A0A096MNB3_PAPAN Loading...

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4

AlphaFold DB (A0A1U7QJH8), UniProt , Accession A0A096MNB3, Species PAPAN (Papio anubis, Olive baboon), Gene OST4, Length 37 aa.

						>A0A096MNB3_PAPAN|A0A096MNB3|OST4
MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	79.8	Confident	94.5	Very high	234 Å²	234	105.7 Å²	105.7	100%	1.153	57%	0.574	S	S	*	*				0	117.7	0	-169	-177.5	-53.9	0	106.3
2	I	91.5	Very high	94.8	Very high	109 Å²	109	106.3 Å²	106.3	56%	0.559	58%	0.576	S	S	*	*			trans	-75.8	137.8	176.7	-168.1	141.6	0	0	108.4	Q6	I2-Q6 HydrophobicContact CD1-CB 4.08Å; I2-Q6 HydrophobicContact CG1-CB 3.58Å
3	T	96.6	Very high	95	Very high	70 Å²	70	108.2 Å²	108.2	43%	0.429	58%	0.581	S	S	.	*			trans	-84.4	156.5	179.7	68.1	0	0	0	110.9	V5 Q6 L7	T3-V5 PolarHBondContact O-N 2.95Å; T3-Q6 VanDerWaalsContact N-OE1 3.11Å; T3-Q6 WeakPolarHBondContact O-CB 3.35Å; T3-Q6 PolarHBondContact O-N 3.13Å; T3-Q6 VanDerWaalsContact OG1-CG 3.27Å; T3-Q6 WeakPolarHBondContact OG1-CG 3.39Å; T3-Q6 PolarHBondContact OG1-N 2.8Å; T3-Q6 PolarHBondContact OG1-OE1 3.44Å; T3-L7 PolarHBondContact O-N 3.3Å
4	D	95.1	Very high	95.2	Very high	144 Å²	144	105.9 Å²	105.9	77%	0.77	57%	0.568	S	S	*	*	H	α-helix	trans	-55.6	-36.5	179.2	-57.2	-79.4	0	0	112.3	L7 A8	D4-L7 PolarHBondContact O-N 3.18Å; D4-A8 VanDerWaalsContact O-CB 3.32Å; D4-A8 WeakPolarHBondContact O-CB 3.5Å; D4-A8 PolarHBondContact O-N 3.11Å
5	V	96.1	Very high	95.4	Very high	99 Å²	99	101.4 Å²	101.4	60%	0.6	56%	0.557	S	S	*	*	H	α-helix	trans	-67.3	-43.3	176.7	-177.5	0	0	0	111.4	T3 L7 A8 I9	T3-V5 PolarHBondContact O-N 2.95Å; V5-L7 VanDerWaalsContact C-N 3.33Å; V5-L7 PolarHBondContact O-N 2.85Å; V5-A8 PolarHBondContact O-N 3.45Å; V5-I9 HydrophobicContact CG1-CD1 3.92Å; V5-I9 VanDerWaalsContact O-CG1 3.27Å; V5-I9 WeakPolarHBondContact O-CG1 3.15Å; V5-I9 PolarHBondContact O-N 3.29Å
6	Q	95.9	Very high	95.6	Very high	103 Å²	103	100.8 Å²	100.8	48%	0.481	56%	0.557	S	S	.	*	H	α-helix	trans	-64.4	-40.4	176.8	-73.5	171.6	-20.1	0	111.3	I2 T3 F10	I2-Q6 HydrophobicContact CD1-CB 4.08Å; I2-Q6 HydrophobicContact CG1-CB 3.58Å; T3-Q6 VanDerWaalsContact N-OE1 3.11Å; T3-Q6 WeakPolarHBondContact O-CB 3.35Å; T3-Q6 PolarHBondContact O-N 3.13Å; T3-Q6 VanDerWaalsContact OG1-CG 3.27Å; T3-Q6 WeakPolarHBondContact OG1-CG 3.39Å; T3-Q6 PolarHBondContact OG1-N 2.8Å; T3-Q6 PolarHBondContact OG1-OE1 3.44Å; Q6-F10 VanDerWaalsContact O-CB 3.28Å; Q6-F10 WeakPolarHBondContact O-CB 3.26Å; Q6-F10 PolarHBondContact O-N 2.82Å
