A0A096MQ77_PAPAN Loading...

Ragulator complex protein LAMTOR4

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD): it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.

AlphaFold DB (G7P0C8), UniProt , Accession A0A096MQ77, Species PAPAN (Papio anubis, Olive baboon), Gene LAMTOR4, Length 99 aa.

						>A0A096MQ77_PAPAN|A0A096MQ77|LAMTOR4
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHHGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.8	Very low	78.8	Confident	246 Å²	246	92.7 Å²	92.7	100%	1.212	50%	0.5	S	S	*	.				0	111.7	0	-74.9	-162.8	-108	0	0	107.7
2	T	51.4	Low	80	Confident	86 Å²	86	89.1 Å²	89.1	53%	0.528	48%	0.479	S	S	.	.			trans	-73.6	126.2	173.4	34	0	0	0	0	109
3	S	75.2	Confident	81	Confident	56 Å²	56	88.9 Å²	88.9	39%	0.392	49%	0.486	S	S	.	.			trans	-73.3	153.5	178.9	74.6	0	0	0	0	110.4	L5 T6 Q7	S3-L5 PolarHBondContact O-N 3.27Å; S3-T6 PolarHBondContact N-OG1 2.99Å; S3-T6 PolarHBondContact O-N 2.75Å; S3-T6 PolarHBondContact O-OG1 2.89Å; S3-T6 PolarHBondContact OG-N 3.08Å; S3-T6 PolarHBondContact OG-OG1 2.88Å; S3-Q7 PolarHBondContact O-N 3.13Å
4	A	75.5	Confident	81.8	Confident	82 Å²	82	85.8 Å²	85.8	68%	0.678	47%	0.468	S	S	*	.	H	α-helix	trans	-55.6	-26.3	176.3	0	0	0	0	0	113.1	G8	A4-G8 PolarHBondContact O-N 3.41Å
5	L	79.9	Confident	82.7	Confident	84 Å²	84	83.1 Å²	83.1	44%	0.44	45%	0.451	S	S	.	.	H	α-helix	trans	-68.9	-42	177.5	-66.8	159.2	0	0	0	112.1	S3 G8	S3-L5 PolarHBondContact O-N 3.27Å; L5-G8 PolarHBondContact O-N 3.44Å
6	T	85.4	Confident	83.6	Confident	8 Å²	8	81.2 Å²	81.2	5%	0.049	44%	0.44	C	S	.	.	H	α-helix	trans	-75.4	-32.7	-179.7	55.3	0	0	0	0	111.6	S3 G8 L9 E10 Y18 A28	S3-T6 PolarHBondContact N-OG1 2.99Å; S3-T6 PolarHBondContact O-N 2.75Å; S3-T6 PolarHBondContact O-OG1 2.89Å; S3-T6 PolarHBondContact OG-N 3.08Å; S3-T6 PolarHBondContact OG-OG1 2.88Å; T6-G8 PolarHBondContact O-N 3.14Å; T6-L9 PolarHBondContact O-N 3.37Å; T6-L9 VanDerWaalsContact O-N 3.08Å; T6-E10 WeakPolarHBondContact O-CG 3.11Å; T6-E10 PolarHBondContact O-N 3.1Å; T6-Y18 WeakPolarHBondContact CB-OH 3.42Å; T6-Y18 HydrophobicContact CG2-CE2 3.92Å; T6-A28 HydrophobicContact CG2-CB 3.61Å
7	Q	86.6	Confident	84.4	Confident	96 Å²	96	76.4 Å²	76.4	45%	0.449	41%	0.414	S	S	.	.	H	α-helix	trans	-59.5	-35	172.3	-69.9	-179.7	-3.4	0	0	112.7	S3 L9 R11	S3-Q7 PolarHBondContact O-N 3.13Å; Q7-L9 VanDerWaalsContact C-N 3.33Å; Q7-R11 VanDerWaalsContact O-CG 3.25Å; Q7-R11 WeakPolarHBondContact O-CG 3.28Å; Q7-R11 PolarHBondContact O-N 2.94Å
8	G	91.3	Very high	85.1	Confident	43 Å²	43	72.7 Å²	72.7	44%	0.443	39%	0.393	S	S	.	.	H	α-helix	trans	-65.1	-36.9	175.5	0	0	0	0	0	112.8	A4 L5 T6	A4-G8 PolarHBondContact O-N 3.41Å; L5-G8 PolarHBondContact O-N 3.44Å; T6-G8 PolarHBondContact O-N 3.14Å
