A0A096MLP7_PAPAN Loading...

Cysteine-rich and transmembrane domain-containing protein 1

AlphaFold DB (A0A2K6KCB7), UniProt , Accession A0A096MLP7, Species PAPAN (Papio anubis, Olive baboon), Gene CYSTM1, Length 97 aa.

						>A0A096MLP7_PAPAN|A0A096MLP7|CYSTM1
MNQGNPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.3	Very low	62.1	Low	235 Å²	235	135.3 Å²	135.3	100%	1.158	77%	0.774	S	S	*	*				0	130	0	-64.1	173.9	-174.9	0	0	107	Q3	M1-Q3 PolarHBondContact O-N 3.12Å
2	N	51.4	Low	62.4	Low	146 Å²	146	135.8 Å²	135.8	78%	0.781	79%	0.785	S	S	*	*			trans	-60.2	114	-166.3	-170.4	-77.5	0	0	0	111.8	G4	N2-G4 PolarHBondContact O-N 2.97Å; N2-G4 PolarHBondContact OD1-N 3.4Å
3	Q	59.5	Low	62.3	Low	204 Å²	204	129.5 Å²	129.5	95%	0.953	77%	0.769	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.2	17.8	-177.7	-72.6	169.8	-9.4	0	0	113.6	M1	M1-Q3 PolarHBondContact O-N 3.12Å
4	G	62	Low	62.1	Low	61 Å²	61	130 Å²	130	63%	0.629	78%	0.777	S	S	*	*	T	Hydrogen-bonded Turn	trans	-121.1	7.6	-164.1	0	0	0	0	0	117.1	N2	N2-G4 PolarHBondContact O-N 2.97Å; N2-G4 PolarHBondContact OD1-N 3.4Å
5	N	65.1	Low	62.2	Low	131 Å²	131	130.6 Å²	130.6	70%	0.701	78%	0.782	S	S	*	*			trans	-131.2	115.4	179.1	-158.7	10.7	0	0	0	111.5
6	P	67.4	Low	62.2	Low	88 Å²	88	127.8 Å²	127.8	57%	0.571	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-60	149.8	170.1	26.7	-33.4	0	0	0	109.7
7	P	66.3	Low	62.5	Low	109 Å²	109	127.5 Å²	127.5	71%	0.708	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-55.2	142.1	175.7	23.3	-32.2	0	0	0	109.8	Y9	P7-Y9 PolarHBondContact O-N 3.49Å
8	P	71.3	Confident	62.4	Low	121 Å²	121	132.8 Å²	132.8	79%	0.786	78%	0.784	S	S	*	*	P	Polyproline II helix	trans	-56.1	127.6	175.9	-20	29.6	0	0	0	109.6
9	Y	65.4	Low	62.7	Low	211 Å²	211	131.3 Å²	131.3	83%	0.827	78%	0.778	S	S	*	*	P	Polyproline II helix	trans	-57.9	136.4	173.4	-77.1	-86.2	0	0	0	109.5	P7 G11	P7-Y9 PolarHBondContact O-N 3.49Å; Y9-G11 PolarHBondContact O-N 2.87Å; Y9-G11 VanDerWaalsContact O-N 3.08Å
10	P	63.3	Low	63.1	Low	126 Å²	126	131.1 Å²	131.1	82%	0.818	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-55.7	119.3	170.6	-21.4	32	0	0	0	108.9
11	G	63.5	Low	63.3	Low	56 Å²	56	135.4 Å²	135.4	58%	0.577	79%	0.785	S	S	*	*	P	Polyproline II helix	trans	-62.4	165.6	176.8	0	0	0	0	0	111.5	Y9 G13	Y9-G11 PolarHBondContact O-N 2.87Å; Y9-G11 VanDerWaalsContact O-N 3.08Å; G11-G13 PolarHBondContact O-N 3.12Å
12	P	65.4	Low	64.1	Low	141 Å²	141	129.1 Å²	129.1	92%	0.916	76%	0.762	S	S	*	*			trans	-52.3	115.7	174.6	-21.4	31.5	0	0	0	109.3
13	G	61.7	Low	64.7	Low	55 Å²	55	128.1 Å²	128.1	57%	0.567	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-59.2	159.1	178.9	0	0	0	0	0	111	G11 T15	G11-G13 PolarHBondContact O-N 3.12Å; G13-T15 PolarHBondContact O-N 3.46Å
14	P	59	Low	64.9	Low	136 Å²	136	127.1 Å²	127.1	88%	0.883	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-57.8	116.5	179.1	23.1	-31.7	0	0	0	109.7	A16	P14-A16 PolarHBondContact O-N 3.02Å
15	T	63.7	Low	64.5	Low	139 Å²	139	130.3 Å²	130.3	85%	0.853	77%	0.768	S	S	*	*	P	Polyproline II helix	trans	-63.6	119.2	171.5	17.7	0	0	0	0	108.5	G13	G13-T15 PolarHBondContact O-N 3.46Å
16	A	62.3	Low	64	Low	86 Å²	86	133 Å²	133	71%	0.711	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-61.6	139.9	179.8	0	0	0	0	0	110.8	P14	P14-A16 PolarHBondContact O-N 3.02Å
17	P	66.5	Low	63.3	Low	123 Å²	123	131.7 Å²	131.7	80%	0.799	78%	0.781	S	S	*	*	P	Polyproline II helix	trans	-60.9	136.8	172.4	-20.7	31.7	0	0	0	111.1
18	Y	61.2	Low	62.3	Low	222 Å²	222	132.9 Å²	132.9	87%	0.871	79%	0.789	S	S	*	*	P	Polyproline II helix	trans	-60.3	137.8	173.1	-79.9	-88.2	0	0	0	110.5