7	L	96.3	Very high	95.7	Very high	91 Å²	91	98.2 Å²	98.2	48%	0.476	55%	0.547	S	S	.	.	H	α-helix	trans	-66.7	-41.4	176.4	-176.2	59.8	0	0	111.7	T3 D4 V5 F10 A11	T3-L7 PolarHBondContact O-N 3.3Å; D4-L7 PolarHBondContact O-N 3.18Å; V5-L7 VanDerWaalsContact C-N 3.33Å; V5-L7 PolarHBondContact O-N 2.85Å; L7-F10 PolarHBondContact O-N 2.9Å; L7-A11 WeakPolarHBondContact O-CB 3.18Å; L7-A11 PolarHBondContact O-N 3.23Å
8	A	96.8	Very high	95.8	Very high	46 Å²	46	98.9 Å²	98.9	38%	0.38	55%	0.55	S	S	.	.	H	α-helix	trans	-63.4	-44.3	176.4	0	0	0	0	111.9	D4 V5 F10 A11 N12	D4-A8 VanDerWaalsContact O-CB 3.32Å; D4-A8 WeakPolarHBondContact O-CB 3.5Å; D4-A8 PolarHBondContact O-N 3.11Å; V5-A8 PolarHBondContact O-N 3.45Å; A8-F10 VanDerWaalsContact C-N 3.34Å; A8-A11 PolarHBondContact O-N 3.43Å; A8-N12 WeakPolarHBondContact O-CB 3.32Å; A8-N12 PolarHBondContact O-N 2.83Å; A8-N12 PolarHBondContact O-ND2 2.99Å
9	I	97.6	Very high	95.9	Very high	100 Å²	100	101.2 Å²	101.2	51%	0.513	55%	0.553	S	S	.	*	H	α-helix	trans	-62.6	-44.1	176.1	-67.9	166.8	0	0	110.3	V5 N12 M13	V5-I9 HydrophobicContact CG1-CD1 3.92Å; V5-I9 VanDerWaalsContact O-CG1 3.27Å; V5-I9 WeakPolarHBondContact O-CG1 3.15Å; V5-I9 PolarHBondContact O-N 3.29Å; I9-N12 PolarHBondContact O-N 3.43Å; I9-M13 WeakPolarHBondContact O-CB 3.39Å; I9-M13 PolarHBondContact O-N 3.48Å
10	F	96.5	Very high	96	Very high	111 Å²	111	101.1 Å²	101.1	49%	0.487	55%	0.552	S	S	.	*	H	α-helix	trans	-62	-46.4	178.1	-177.6	-106.7	0	0	112.1	Q6 L7 A8 N12 M13 L14	Q6-F10 VanDerWaalsContact O-CB 3.28Å; Q6-F10 WeakPolarHBondContact O-CB 3.26Å; Q6-F10 PolarHBondContact O-N 2.82Å; L7-F10 PolarHBondContact O-N 2.9Å; A8-F10 VanDerWaalsContact C-N 3.34Å; F10-N12 PolarHBondContact O-N 2.94Å; F10-M13 PolarHBondContact O-N 2.88Å; F10-L14 HydrophobicContact CD1-CD1 3.88Å; F10-L14 HydrophobicContact CD1-CG 4.39Å; F10-L14 HydrophobicContact CE1-CD1 3.29Å; F10-L14 HydrophobicContact CE1-CG 4.08Å; F10-L14 HydrophobicContact CE2-CD1 4.26Å; F10-L14 HydrophobicContact CE2-CG 4.27Å; F10-L14 HydrophobicContact CZ-CD1 3.52Å; F10-L14 HydrophobicContact CZ-CD2 4.36Å; F10-L14 HydrophobicContact CZ-CG 4.01Å; F10-L14 WeakPolarHBondContact O-CB 3.27Å; F10-L14 WeakPolarHBondContact O-CG 3.45Å; F10-L14 PolarHBondContact O-N 3.02Å
11	A	97.4	Very high	96.1	Very high	56 Å²	56	101.6 Å²	101.6	46%	0.463	55%	0.553	S	S	.	*	H	α-helix	trans	-62.1	-41.2	177.3	0	0	0	0	112.2	L7 A8 L14 G15	L7-A11 WeakPolarHBondContact O-CB 3.18Å; L7-A11 PolarHBondContact O-N 3.23Å; A8-A11 PolarHBondContact O-N 3.43Å; A11-L14 PolarHBondContact O-N 2.88Å; A11-G15 PolarHBondContact O-N 3.29Å