9	L	93.5	Very high	85.7	Confident	18 Å²	18	68.9 Å²	68.9	9%	0.094	37%	0.373	C	S	.	.	H	α-helix	trans	-74.5	-38.4	-179.4	-57.6	175.5	0	0	0	111.9	T6 Q7 R11 I12 Y18 V20 F85 V87	T6-L9 PolarHBondContact O-N 3.37Å; T6-L9 VanDerWaalsContact O-N 3.08Å; Q7-L9 VanDerWaalsContact C-N 3.33Å; L9-R11 PolarHBondContact O-N 3.31Å; L9-I12 HydrophobicContact CD2-CD1 4.11Å; L9-I12 WeakPolarHBondContact O-CB 3.27Å; L9-I12 WeakPolarHBondContact O-CG1 3.29Å; L9-I12 PolarHBondContact O-N 2.89Å; L9-Y18 HydrophobicContact CB-CD1 3.92Å; L9-Y18 HydrophobicContact CB-CD2 4.32Å; L9-Y18 HydrophobicContact CB-CE1 4.43Å; L9-Y18 HydrophobicContact CB-CG 3.86Å; L9-Y18 HydrophobicContact CD1-CD2 3.65Å; L9-Y18 HydrophobicContact CD1-CE2 4.27Å; L9-Y18 HydrophobicContact CD1-CG 3.91Å; L9-V20 HydrophobicContact CD1-CG2 3.58Å; L9-F85 HydrophobicContact CD1-CD1 4.34Å; L9-V87 HydrophobicContact CD2-CG2 3.83Å
10	E	92.2	Very high	86.2	Confident	85 Å²	85	65.9 Å²	65.9	40%	0.397	36%	0.357	S	S	.	.	H	α-helix	trans	-65	-25.3	176.5	-72.3	171.6	-167.5	0	0	113	T6 I12 Y18	T6-E10 WeakPolarHBondContact O-CG 3.11Å; T6-E10 PolarHBondContact O-N 3.1Å; E10-I12 VanDerWaalsContact C-N 3.28Å; E10-I12 PolarHBondContact O-N 3.36Å; E10-Y18 HydrophobicContact CG-CD1 4.35Å; E10-Y18 HydrophobicContact CG-CE1 3.48Å; E10-Y18 VanDerWaalsContact CG-CE1 3.48Å; E10-Y18 PolarHBondContact OE1-OH 2.95Å
11	R	93.4	Very high	86.6	Confident	216 Å²	216	62.8 Å²	62.8	82%	0.815	34%	0.34	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85	-0.2	179.2	-69	176.7	72.2	179.6	4	113.5	Q7 L9 P13	Q7-R11 VanDerWaalsContact O-CG 3.25Å; Q7-R11 WeakPolarHBondContact O-CG 3.28Å; Q7-R11 PolarHBondContact O-N 2.94Å; L9-R11 PolarHBondContact O-N 3.31Å; R11-P13 WeakPolarHBondContact O-CD 3.3Å
12	I	93.1	Very high	88.9	Confident	49 Å²	49	52.3 Å²	52.3	25%	0.251	29%	0.291	S	S	.	.	S	Bend	trans	-73.4	125.5	179.5	-65.9	171.4	0	0	0	108.9	L9 E10 D14 Q15 V87 R89	L9-I12 HydrophobicContact CD2-CD1 4.11Å; L9-I12 WeakPolarHBondContact O-CB 3.27Å; L9-I12 WeakPolarHBondContact O-CG1 3.29Å; L9-I12 PolarHBondContact O-N 2.89Å; E10-I12 VanDerWaalsContact C-N 3.28Å; E10-I12 PolarHBondContact O-N 3.36Å; I12-D14 PolarHBondContact O-N 3.48Å; I12-Q15 HydrophobicContact CB-CB 4.14Å; I12-Q15 HydrophobicContact CG2-CB 4.37Å; I12-Q15 WeakPolarHBondContact O-CB 3.43Å; I12-Q15 PolarHBondContact O-N 3.43Å; I12-V87 HydrophobicContact CD1-CB 4.46Å; I12-V87 HydrophobicContact CD1-CG1 4.14Å; I12-V87 HydrophobicContact CD1-CG2 3.74Å; I12-V87 HydrophobicContact CG2-CG1 4.37Å; I12-R89 HydrophobicContact CG2-CG 4.3Å
13	P	92.6	Very high	90.5	Very high	87 Å²	87	56.7 Å²	56.7	57%	0.565	31%	0.305	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.6	140.4	177.7	-24.3	33.8	0	0	0	111.9	R11 Q15 R89	R11-P13 WeakPolarHBondContact O-CD 3.3Å; P13-Q15 PolarHBondContact O-N 3.48Å; P13-R89 PolarHBondContact O-NE 2.83Å; P13-R89 PolarHBondContact O-NH2 3.02Å