19	P	67.5	Low	61.3	Low	105 Å²	105	130.2 Å²	130.2	68%	0.682	78%	0.784	S	S	*	*	P	Polyproline II helix	trans	-67.3	147.7	177.7	26.2	-32.3	0	0	0	111.3
20	P	71.2	Confident	60.4	Low	126 Å²	126	126.9 Å²	126.9	82%	0.818	79%	0.788	S	S	*	*	P	Polyproline II helix	trans	-66.8	141.2	176.7	25.7	-31.2	0	0	0	111.1
21	Y	67.8	Low	59.4	Low	222 Å²	222	130 Å²	130	87%	0.871	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-63.4	139.6	176	-75.8	-85.1	0	0	0	111
22	P	64.6	Low	58.3	Low	104 Å²	104	131.2 Å²	131.2	68%	0.675	81%	0.807	S	S	*	*	P	Polyproline II helix	trans	-67.3	143.4	177.8	26.5	-32.6	0	0	0	111.1	Q24	P22-Q24 PolarHBondContact O-N 2.77Å
23	P	64	Low	57.2	Low	125 Å²	125	127 Å²	127	81%	0.812	79%	0.789	S	S	*	*	P	Polyproline II helix	trans	-65.2	126.8	175.2	24	-29.8	0	0	0	110.1
24	Q	64.8	Low	56.7	Low	183 Å²	183	131.1 Å²	131.1	86%	0.855	81%	0.805	S	S	*	*	P	Polyproline II helix	trans	-70.9	130.7	174.1	-60.6	-174.1	-30.2	0	0	109	P22 M26	P22-Q24 PolarHBondContact O-N 2.77Å; Q24-M26 PolarHBondContact O-N 2.82Å; Q24-M26 VanDerWaalsContact O-N 3.13Å
25	P	52.8	Low	56	Low	127 Å²	127	134.6 Å²	134.6	83%	0.825	80%	0.802	S	S	*	*			trans	-68.7	114	178.5	24.1	-29.3	0	0	0	109.8	G27	P25-G27 PolarHBondContact O-N 3.13Å
26	M	55.5	Low	55.4	Low	188 Å²	188	133 Å²	133	93%	0.926	79%	0.794	S	S	*	*			trans	-67.8	96	169.1	-168.2	87.1	76	0	0	108.1	Q24	Q24-M26 PolarHBondContact O-N 2.82Å; Q24-M26 VanDerWaalsContact O-N 3.13Å
27	G	52.6	Low	54.8	Low	60 Å²	60	133.7 Å²	133.7	62%	0.619	79%	0.792	S	S	*	*	P	Polyproline II helix	trans	-69.3	141.3	179	0	0	0	0	0	112	P25 G29	P25-G27 PolarHBondContact O-N 3.13Å; G27-G29 PolarHBondContact O-N 3.45Å
28	P	44.6	Very low	54.1	Low	134 Å²	134	134 Å²	134	87%	0.87	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-67.3	130	174.2	-14.1	27.9	0	0	0	111
29	G	49.7	Very low	53.6	Low	66 Å²	66	131.1 Å²	131.1	68%	0.68	79%	0.788	S	S	*	*	P	Polyproline II helix	trans	-63.8	157.3	173.2	0	0	0	0	0	113.1	G27 M31	G27-G29 PolarHBondContact O-N 3.45Å; G29-M31 PolarHBondContact O-N 2.79Å
30	P	46.8	Very low	53	Low	141 Å²	141	129.7 Å²	129.7	92%	0.916	79%	0.793	S	S	*	*			trans	-83.3	114.5	-170.2	31.7	-31.5	0	0	0	111.3
31	M	41.4	Very low	51.5	Low	190 Å²	190	133.7 Å²	133.7	94%	0.936	79%	0.793	S	S	*	*			trans	-123.7	102.4	167.6	-151.5	177.1	-174	0	0	109.8	G29	G29-M31 PolarHBondContact O-N 2.79Å
32	G	41.7	Very low	50.4	Low	83 Å²	83	128.5 Å²	128.5	86%	0.856	79%	0.786	S	S	*	*			trans	57.2	115.8	144.8	0	0	0	0	0	121.1
33	G	42.2	Very low	49.4	Very low	53 Å²	53	134 Å²	134	55%	0.546	80%	0.795	S	S	.	*			trans	150.4	136.5	150.1	0	0	0	0	0	115.2	Y35	G33-Y35 PolarHBondContact O-N 3.35Å; G33-Y35 VanDerWaalsContact O-N 3.12Å
34	P	50.2	Low	48.8	Very low	140 Å²	140	136.8 Å²	136.8	91%	0.909	80%	0.797	S	S	*	*			trans	-81.9	87.6	177.7	32.7	-30.7	0	0	0	110.3
35	Y	45.5	Very low	48.1	Very low	210 Å²	210	130.5 Å²	130.5	82%	0.824	78%	0.781	S	S	*	*	P	Polyproline II helix	trans	-88.5	142.1	172.9	-82.5	-90.2	0	0	0	111.3	G33	G33-Y35 PolarHBondContact O-N 3.35Å; G33-Y35 VanDerWaalsContact O-N 3.12Å
36	P	51.2	Low	47.6	Very low	104 Å²	104	133.9 Å²	133.9	68%	0.675	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-61.4	152.2	175.1	26.5	-34	0	0	0	111.1
37	P	49.5	Very low	47.2	Very low	102 Å²	102	129 Å²	129	66%	0.662	76%	0.762	S	S	*	*	P	Polyproline II helix	trans	-61.3	130.8	-176.7	25.4	-33.1	0	0	0	109.5	Q39	P37-Q39 PolarHBondContact O-N 2.98Å
38	P	50.5	Low	46.9	Very low	130 Å²	130	134.3 Å²	134.3	84%	0.844	77%	0.77	S	S	*	*			trans	-61.6	111.9	176.5	21.4	-28.5	0	0	0	108.8	G40	P38-G40 PolarHBondContact O-N 2.97Å