12	N	97.6	Very high	96.9	Very high	113 Å²	113	94.7 Å²	94.7	60%	0.604	52%	0.524	S	S	*	.	H	α-helix	trans	-66.8	-42.7	175.8	-78.9	-67.5	0	0	112	A8 I9 F10 L14 G15 V16	A8-N12 WeakPolarHBondContact O-CB 3.32Å; A8-N12 PolarHBondContact O-N 2.83Å; A8-N12 PolarHBondContact O-ND2 2.99Å; I9-N12 PolarHBondContact O-N 3.43Å; F10-N12 PolarHBondContact O-N 2.94Å; N12-L14 VanDerWaalsContact C-N 3.35Å; N12-L14 PolarHBondContact O-N 3.4Å; N12-G15 PolarHBondContact O-N 3.33Å; N12-V16 WeakPolarHBondContact O-CG2 3.34Å; N12-V16 PolarHBondContact O-N 3.27Å
13	M	97.8	Very high	97.2	Very high	130 Å²	130	93 Å²	93	64%	0.64	52%	0.518	S	S	*	.	H	α-helix	trans	-62.7	-42.2	176.6	-171.6	-175.1	-66.6	0	111.6	I9 F10 S17	I9-M13 WeakPolarHBondContact O-CB 3.39Å; I9-M13 PolarHBondContact O-N 3.48Å; F10-M13 PolarHBondContact O-N 2.88Å; M13-S17 WeakPolarHBondContact O-CB 3.33Å; M13-S17 PolarHBondContact O-N 2.98Å; M13-S17 PolarHBondContact O-OG 3.43Å
14	L	98.1	Very high	97.2	Very high	76 Å²	76	94.9 Å²	94.9	40%	0.398	53%	0.526	S	S	.	.	H	α-helix	trans	-65.8	-40.4	173.1	-74.3	-172.4	0	0	112.4	F10 A11 N12 S17 L18	F10-L14 HydrophobicContact CD1-CD1 3.88Å; F10-L14 HydrophobicContact CD1-CG 4.39Å; F10-L14 HydrophobicContact CE1-CD1 3.29Å; F10-L14 HydrophobicContact CE1-CG 4.08Å; F10-L14 HydrophobicContact CE2-CD1 4.26Å; F10-L14 HydrophobicContact CE2-CG 4.27Å; F10-L14 HydrophobicContact CZ-CD1 3.52Å; F10-L14 HydrophobicContact CZ-CD2 4.36Å; F10-L14 HydrophobicContact CZ-CG 4.01Å; F10-L14 WeakPolarHBondContact O-CB 3.27Å; F10-L14 WeakPolarHBondContact O-CG 3.45Å; F10-L14 PolarHBondContact O-N 3.02Å; A11-L14 PolarHBondContact O-N 2.88Å; N12-L14 VanDerWaalsContact C-N 3.35Å; N12-L14 PolarHBondContact O-N 3.4Å; L14-S17 WeakPolarHBondContact CA-OG 3.49Å; L14-S17 PolarHBondContact O-N 2.85Å; L14-S17 PolarHBondContact O-OG 3.43Å; L14-L18 WeakPolarHBondContact O-CB 3.26Å; L14-L18 VanDerWaalsContact O-CG 3.25Å; L14-L18 WeakPolarHBondContact O-CG 3.41Å; L14-L18 PolarHBondContact O-N 2.88Å
15	G	98.1	Very high	97.3	Very high	39 Å²	39	96 Å²	96	40%	0.402	52%	0.52	S	S	.	.	H	α-helix	trans	-60.7	-47.2	176.9	0	0	0	0	112	A11 N12 F19	A11-G15 PolarHBondContact O-N 3.29Å; N12-G15 PolarHBondContact O-N 3.33Å; G15-F19 VanDerWaalsContact O-CB 3.3Å; G15-F19 WeakPolarHBondContact O-CB 3.38Å; G15-F19 PolarHBondContact O-N 3.39Å