14	D	92.7	Very high	90.6	Very high	45 Å²	45	56.5 Å²	56.5	24%	0.241	31%	0.312	C	S	.	.	T	Hydrogen-bonded Turn	trans	59.9	21.1	179.1	-47.1	-60	0	0	0	114.4	I12 L16 R89 Q90 R92	I12-D14 PolarHBondContact O-N 3.48Å; D14-L16 PolarHBondContact O-N 2.88Å; D14-R89 VanDerWaalsContact O-CA 3.25Å; D14-R89 WeakPolarHBondContact O-CA 3.42Å; D14-R89 IonicContact OD2-NH2 3.59Å; D14-Q90 HydrophobicContact CB-CB 4.26Å; D14-Q90 PolarHBondContact O-N 2.89Å; D14-R92 IonicContact OD1-CZ 2.7Å; D14-R92 IonicContact OD1-NE 2.83Å; D14-R92 PolarHBondContact OD1-NE 2.99Å; D14-R92 IonicContact OD1-NH2 3.06Å; D14-R92 PolarHBondContact OD1-NH2 2.93Å; D14-R92 WeakPolarHBondContact OD2-CD 3.25Å; D14-R92 IonicContact OD2-CZ 2.68Å; D14-R92 IonicContact OD2-NE 3.05Å; D14-R92 PolarHBondContact OD2-NE 3.09Å; D14-R92 IonicContact OD2-NH2 3.55Å
15	Q	94.8	Very high	91.2	Very high	45 Å²	45	55.3 Å²	55.3	21%	0.21	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.8	129.4	172.5	171.7	-89.7	-37.1	0	0	109.9	I12 P13 G17 V87 K88	I12-Q15 HydrophobicContact CB-CB 4.14Å; I12-Q15 HydrophobicContact CG2-CB 4.37Å; I12-Q15 WeakPolarHBondContact O-CB 3.43Å; I12-Q15 PolarHBondContact O-N 3.43Å; P13-Q15 PolarHBondContact O-N 3.48Å; Q15-G17 VanDerWaalsContact NE2-C 3.34Å; Q15-V87 HydrophobicContact CB-CG1 4.12Å; Q15-V87 HydrophobicContact CG-CG1 3.76Å; Q15-K88 WeakPolarHBondContact CA-O 3.26Å
16	L	96.7	Very high	91.8	Very high	53 Å²	53	53.7 Å²	53.7	28%	0.277	30%	0.296	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	-25.7	178	-57.7	176.9	0	0	0	111.7	D14 G31 D32 H73 K88 Q90	D14-L16 PolarHBondContact O-N 2.88Å; L16-G31 WeakPolarHBondContact O-CA 3.45Å; L16-D32 PolarHBondContact O-N 3.43Å; L16-H73 HydrophobicContact CD1-CB 4.44Å; L16-K88 HydrophobicContact CB-CB 4.43Å; L16-K88 HydrophobicContact CB-CD 4.16Å; L16-K88 HydrophobicContact CB-CG 4.2Å; L16-K88 HydrophobicContact CD1-CD 4.43Å; L16-K88 HydrophobicContact CD1-CG 4.36Å; L16-K88 PolarHBondContact N-O 3.21Å; L16-Q90 HydrophobicContact CD1-CB 4.09Å; L16-Q90 HydrophobicContact CD2-CB 4.43Å; L16-Q90 HydrophobicContact CG-CB 4.37Å
17	G	97.1	Very high	92.1	Very high	0 Å²	0	58 Å²	58	0%	0	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-168.2	157.1	177.6	0	0	0	0	0	110.8	Q15 S30 K88	Q15-G17 VanDerWaalsContact NE2-C 3.34Å; G17-S30 CarbonylContact C-O 3.54Å; G17-S30 WeakPolarHBondContact CA-O 3.35Å; G17-K88 PolarHBondContact O-N 3.39Å
18	Y	97.4	Very high	92.5	Very high	10 Å²	10	54.6 Å²	54.6	4%	0.039	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.1	159.1	170.6	68.4	-100.7	0	0	0	110.8	T6 L9 E10 V20 A28 S29 S30 V86	T6-Y18 WeakPolarHBondContact CB-OH 3.42Å; T6-Y18 HydrophobicContact CG2-CE2 3.92Å; L9-Y18 HydrophobicContact CB-CD1 3.92Å; L9-Y18 HydrophobicContact CB-CD2 4.32Å; L9-Y18 HydrophobicContact CB-CE1 4.43Å; L9-Y18 HydrophobicContact CB-CG 3.86Å; L9-Y18 