39	Q	51.2	Low	47.4	Very low	161 Å²	161	137.1 Å²	137.1	75%	0.752	77%	0.765	S	S	*	*			trans	-55	135.5	169.2	-67.1	-70.4	-29.6	0	0	108.3	P37 Y41	P37-Q39 PolarHBondContact O-N 2.98Å; Q39-Y41 PolarHBondContact O-N 2.73Å; Q39-Y41 VanDerWaalsContact O-N 3.12Å
40	G	54.4	Low	47.5	Very low	75 Å²	75	136.3 Å²	136.3	77%	0.773	76%	0.757	S	S	*	*			trans	-49.1	114.1	-167	0	0	0	0	0	113.8	P38	P38-G40 PolarHBondContact O-N 2.97Å
41	Y	41	Very low	47.2	Very low	209 Å²	209	141.5 Å²	141.5	82%	0.82	76%	0.758	S	S	*	*			trans	-93.8	123.7	153	-83.3	-93.6	0	0	0	107.1	Q39 Y43	Q39-Y41 PolarHBondContact O-N 2.73Å; Q39-Y41 VanDerWaalsContact O-N 3.12Å; Y41-Y43 VanDerWaalsContact C-N 3.26Å; Y41-Y43 PolarHBondContact O-N 3.13Å
42	P	44.5	Very low	47.8	Very low	113 Å²	113	142.1 Å²	142.1	73%	0.734	76%	0.758	S	S	*	*			trans	-64.8	100.4	161.6	27.3	-29.1	0	0	0	105.7	Q44	P42-Q44 PolarHBondContact O-N 3.04Å
43	Y	42.7	Very low	48.4	Very low	219 Å²	219	141.9 Å²	141.9	86%	0.859	76%	0.756	S	S	*	*			trans	-61.9	92.3	171.5	-138.5	-94.1	0	0	0	106	Y41 G45	Y41-Y43 VanDerWaalsContact C-N 3.26Å; Y41-Y43 PolarHBondContact O-N 3.13Å; Y43-G45 PolarHBondContact O-N 3.31Å
44	Q	52.6	Low	48.9	Very low	185 Å²	185	142.1 Å²	142.1	86%	0.864	76%	0.759	S	S	*	*			trans	-68.9	79.1	161	-73.7	-179.2	-12.8	0	0	105.4	P42 Y46	P42-Q44 PolarHBondContact O-N 3.04Å; Q44-Y46 PolarHBondContact O-N 3.25Å
45	G	49.6	Very low	48.7	Very low	50 Å²	50	141.7 Å²	141.7	52%	0.515	76%	0.756	S	S	.	*			trans	-57.3	134.5	174	0	0	0	0	0	108.6	Y43	Y43-G45 PolarHBondContact O-N 3.31Å
46	Y	42.5	Very low	49.2	Very low	198 Å²	198	140.1 Å²	140.1	78%	0.776	76%	0.756	S	S	*	*			trans	-34.6	142.4	168.7	-87	-104.3	0	0	0	111.9	Q44 Q48	Q44-Y46 PolarHBondContact O-N 3.25Å; Y46-Q48 PolarHBondContact O-N 2.74Å
47	P	47.1	Very low	49.6	Very low	87 Å²	87	143.2 Å²	143.2	57%	0.565	76%	0.762	S	S	*	*			trans	-58.9	102.1	172.6	23.4	-30.3	0	0	0	108.5	Y49	P47-Y49 VanDerWaalsContact C-N 3.3Å; P47-Y49 HydrophobicContact CB-CD1 4.44Å; P47-Y49 HydrophobicContact CB-CE1 4.07Å; P47-Y49 HydrophobicContact CG-CE1 3.81Å; P47-Y49 WeakPolarHBondContact O-CD1 3.24Å; P47-Y49 WeakPolarHBondContact O-CD2 3.4Å; P47-Y49 VanDerWaalsContact O-CE1 3.24Å; P47-Y49 WeakPolarHBondContact O-CE1 3.35Å; P47-Y49 WeakPolarHBondContact O-CE2 3.18Å; P47-Y49 PolarHBondContact O-N 3.05Å
48	Q	46.5	Very low	49.9	Very low	170 Å²	170	142.9 Å²	142.9	79%	0.794	76%	0.759	S	S	*	*			trans	-72	93	171.2	-106.5	-80.2	3.1	0	0	106.4	Y46 G50	Y46-Q48 PolarHBondContact O-N 2.74Å; Q48-G50 VanDerWaalsContact C-N 3.31Å; Q48-G50 PolarHBondContact O-N 3.44Å
49	Y	54.2	Low	50.4	Low	194 Å²	194	140.3 Å²	140.3	76%	0.761	74%	0.743	S	S	*	*			trans	-63.7	93.6	166.8	-12.3	-95	0	0	0	107.3	P47	P47-Y49 VanDerWaalsContact C-N 3.3Å; P47-Y49 HydrophobicContact CB-CD1 4.44Å; P47-Y49 HydrophobicContact CB-CE1 4.07Å; P47-Y49 HydrophobicContact CG-CE1 3.81Å; P47-Y49 WeakPolarHBondContact O-CD1 3.24Å; P47-Y49 WeakPolarHBondContact O-CD2 3.4Å; P47-Y49 VanDerWaalsContact O-CE1 3.24Å; P47-Y49 WeakPolarHBondContact O-CE1 3.35Å; P47-Y49 WeakPolarHBondContact O-CE2 3.18Å; P47-Y49 PolarHBondContact O-N 3.05Å
50	G	52.5	Low	50.7	Low	49 Å²	49	142.2 Å²	142.2	51%	0.505	75%	0.748	S	S	.	*			trans	-175.3	110.9	-179.5	0	0	0	0	0	113.5	Q48	Q48-G50 VanDerWaalsContact C-N 3.31Å; Q48-G50 PolarHBondContact O-N 3.44Å
51	W	41.2	Very low	50.9	Low	249 Å²	249	143.3 Å²	143.3	94%	0.943	74%	0.74	S	S	*	*			trans	95.2	84.5	175.5	-56	105.1	0	0	0	116.7	G53	W51-G53 PolarHBondContact O-N 3.17Å