16	V	98.2	Very high	97.2	Very high	91 Å²	91	97.2 Å²	97.2	55%	0.552	52%	0.519	S	S	*	.	H	α-helix	trans	-65.4	-42.1	177.4	175.1	0	0	0	111.3	N12 F19 L20	N12-V16 WeakPolarHBondContact O-CG2 3.34Å; N12-V16 PolarHBondContact O-N 3.27Å; V16-F19 PolarHBondContact O-N 2.96Å; V16-L20 HydrophobicContact CG1-CD1 4.14Å; V16-L20 HydrophobicContact CG1-CG 4.45Å; V16-L20 WeakPolarHBondContact O-CB 3.46Å; V16-L20 WeakPolarHBondContact O-CG 3.29Å; V16-L20 PolarHBondContact O-N 3.45Å
17	S	97.6	Very high	97.2	Very high	57 Å²	57	99.4 Å²	99.4	40%	0.399	52%	0.524	S	S	.	.	H	α-helix	trans	-66.2	-42.4	180	68.4	0	0	0	112.4	M13 L14 L20 L21	M13-S17 WeakPolarHBondContact O-CB 3.33Å; M13-S17 PolarHBondContact O-N 2.98Å; M13-S17 PolarHBondContact O-OG 3.43Å; L14-S17 WeakPolarHBondContact CA-OG 3.49Å; L14-S17 PolarHBondContact O-N 2.85Å; L14-S17 PolarHBondContact O-OG 3.43Å; S17-L20 PolarHBondContact O-N 2.94Å; S17-L21 WeakPolarHBondContact O-CB 3.3Å; S17-L21 PolarHBondContact O-N 2.93Å
18	L	97.9	Very high	97.1	Very high	112 Å²	112	99.5 Å²	99.5	59%	0.586	53%	0.528	S	S	*	.	H	α-helix	trans	-64.5	-42.6	174.7	-71.4	175	0	0	111.6	L14 L21 V22	L14-L18 WeakPolarHBondContact O-CB 3.26Å; L14-L18 VanDerWaalsContact O-CG 3.25Å; L14-L18 WeakPolarHBondContact O-CG 3.41Å; L14-L18 PolarHBondContact O-N 2.88Å; L18-L21 PolarHBondContact O-N 3.25Å; L18-V22 WeakPolarHBondContact O-CG2 3.43Å; L18-V22 PolarHBondContact O-N 2.78Å
19	F	97.8	Very high	96.9	Very high	142 Å²	142	98.1 Å²	98.1	62%	0.623	52%	0.516	S	S	*	.	H	α-helix	trans	-62.3	-45.7	177.8	-172.8	-102.4	0	0	111.7	G15 V16 L21 V22 V23	G15-F19 VanDerWaalsContact O-CB 3.3Å; G15-F19 WeakPolarHBondContact O-CB 3.38Å; G15-F19 PolarHBondContact O-N 3.39Å; V16-F19 PolarHBondContact O-N 2.96Å; F19-L21 VanDerWaalsContact C-N 3.32Å; F19-L21 PolarHBondContact O-N 2.94Å; F19-V22 PolarHBondContact O-N 3.24Å; F19-V23 HydrophobicContact CD1-CG2 4.31Å; F19-V23 HydrophobicContact CE1-CG2 3.97Å; F19-V23 HydrophobicContact CZ-CG2 4.2Å; F19-V23 WeakPolarHBondContact O-CG2 3.37Å; F19-V23 PolarHBondContact O-N 2.89Å
20	L	97.6	Very high	96.7	Very high	99 Å²	99	96.8 Å²	96.8	52%	0.518	51%	0.513	S	S	.	.	H	α-helix	trans	-60.4	-41.4	174.5	-75.4	176.3	0	0	112.1	V16 S17 V22 V23 L24	V16-L20 HydrophobicContact CG1-CD1 4.14Å; V16-L20 HydrophobicContact CG1-CG 4.45Å; V16-L20 WeakPolarHBondContact O-CB 3.46Å; V16-L20 WeakPolarHBondContact O-CG 3.29Å; V16-L20 PolarHBondContact O-N 3.45Å; S17-L20 PolarHBondContact O-N 2.94Å; L20-V22 VanDerWaalsContact C-N 3.33Å; L20-V22 PolarHBondContact O-N 2.82Å; L20-V23 PolarHBondContact O-N 3.49Å; L20-L24 WeakPolarHBondContact O-CB 3.46Å; L20-L24 VanDerWaalsContact O-CG 3.29Å; L20-L24 WeakPolarHBondContact O-CG 3.42Å; L20-L24 PolarHBondContact O-N 3.46Å
21	L	97.3	Very high	96.4	Very high	111 Å²	111	95.3 Å²	95.3	58%	0.581	51%	0.51	S	S	*	.	H	α-helix	trans	-61.8	-42.2	177.8	-168.4	154.1	0	0	111.4	S17 L18 F19 L24 Y25	S17-L21 WeakPolarHBondContact O-CB 3.3Å; S17-L21 PolarHBondContact O-N 2.93Å; L18-L21 PolarHBondContact O-N 3.25Å; F19-L21 VanDerWaalsContact C-N 3.32Å; F19-L21 PolarHBondContact O-N 2.94Å; L21-L24 PolarHBondContact O-N 2.96Å; L21-Y25 WeakPolarHBondContact O-CB 3.4Å; L21-Y25 PolarHBondContact O-N 3.47Å
22	V	97.9	Very high	95.9	Very high	89 Å²	89	95.7 Å²	95.7	54%	0.539	50%	0.504	S	S	.	.	H	α-helix	trans	-63.2	-44.9	175.9	171.5	0	0	0	111.4	L18 F19 L20 Y25 H26	L18-V22 WeakPolarHBondContact O-CG2 3.43Å; L18-V22 PolarHBondContact O-N 2.78Å; F19-V22 PolarHBondContact O-N 3.24Å; L20-V22 VanDerWaalsContact C-N 3.33Å; L20-V22 PolarHBondContact O-N 2.82Å; V22-Y25 PolarHBondContact O-N 3.31Å; V22-H26 WeakPolarHBondContact O-CB 3.25Å; V22-H26 PolarHBondContact O-N 3.5Å
23	V	97.7	Very high	94.9	Very high	73 Å²	73	94.7 Å²	94.7	44%	0.442	50%	0.504	S	S	.	.	H	α-helix	trans	-62.9	-44.1	177.9	173	0	0	0	110.9	F19 L20 H26 Y27	F19-V23 HydrophobicContact CD1-CG2 4.31Å; F19-V23 HydrophobicContact CE1-CG2 3.97Å; F19-V23 HydrophobicContact CZ-CG2 4.2Å; F19-V23 WeakPolarHBondContact O-CG2 3.37Å; F19-V23 PolarHBondContact O-N 2.89Å; L20-V23 PolarHBondContact O-N 3.49Å; V23-H26 PolarHBondContact O-N 2.97Å; V23-Y27 WeakPolarHBondContact O-CB 3.36Å; V23-Y27 PolarHBondContact O-N 2.87Å
24	L	96.9	Very high	93.8	Very high	111 Å²	111	97 Å²	97	58%	0.581	51%	0.51	S	S	*	.	H	α-helix	trans	-62.6	-44.4	175.8	-72.7	175	0	0	111.7	L20 L21 H26 Y27 V28	L20-L24 WeakPolarHBondContact O-CB 3.46Å; L20-L24 VanDerWaalsContact O-CG 3.29Å; L20-L24 WeakPolarHBondContact O-CG 3.42Å; L20-L24 PolarHBondContact O-N 3.46Å; L21-L24 PolarHBondContact O-N 2.96Å; L24-H26 VanDerWaalsContact C-N 3.31Å; L24-H26 PolarHBondContact O-N 3.26Å; L24-Y27 PolarHBondContact O-N 3.44Å; L24-V28 WeakPolarHBondContact O-CB 3.36Å; L24-V28 WeakPolarHBondContact O-CG2 3.34Å; L24-V28 PolarHBondContact O-N 2.96Å
25	Y	95.9	Very high	92	Very high	168 Å²	168	100.1 Å²	100.1	66%	0.659	52%	0.521	S	S	*	.	H	α-helix	trans	-58.7	-45.1	175.5	176.9	-95.9	0	0	111.1	L21 V22 V28 A29	L21-Y25 WeakPolarHBondContact O-CB 3.4Å; L21-Y25 PolarHBondContact O-N 3.47Å; V22-Y25 PolarHBondContact O-N 3.31Å; Y25-V28 PolarHBondContact O-N 3.37Å; Y25-A29 HydrophobicContact CE1-CB 4.45Å; Y25-A29 WeakPolarHBondContact O-CB 3.4Å; Y25-A29 PolarHBondContact O-N 2.98Å