52	Q	52.4	Low	51.6	Low	203 Å²	203	136.3 Å²	136.3	95%	0.949	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.8	118	156.8	-70.7	-177.8	12.4	0	0	109.5
53	G	54.2	Low	52.3	Low	78 Å²	78	135.1 Å²	135.1	80%	0.804	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	128.2	3.2	162.3	0	0	0	0	0	117.6	W51	W51-G53 PolarHBondContact O-N 3.17Å
54	G	53.4	Low	53	Low	59 Å²	59	133.2 Å²	133.2	61%	0.608	70%	0.702	S	S	*	*	S	Bend	trans	-74.6	140	162.7	0	0	0	0	0	109.9	Q56	G54-Q56 VanDerWaalsContact C-N 3.29Å; G54-Q56 PolarHBondContact O-N 3.27Å
55	P	46.1	Very low	53.4	Low	131 Å²	131	129.2 Å²	129.2	85%	0.851	69%	0.691	S	S	*	*			trans	-58.5	96.3	172.2	-19	30.5	0	0	0	108.7	E57	P55-E57 PolarHBondContact O-N 3.37Å
56	Q	55.1	Low	54	Low	176 Å²	176	130.2 Å²	130.2	82%	0.822	69%	0.686	S	S	*	*			trans	-59	114.3	169.3	-176.2	167	-6.7	0	0	105.2	G54 P58	G54-Q56 VanDerWaalsContact C-N 3.29Å; G54-Q56 PolarHBondContact O-N 3.27Å; Q56-P58 WeakPolarHBondContact O-CD 3.45Å
57	E	61.3	Low	54.8	Low	170 Å²	170	126.7 Å²	126.7	79%	0.794	68%	0.677	S	S	*	*	P	Polyproline II helix	trans	-47.9	118.8	179.5	-65.9	178.3	143.9	0	0	107.2	P55	P55-E57 PolarHBondContact O-N 3.37Å
58	P	55.8	Low	55.4	Low	94 Å²	94	127.3 Å²	127.3	61%	0.61	68%	0.675	S	S	*	*	P	Polyproline II helix	trans	-56.8	131.5	-173.4	18.4	-29.1	0	0	0	107.7	Q56 K60	Q56-P58 WeakPolarHBondContact O-CD 3.45Å; P58-K60 PolarHBondContact O-N 3.17Å; P58-K60 VanDerWaalsContact O-N 3.13Å
59	P	61.1	Low	55.9	Low	76 Å²	76	125 Å²	125	49%	0.494	67%	0.665	S	S	.	*	P	Polyproline II helix	trans	-48.6	127.7	173.2	-24.4	31.4	0	0	0	108.2	T61 T62	P59-T61 PolarHBondContact O-N 3.38Å; P59-T62 HydrophobicContact CB-CG2 4.22Å; P59-T62 HydrophobicContact CG-CG2 4.33Å; P59-T62 WeakPolarHBondContact O-CG2 3.47Å; P59-T62 PolarHBondContact O-N 3.11Å; P59-T62 PolarHBondContact O-OG1 3.5Å
60	K	57	Low	56.1	Low	201 Å²	201	124.2 Å²	124.2	87%	0.874	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.2	8.3	-177.2	-77.6	154.3	179.5	168.5	0	114.2	P58	P58-K60 PolarHBondContact O-N 3.17Å; P58-K60 VanDerWaalsContact O-N 3.13Å
61	T	57.7	Low	56.5	Low	98 Å²	98	131.3 Å²	131.3	60%	0.601	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.2	-6.6	179.8	54.3	0	0	0	0	113.6	P59 V63	P59-T61 PolarHBondContact O-N 3.38Å; T61-V63 VanDerWaalsContact C-N 3.29Å; T61-V63 PolarHBondContact O-N 3.1Å
62	T	57.1	Low	57.4	Low	63 Å²	63	124.2 Å²	124.2	39%	0.387	65%	0.653	S	S	.	*	H	α-helix	trans	-72.1	-20.2	-176.5	57.5	0	0	0	0	114	P59 V66	P59-T62 HydrophobicContact CB-CG2 4.22Å; P59-T62 HydrophobicContact CG-CG2 4.33Å; P59-T62 WeakPolarHBondContact O-CG2 3.47Å; P59-T62 PolarHBondContact O-N 3.11Å; P59-T62 PolarHBondContact O-OG1 3.5Å; T62-V66 WeakPolarHBondContact O-CG2 3.37Å
63	V	59.3	Low	57.7	Low	88 Å²	88	121.5 Å²	121.5	53%	0.533	64%	0.64	S	S	.	*	H	α-helix	trans	-70.3	-40.3	-178.8	-175.5	0	0	0	0	111.1	T61 V65 V66 E67	T61-V63 VanDerWaalsContact C-N 3.29Å; T61-V63 PolarHBondContact O-N 3.1Å; V63-V65 PolarHBondContact O-N 2.88Å; V63-V66 PolarHBondContact O-N 3.03Å; V63-E67 PolarHBondContact O-N 3.03Å
64	Y	56.8	Low	58.1	Low	178 Å²	178	122.4 Å²	122.4	70%	0.698	63%	0.626	S	S	*	*	H	α-helix	trans	-66.9	-37.7	-176.6	-73.7	-78.8	0	0	0	113.1	D68	Y64-D68 WeakPolarHBondContact O-CB 3.44Å; Y64-D68 PolarHBondContact O-N 3.33Å
65	V	61.3	Low	58.7	Low	102 Å²	102	121.4 Å²	121.4	62%	0.618	62%	0.616	S	S	*	*	H	α-helix	trans	-69.7	-35.2	-179.3	-176.8	0	0	0	0	111.4	V63 Q69	V63-V65 PolarHBondContact O-N 2.88Å; V65-Q69 WeakPolarHBondContact O-CB 3.34Å; V65-Q69 PolarHBondContact O-N 2.98Å; V65-Q69 VanDerWaalsContact O-N 3.1Å
66	V	61.7	Low	59.9	Low	70 Å²	70	118.4 Å²	118.4	42%	0.424	60%	0.596	S	S	.	*	H	α-helix	trans	-73.9	-39.7	-179.6	174.5	0	0	0	0	111.6	T62 V63 R70	T62-V66 WeakPolarHBondContact O-CG2 3.37Å; V63-V66 PolarHBondContact O-N 3.03Å; V66-R70 WeakPolarHBondContact O-CG 3.39Å; V66-R70 PolarHBondContact O-N 3.07Å
67	E	59.4	Low	60.4	Low	124 Å²	124	112.7 Å²	112.7	58%	0.579	58%	0.575	S	S	*	*	H	α-helix	trans	-66.7	-40.9	177.1	-72	-171.4	132.6	0	0	112.1	V63 R70 R71	V63-E67 PolarHBondContact O-N 3.03Å; E67-R70 PolarHBondContact O-N 2.91Å; E67-R71 WeakPolarHBondContact O-CB 3.45Å; E67-R71 PolarHBondContact O-N 3.38Å; E67-R71 VanDerWaalsContact O-N 3.11Å
68	D	59.5	Low	61	Low	100 Å²	100	108.2 Å²	108.2	54%	0.535	56%	0.56	S	S	.	*	H	α-helix	trans	-61.4	-50.5	175.7	-162.8	-126.5	0	0	0	110.8	Y64 R70 R71 D72	Y64-D68 WeakPolarHBondContact O-CB 3.44Å; Y64-D68 PolarHBondContact O-N 3.33Å; D68-R70 PolarHBondContact O-N 3.47Å; D68-R71 WeakPolarHBondContact O-CB 3.31Å; D68-R71 PolarHBondContact O-N 3.03Å; D68-D72 PolarHBondContact O-N 3.1Å
69	Q	57	Low	62.1	Low	123 Å²	123	107.3 Å²	107.3	58%	0.575	56%	0.555	S	S	*	*	H	α-helix	trans	-59.3	-42.3	178.4	-173.6	179.9	23.3	0	0	113.3	V65 R71 E73	V65-Q69 WeakPolarHBondContact O-CB 3.34Å; V65-Q69 PolarHBondContact O-N 2.98Å; V65-Q69 VanDerWaalsContact O-N 3.1Å; Q69-R71 VanDerWaalsContact C-N 3.3Å; Q69-R71 PolarHBondContact O-N 2.63Å; Q69-E73 PolarHBondContact O-N 3.14Å; Q69-E73 VanDerWaalsContact O-N 3.1Å
70	R	58.4	Low	62.9	Low	176 Å²	176	109.5 Å²	109.5	66%	0.664	56%	0.562	S	S	*	*	H	α-helix	trans	-63.8	-40.2	176.2	-71.6	-147.8	-153.5	-106.3	6.7	111	V66 E67 D68 L74	V66-R70 WeakPolarHBondContact O-CG 3.39Å; V66-R70 PolarHBondContact O-N 3.07Å; E67-R70 PolarHBondContact O-N 2.91Å; D68-R70 PolarHBondContact O-N 3.47Å; R70-L74 HydrophobicContact CB-CD1 4.38Å; R70-L74 VanDerWaalsContact O-CB 3.31Å; R70-L74 WeakPolarHBondContact O-CB 3.4Å; R70-L74 WeakPolarHBondContact O-CD1 3.13Å; R70-L74 WeakPolarHBondContact O-CG 3.05Å; R70-L74 PolarHBondContact O-N 3.08Å
71	R	60	Low	64.1	Low	199 Å²	199	104 Å²	104	75%	0.751	55%	0.545	S	S	*	.	H	α-helix	trans	-69.5	-37.5	-178.1	-154.8	171.6	-173.2	158.3	0.3	111.9	E67 D68 Q69 L74 G75	E67-R71 WeakPolarHBondContact O-CB 3.45Å; E67-R71 PolarHBondContact O-N 3.38Å; E67-R71 VanDerWaalsContact O-N 3.11Å; D68-R71 WeakPolarHBondContact O-CB 3.31Å; D68-R71 PolarHBondContact O-N 3.03Å; Q69-R71 VanDerWaalsContact C-N 3.3Å; Q69-R71 PolarHBondContact O-N 2.63Å; R71-L74 PolarHBondContact O-N 2.89Å; R71-G75 PolarHBondContact O-N 3.24Å
72	D	60.5	Low	65	Low	100 Å²	100	102 Å²	102	54%	0.535	54%	0.538	S	S	.	.	H	α-helix	trans	-72.3	-29.1	176.4	-74.3	-37.2	0	0	0	113.8	D68 P76	D68-D72 PolarHBondContact O-N 3.1Å; D72-P76 WeakPolarHBondContact O-CD 3.03Å; D72-P76 WeakPolarHBondContact O-CG 2.79Å
73	E	59.7	Low	66.2	Low	145 Å²	145	102.4 Å²	102.4	68%	0.678	54%	0.543	S	S	*	.	H	α-helix	trans	-78.1	-32.7	169.6	-78.6	-139.4	113.5	0	0	112.2	Q69 S77	Q69-E73 PolarHBondContact O-N 3.14Å; Q69-E73 VanDerWaalsContact O-N 3.1Å; E73-S77 VanDerWaalsContact O-CB 3.3Å; E73-S77 WeakPolarHBondContact O-CB 3.44Å; E73-S77 PolarHBondContact O-N 2.63Å; E73-S77 PolarHBondContact O-OG 3.46Å
74	L	62	Low	67.5	Low	98 Å²	98	107.7 Å²	107.7	51%	0.513	55%	0.554	S	S	.	*	H	α-helix	trans	-70.5	-37.3	176.5	-75	155.1	0	0	0	111.9	R70 R71 S77 T78	R70-L74 HydrophobicContact CB-CD1 4.38Å; R70-L74 VanDerWaalsContact O-CB 3.31Å; R70-L74 WeakPolarHBondContact O-CB 3.4Å; R70-L74 WeakPolarHBondContact O-CD1 3.13Å; R70-L74 WeakPolarHBondContact O-CG 3.05Å; R70-L74 PolarHBondContact O-N 3.08Å; R71-L74 PolarHBondContact O-N 2.89Å; L74-S77 WeakPolarHBondContact CA-OG 3.2Å; L74-S77 PolarHBondContact O-OG 3.02Å; L74-T78 WeakPolarHBondContact O-CB 3.16Å; L74-T78 WeakPolarHBondContact O-CG2 3.24Å; L74-T78 PolarHBondContact O-N 3.18Å; L74-T78 PolarHBondContact O-OG1 3.08Å