26	H	94.8	Very high	90.2	Very high	123 Å²	123	104.5 Å²	104.5	57%	0.569	53%	0.531	S	S	*	.	H	α-helix	trans	-63.6	-45.7	177.7	-171	78.5	0	0	111.8	V22 V23 L24 V28 A29 V30	V22-H26 WeakPolarHBondContact O-CB 3.25Å; V22-H26 PolarHBondContact O-N 3.5Å; V23-H26 PolarHBondContact O-N 2.97Å; L24-H26 VanDerWaalsContact C-N 3.31Å; L24-H26 PolarHBondContact O-N 3.26Å; H26-V28 PolarHBondContact O-N 3.4Å; H26-A29 PolarHBondContact O-N 3Å; H26-V30 WeakPolarHBondContact O-CB 3.4Å; H26-V30 WeakPolarHBondContact O-CG2 3.44Å; H26-V30 PolarHBondContact O-N 2.89Å
27	Y	95.2	Very high	88	Confident	149 Å²	149	111.5 Å²	111.5	58%	0.584	56%	0.558	S	S	*	*	H	α-helix	trans	-57.7	-48.1	176.4	179.3	-94	0	0	111.6	V23 L24 N31	V23-Y27 WeakPolarHBondContact O-CB 3.36Å; V23-Y27 PolarHBondContact O-N 2.87Å; L24-Y27 PolarHBondContact O-N 3.44Å; Y27-N31 VanDerWaalsContact CD2-ND2 3.26Å; Y27-N31 WeakPolarHBondContact CD2-ND2 3.27Å; Y27-N31 WeakPolarHBondContact CE2-ND2 3.27Å; Y27-N31 VanDerWaalsContact O-CB 3.27Å; Y27-N31 WeakPolarHBondContact O-CB 3.38Å; Y27-N31 PolarHBondContact O-N 2.85Å; Y27-N31 PolarHBondContact O-ND2 3.5Å
28	V	94.7	Very high	87.6	Confident	94 Å²	94	114.3 Å²	114.3	57%	0.57	57%	0.566	S	S	*	*	H	α-helix	trans	-64.3	-42.8	177	172	0	0	0	110.9	L24 Y25 H26 V30 N31 N32	L24-V28 WeakPolarHBondContact O-CB 3.36Å; L24-V28 WeakPolarHBondContact O-CG2 3.34Å; L24-V28 PolarHBondContact O-N 2.96Å; Y25-V28 PolarHBondContact O-N 3.37Å; H26-V28 PolarHBondContact O-N 3.4Å; V28-V30 PolarHBondContact O-N 3.44Å; V28-N31 CarbonylContact O-C 3.57Å; V28-N31 PolarHBondContact O-N 3.34Å; V28-N32 WeakPolarHBondContact O-CB 3.32Å; V28-N32 PolarHBondContact O-N 2.92Å
29	A	92.8	Very high	87	Confident	16 Å²	16	114.4 Å²	114.4	13%	0.132	56%	0.564	C	S	.	*	H	α-helix	trans	-66.2	-37.1	-177.7	0	0	0	0	113	Y25 H26 K35	Y25-A29 HydrophobicContact CE1-CB 4.45Å; Y25-A29 WeakPolarHBondContact O-CB 3.4Å; Y25-A29 PolarHBondContact O-N 2.98Å; H26-A29 PolarHBondContact O-N 3Å; A29-K35 WeakPolarHBondContact O-CD 3.28Å
30	V	93.1	Very high	86.4	Confident	72 Å²	72	112.8 Å²	112.8	44%	0.436	56%	0.561	S	S	.	*	H	α-helix	trans	-74.2	-40	175.8	170.3	0	0	0	111.2	H26 V28 N32 Q36	H26-V30 WeakPolarHBondContact O-CB 3.4Å; H26-V30 WeakPolarHBondContact O-CG2 3.44Å; H26-V30 PolarHBondContact O-N 2.89Å; V28-V30 PolarHBondContact O-N 3.44Å; V30-N32 VanDerWaalsContact C-N 3.28Å; V30-N32 PolarHBondContact O-N 3.37Å; V30-Q36 PolarHBondContact O-NE2 3.01Å