75	G	66.3	Low	69	Low	38 Å²	38	102.8 Å²	102.8	39%	0.392	54%	0.542	S	S	.	.	H	α-helix	trans	-56.3	-57.9	-179.6	0	0	0	0	0	115.5	R71 T78 C79	R71-G75 PolarHBondContact O-N 3.24Å; G75-T78 PolarHBondContact O-OG1 2.85Å; G75-T78 VanDerWaalsContact O-OG1 3.08Å; G75-C79 WeakPolarHBondContact O-CB 3.3Å; G75-C79 PolarHBondContact O-N 2.93Å; G75-C79 VanDerWaalsContact O-N 3.14Å
76	P	70.1	Confident	70.1	Confident	67 Å²	67	100.5 Å²	100.5	44%	0.435	53%	0.534	S	S	.	.	H	α-helix	trans	-73.8	-33.8	-179.9	26	-29	0	0	0	112.7	D72 C79 L80	D72-P76 WeakPolarHBondContact O-CD 3.03Å; D72-P76 WeakPolarHBondContact O-CG 2.79Å; P76-C79 VanDerWaalsContact CA-SG 3.57Å; P76-C79 PolarHBondContact O-SG 3.46Å; P76-L80 VanDerWaalsContact O-CB 3.29Å; P76-L80 WeakPolarHBondContact O-CB 3.29Å; P76-L80 WeakPolarHBondContact O-CD1 3.37Å; P76-L80 WeakPolarHBondContact O-CG 3.46Å; P76-L80 PolarHBondContact O-N 2.82Å
77	S	66.7	Low	71.1	Confident	56 Å²	56	102.1 Å²	102.1	39%	0.392	54%	0.54	S	S	.	.	H	α-helix	trans	-71	-37.6	177.3	61.8	0	0	0	0	112.5	E73 L74 T81	E73-S77 VanDerWaalsContact O-CB 3.3Å; E73-S77 WeakPolarHBondContact O-CB 3.44Å; E73-S77 PolarHBondContact O-N 2.63Å; E73-S77 PolarHBondContact O-OG 3.46Å; L74-S77 WeakPolarHBondContact CA-OG 3.2Å; L74-S77 PolarHBondContact O-OG 3.02Å; S77-T81 VanDerWaalsContact O-CB 3.24Å; S77-T81 WeakPolarHBondContact O-CB 3.47Å; S77-T81 PolarHBondContact O-N 2.69Å; S77-T81 PolarHBondContact O-OG1 2.95Å
78	T	74.1	Confident	72.3	Confident	77 Å²	77	99.1 Å²	99.1	47%	0.472	53%	0.531	S	S	.	.	H	α-helix	trans	-71.2	-39.2	175.5	57.7	0	0	0	0	111.9	L74 G75 T81 A82	L74-T78 WeakPolarHBondContact O-CB 3.16Å; L74-T78 WeakPolarHBondContact O-CG2 3.24Å; L74-T78 PolarHBondContact O-N 3.18Å; L74-T78 PolarHBondContact O-OG1 3.08Å; G75-T78 PolarHBondContact O-OG1 2.85Å; G75-T78 VanDerWaalsContact O-OG1 3.08Å; T78-T81 PolarHBondContact O-N 2.85Å; T78-A82 WeakPolarHBondContact O-CB 3.28Å; T78-A82 PolarHBondContact O-N 3.44Å
79	C	78.1	Confident	73.4	Confident	74 Å²	74	97.9 Å²	97.9	50%	0.5	53%	0.53	S	S	.	.	H	α-helix	trans	-69.2	-39.1	177.6	80.6	0	0	0	0	112	G75 P76 C83	G75-C79 WeakPolarHBondContact O-CB 3.3Å; G75-C79 PolarHBondContact O-N 2.93Å; G75-C79 VanDerWaalsContact O-N 3.14Å; P76-C79 VanDerWaalsContact CA-SG 3.57Å; P76-C79 PolarHBondContact O-SG 3.46Å; C79-C83 WeakPolarHBondContact O-CB 3.18Å; C79-C83 PolarHBondContact O-N 3.37Å
80	L	77.6	Confident	74.6	Confident	122 Å²	122	96 Å²	96	64%	0.639	53%	0.529	S	S	*	.	H	α-helix	trans	-65.7	-42.9	173.9	-74	171.8	0	0	0	111.5	P76 C83 W84	P76-L80 VanDerWaalsContact O-CB 3.29Å; P76-L80 WeakPolarHBondContact O-CB 3.29Å; P76-L80 WeakPolarHBondContact O-CD1 3.37Å; P76-L80 WeakPolarHBondContact O-CG 3.46Å; P76-L80 PolarHBondContact O-N 2.82Å; L80-C83 PolarHBondContact O-N 3.23Å; L80-W84 VanDerWaalsContact O-CB 3.28Å; L80-W84 WeakPolarHBondContact O-CB 3.15Å; L80-W84 PolarHBondContact O-N 3.36Å
81	T	82.1	Confident	75.5	Confident	87 Å²	87	91.4 Å²	91.4	53%	0.534	52%	0.523	S	S	.	.	H	α-helix	trans	-64.4	-46.2	176.7	-58.6	0	0	0	0	111.2	S77 T78 W84 T85	S77-T81 VanDerWaalsContact O-CB 3.24Å; S77-T81 WeakPolarHBondContact O-CB 3.47Å; S77-T81 PolarHBondContact O-N 2.69Å; S77-T81 PolarHBondContact O-OG1 2.95Å; T78-T81 PolarHBondContact O-N 2.85Å; T81-W84 PolarHBondContact O-N 2.93Å; T81-T85 HydrophobicContact CG2-CG2 4.48Å; T81-T85 VanDerWaalsContact O-CG2 3.28Å; T81-T85 WeakPolarHBondContact O-CG2 3.2Å; T81-T85 PolarHBondContact O-N 3.37Å; T81-T85 PolarHBondContact O-OG1 3.14Å
82	A	78.2	Confident	76.1	Confident	54 Å²	54	87.2 Å²	87.2	45%	0.446	52%	0.515	S	S	.	.	H	α-helix	trans	-61.2	-46.4	176.2	0	0	0	0	0	111.5	T78 W84 T85 A86	T78-A82 WeakPolarHBondContact O-CB 3.28Å; T78-A82 PolarHBondContact O-N 3.44Å; A82-W84 PolarHBondContact O-N 2.94Å; A82-T85 WeakPolarHBondContact CA-OG1 3.5Å; A82-T85 PolarHBondContact O-N 3.42Å; A82-T85 PolarHBondContact O-OG1 3.44Å; A82-A86 WeakPolarHBondContact O-CB 3.33Å; A82-A86 PolarHBondContact O-N 2.87Å
83	C	80.9	Confident	76.7	Confident	72 Å²	72	92.1 Å²	92.1	49%	0.486	53%	0.526	S	S	.	.	H	α-helix	trans	-61.8	-43.3	177.7	-170	0	0	0	0	111.8	C79 L80 A86 L87	C79-C83 WeakPolarHBondContact O-CB 3.18Å; C79-C83 PolarHBondContact O-N 3.37Å; L80-C83 PolarHBondContact O-N 3.23Å; C83-A86 PolarHBondContact O-N 3.2Å; C83-L87 WeakPolarHBondContact O-CB 3.45Å; C83-L87 WeakPolarHBondContact O-CG 3.28Å; C83-L87 PolarHBondContact O-N 3.45Å
84	W	87.5	Confident	77.4	Confident	200 Å²	200	90.8 Å²	90.8	76%	0.758	52%	0.524	S	S	*	.	H	α-helix	trans	-63.9	-44.5	177.3	-170.2	-83.9	0	0	0	112.4	L80 T81 A82 L87 C88	L80-W84 VanDerWaalsContact O-CB 3.28Å; L80-W84 WeakPolarHBondContact O-CB 3.15Å; L80-W84 PolarHBondContact O-N 3.36Å; T81-W84 PolarHBondContact O-N 2.93Å; A82-W84 PolarHBondContact O-N 2.94Å; W84-L87 PolarHBondContact O-N 2.93Å; W84-C88 WeakPolarHBondContact O-CB 3.47Å; W84-C88 PolarHBondContact O-N 3.03Å
85	T	87.4	Confident	77.7	Confident	75 Å²	75	94 Å²	94	46%	0.46	54%	0.539	S	S	.	.	H	α-helix	trans	-64.8	-41.3	177.3	57.6	0	0	0	0	111.9	T81 A82 C88 C89	T81-T85 HydrophobicContact CG2-CG2 4.48Å; T81-T85 VanDerWaalsContact O-CG2 3.28Å; T81-T85 WeakPolarHBondContact O-CG2 3.2Å; T81-T85 PolarHBondContact O-N 3.37Å; T81-T85 PolarHBondContact O-OG1 3.14Å; A82-T85 WeakPolarHBondContact CA-OG1 3.5Å; A82-T85 PolarHBondContact O-N 3.42Å; A82-T85 PolarHBondContact O-OG1 3.44Å; T85-C88 PolarHBondContact O-N 3.47Å; T85-C89 WeakPolarHBondContact O-CB 3.33Å; T85-C89 PolarHBondContact O-N 2.92Å; T85-C89 PolarHBondContact O-SG 2.9Å
86	A	84.2	Confident	77.8	Confident	53 Å²	53	99.9 Å²	99.9	44%	0.438	56%	0.56	S	S	.	*	H	α-helix	trans	-62.4	-47.5	175.9	0	0	0	0	0	111.6	A82 C83 C88 C89 C90	A82-A86 WeakPolarHBondContact O-CB 3.33Å; A82-A86 PolarHBondContact O-N 2.87Å; C83-A86 PolarHBondContact O-N 3.2Å; A86-C88 VanDerWaalsContact C-N 3.34Å; A86-C88 PolarHBondContact O-N 3.37Å; A86-C89 PolarHBondContact O-N 3.45Å; A86-C90 PolarHBondContact O-N 3.3Å; A86-C90 PolarHBondContact O-SG 3.26Å
87	L	83.8	Confident	77.6	Confident	105 Å²	105	104.3 Å²	104.3	55%	0.55	59%	0.586	S	S	.	*	H	α-helix	trans	-59.6	-43.9	175.6	-74.5	169.8	0	0	0	111.8	C83 W84 C90 C91	C83-L87 WeakPolarHBondContact O-CB 3.45Å; C83-L87 WeakPolarHBondContact O-CG 3.28Å; C83-L87 PolarHBondContact O-N 3.45Å; W84-L87 PolarHBondContact O-N 2.93Å; L87-C90 PolarHBondContact O-N 3.44Å; L87-C91 PolarHBondContact O-N 2.91Å; L87-C91 PolarHBondContact O-SG 3.2Å
88	C	85.3	Confident	78.2	Confident	60 Å²	60	106.8 Å²	106.8	41%	0.405	60%	0.596	S	S	.	*	H	α-helix	trans	-62.2	-44.6	177.2	-173.3	0	0	0	0	112	W84 T85 A86 C91 L92	W84-C88 WeakPolarHBondContact O-CB 3.47Å; W84-C88 PolarHBondContact O-N 3.03Å; T85-C88 PolarHBondContact O-N 3.47Å; A86-C88 VanDerWaalsContact C-N 3.34Å; A86-C88 PolarHBondContact O-N 3.37Å; C88-C91 PolarHBondContact O-N 2.99Å; C88-L92 WeakPolarHBondContact O-CB 3.28Å; C88-L92 VanDerWaalsContact O-CG 3.28Å; C88-L92 WeakPolarHBondContact O-CG 3.46Å; C88-L92 PolarHBondContact O-N 3.36Å