31	N	89.9	Confident	85.8	Confident	80 Å²	80	113.6 Å²	113.6	43%	0.428	56%	0.564	S	S	.	*	S	Bend	trans	-86.3	5.7	-179	-68.1	-62.6	0	0	113.8	Y27 V28 P33	Y27-N31 VanDerWaalsContact CD2-ND2 3.26Å; Y27-N31 WeakPolarHBondContact CD2-ND2 3.27Å; Y27-N31 WeakPolarHBondContact CE2-ND2 3.27Å; Y27-N31 VanDerWaalsContact O-CB 3.27Å; Y27-N31 WeakPolarHBondContact O-CB 3.38Å; Y27-N31 PolarHBondContact O-N 2.85Å; Y27-N31 PolarHBondContact O-ND2 3.5Å; V28-N31 CarbonylContact O-C 3.57Å; V28-N31 PolarHBondContact O-N 3.34Å; N31-P33 VanDerWaalsContact O-CD 3.26Å; N31-P33 WeakPolarHBondContact O-CD 3.46Å
32	N	86.7	Confident	85	Confident	65 Å²	65	113.8 Å²	113.8	35%	0.348	56%	0.563	S	S	.	*			trans	-78.1	112.9	174.6	-173.8	15.1	0	0	109	V28 V30 K34 K35	V28-N32 WeakPolarHBondContact O-CB 3.32Å; V28-N32 PolarHBondContact O-N 2.92Å; V30-N32 VanDerWaalsContact C-N 3.28Å; V30-N32 PolarHBondContact O-N 3.37Å; N32-K34 PolarHBondContact O-N 2.96Å; N32-K34 VanDerWaalsContact O-N 3.13Å; N32-K35 PolarHBondContact O-N 3.18Å
33	P	77.5	Confident	84.2	Confident	92 Å²	92	115.5 Å²	115.5	60%	0.597	56%	0.564	S	S	*	*	G	3₁₀ helix	trans	-61.1	-27.7	-176	24.1	-34.2	0	0	112.4	N31 K35 Q36	N31-P33 VanDerWaalsContact O-CD 3.26Å; N31-P33 WeakPolarHBondContact O-CD 3.46Å; P33-K35 PolarHBondContact O-N 3.49Å; P33-K35 VanDerWaalsContact O-N 3.11Å; P33-Q36 PolarHBondContact O-N 3.35Å
34	K	73.6	Confident	83.2	Confident	177 Å²	177	118.5 Å²	118.5	77%	0.77	57%	0.573	S	S	*	*	G	3₁₀ helix	trans	-63.8	-12.6	175	-61.9	-175.4	177.1	-176.4	114.5	N32	N32-K34 PolarHBondContact O-N 2.96Å; N32-K34 VanDerWaalsContact O-N 3.13Å
35	K	61.4	Low	82.2	Confident	143 Å²	143	119.1 Å²	119.1	62%	0.622	57%	0.572	S	S	*	*	G	3₁₀ helix	trans	-110.9	-4.9	-179.1	-151.4	-169.6	178.2	-172.3	112.3	A29 N32 P33	A29-K35 WeakPolarHBondContact O-CD 3.28Å; N32-K35 PolarHBondContact O-N 3.18Å; P33-K35 PolarHBondContact O-N 3.49Å; P33-K35 VanDerWaalsContact O-N 3.11Å
36	Q	58.8	Low	81	Confident	131 Å²	131	115 Å²	115	61%	0.612	57%	0.565	S	S	*	*			trans	-96.6	3.5	178.6	-73.7	-177	1.6	0	112.8	V30 P33	V30-Q36 PolarHBondContact O-NE2 3.01Å; P33-Q36 PolarHBondContact O-N 3.35Å
37	E	53.8	Low	79.8	Confident	238 Å²	238	114.3 Å²	114.3	100%	1.112	57%	0.565	S	S	*	*			trans	-89.1	0	167.1	-61	-171.3	126.3	0	111.5

Retrieved 37 of 37 residues in 15.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).