89	C	81.4	Confident	78.4	Confident	74 Å²	74	108.3 Å²	108.3	50%	0.5	60%	0.602	S	S	.	*	H	α-helix	trans	-63.5	-41.8	176.3	-77.2	0	0	0	0	112.6	T85 A86 L92 W93	T85-C89 WeakPolarHBondContact O-CB 3.33Å; T85-C89 PolarHBondContact O-N 2.92Å; T85-C89 PolarHBondContact O-SG 2.9Å; A86-C89 PolarHBondContact O-N 3.45Å; C89-L92 PolarHBondContact O-N 3.02Å; C89-W93 PolarHBondContact O-N 3.42Å
90	C	82.2	Confident	78.4	Confident	84 Å²	84	110.2 Å²	110.2	57%	0.568	61%	0.608	S	S	*	*	H	α-helix	trans	-61.8	-45.8	176.8	-68	0	0	0	0	111.6	A86 L87 L92 W93 D94	A86-C90 PolarHBondContact O-N 3.3Å; A86-C90 PolarHBondContact O-SG 3.26Å; L87-C90 PolarHBondContact O-N 3.44Å; C90-L92 VanDerWaalsContact C-N 3.33Å; C90-L92 PolarHBondContact O-N 3.24Å; C90-W93 PolarHBondContact O-N 3.16Å; C90-D94 VanDerWaalsContact O-CB 3.29Å; C90-D94 WeakPolarHBondContact O-CB 3.45Å; C90-D94 PolarHBondContact O-N 3.19Å
91	C	78.3	Confident	78.4	Confident	80 Å²	80	109.5 Å²	109.5	54%	0.541	61%	0.606	S	S	.	*	H	α-helix	trans	-65.4	-35.7	178.4	-64.1	0	0	0	0	112.7	L87 C88 M95	L87-C91 PolarHBondContact O-N 2.91Å; L87-C91 PolarHBondContact O-SG 3.2Å; C88-C91 PolarHBondContact O-N 2.99Å; C91-M95 WeakPolarHBondContact O-CG 3.36Å; C91-M95 PolarHBondContact O-N 3.15Å; C91-M95 VanDerWaalsContact O-N 3.15Å
92	L	71.4	Confident	78.2	Confident	110 Å²	110	110.9 Å²	110.9	58%	0.576	61%	0.611	S	S	*	*	H	α-helix	trans	-70	-37.1	177.2	-74.9	167.1	0	0	0	112	C88 C89 C90 L96	C88-L92 WeakPolarHBondContact O-CB 3.28Å; C88-L92 VanDerWaalsContact O-CG 3.28Å; C88-L92 WeakPolarHBondContact O-CG 3.46Å; C88-L92 PolarHBondContact O-N 3.36Å; C89-L92 PolarHBondContact O-N 3.02Å; C90-L92 VanDerWaalsContact C-N 3.33Å; C90-L92 PolarHBondContact O-N 3.24Å; L92-L96 WeakPolarHBondContact O-CB 3.35Å; L92-L96 PolarHBondContact O-N 3.18Å
93	W	74.2	Confident	78.2	Confident	203 Å²	203	114.7 Å²	114.7	77%	0.769	62%	0.622	S	S	*	*	H	α-helix	trans	-71.9	-39.2	174.8	-87.8	58.7	0	0	0	112.3	C89 C90 M95 L96 T97	C89-W93 PolarHBondContact O-N 3.42Å; C90-W93 PolarHBondContact O-N 3.16Å; W93-M95 VanDerWaalsContact C-N 3.31Å; W93-M95 PolarHBondContact O-N 3.44Å; W93-L96 PolarHBondContact O-N 3.33Å; W93-L96 VanDerWaalsContact O-N 3.16Å; W93-T97 WeakPolarHBondContact O-CG2 3.29Å; W93-T97 PolarHBondContact O-N 3.33Å
94	D	73.8	Confident	78	Confident	118 Å²	118	117.8 Å²	117.8	63%	0.631	63%	0.631	S	S	*	*	H	α-helix	trans	-65.3	-31.5	178.1	-169.6	65	0	0	0	112.9	C90	C90-D94 VanDerWaalsContact O-CB 3.29Å; C90-D94 WeakPolarHBondContact O-CB 3.45Å; C90-D94 PolarHBondContact O-N 3.19Å
95	M	68.1	Low	77.3	Confident	166 Å²	166	111.5 Å²	111.5	82%	0.818	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.6	-17.2	173.8	-72.2	-72.2	-152.6	0	0	114	C91 W93	C91-M95 WeakPolarHBondContact O-CG 3.36Å; C91-M95 PolarHBondContact O-N 3.15Å; C91-M95 VanDerWaalsContact O-N 3.15Å; W93-M95 VanDerWaalsContact C-N 3.31Å; W93-M95 PolarHBondContact O-N 3.44Å
96	L	68.4	Low	76.4	Confident	160 Å²	160	114.5 Å²	114.5	84%	0.838	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.8	-7.8	-178.8	-152.1	77.8	0	0	0	112.6	L92 W93	L92-L96 WeakPolarHBondContact O-CB 3.35Å; L92-L96 PolarHBondContact O-N 3.18Å; W93-L96 PolarHBondContact O-N 3.33Å; W93-L96 VanDerWaalsContact O-N 3.16Å
97	T	66.1	Low	75.7	Confident	161 Å²	161	120.1 Å²	120.1	99%	0.988	65%	0.653	S	S	*	*			trans	-104.7	0	171.8	-173.4	0	0	0	0	111.6	W93	W93-T97 WeakPolarHBondContact O-CG2 3.29Å; W93-T97 PolarHBondContact O-N 3.33Å

Retrieved 97 of 97 residues in 42.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).