HydrophobicContact CD1-CD2 3.65Å; L9-Y18 HydrophobicContact CD1-CE2 4.27Å; L9-Y18 HydrophobicContact CD1-CG 3.91Å; E10-Y18 HydrophobicContact CG-CD1 4.35Å; E10-Y18 HydrophobicContact CG-CE1 3.48Å; E10-Y18 VanDerWaalsContact CG-CE1 3.48Å; E10-Y18 PolarHBondContact OE1-OH 2.95Å; Y18-V20 HydrophobicContact CD2-CG2 4.42Å; Y18-A28 HydrophobicContact CE2-CB 4.35Å; Y18-S29 CarbonylContact O-C 3.57Å; Y18-S29 VanDerWaalsContact O-CA 3.27Å; Y18-S29 WeakPolarHBondContact O-CA 3.43Å; Y18-S30 VanDerWaalsContact CZ-CB 3.44Å; Y18-S30 PolarHBondContact N-O 2.81Å; Y18-S30 PolarHBondContact O-N 3.47Å; Y18-V86 CarbonylContact C-O 3.53Å; Y18-V86 WeakPolarHBondContact CA-O 3.47Å; Y18-V86 WeakPolarHBondContact CB-O 3.09Å
19	L	96.4	Very high	92.7	Very high	1 Å²	1	53.7 Å²	53.7	1%	0.005	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148	132.3	179.7	178	126.5	0	0	0	108.9	L21 V26 A28 L33 A40 V86	L19-L21 HydrophobicContact CD1-CD2 4.41Å; L19-L21 HydrophobicContact CD2-CD1 3.68Å; L19-L21 HydrophobicContact CD2-CD2 3.47Å; L19-L21 VanDerWaalsContact CD2-CD2 3.47Å; L19-L21 HydrophobicContact CD2-CG 3.47Å; L19-L21 VanDerWaalsContact CD2-CG 3.47Å; L19-L21 HydrophobicContact CG-CD2 3.87Å; L19-L21 HydrophobicContact CG-CG 4.28Å; L19-V26 HydrophobicContact CD1-CG1 4.35Å; L19-V26 HydrophobicContact CD1-CG2 4.24Å; L19-A28 CarbonylContact C-O 3.59Å; L19-A28 WeakPolarHBondContact CA-O 3.35Å; L19-L33 HydrophobicContact CB-CB 4.2Å; L19-L33 HydrophobicContact CB-CD1 4.16Å; L19-A40 HydrophobicContact CD1-CB 4.12Å; L19-A40 HydrophobicContact CD2-CB 4.14Å; L19-V86 HydrophobicContact CB-CB 4.12Å; L19-V86 HydrophobicContact CD2-CB 4.3Å; L19-V86 HydrophobicContact CD2-CG2 3.89Å; L19-V86 PolarHBondContact N-O 3.43Å; L19-V86 WeakPolarHBondContact O-CB 3.45Å; L19-V86 PolarHBondContact O-N 3.3Å
20	V	95.7	Very high	92.8	Very high	8 Å²	8	54.5 Å²	54.5	5%	0.048	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	121	179.2	-176	0	0	0	0	107.8	L9 Y18 L27 A28 V84 F85	L9-V20 HydrophobicContact CD1-CG2 3.58Å; Y18-V20 HydrophobicContact CD2-CG2 4.42Å; V20-L27 HydrophobicContact CG1-CB 4.42Å; V20-L27 PolarHBondContact O-N 2.82Å; V20-A28 HydrophobicContact CB-CB 4.23Å; V20-A28 HydrophobicContact CG2-CB 4.3Å; V20-A28 PolarHBondContact N-O 2.82Å; V20-A28 PolarHBondContact O-N 3.17Å; V20-V84 WeakPolarHBondContact CA-O 3.38Å; V20-F85 HydrophobicContact CG1-CD1 4.27Å; V20-F85 HydrophobicContact CG1-CE1 4.06Å; V20-F85 HydrophobicContact CG2-CD1 4.11Å; V20-F85 HydrophobicContact CG2-CE1 4.39Å
21	L	94.2	Very high	93	Very high	1 Å²	1	52.2 Å²	52.2	1%	0.005	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	149.5	-179.1	-51.3	177.9	0	0	0	111.4	L19 A25 V26 A40 S44 R83 V84	L19-L21 HydrophobicContact CD1-CD2 4.41Å; L19-L21 HydrophobicContact CD2-CD1 3.68Å; L19-L21 HydrophobicContact CD2-CD2 3.47Å; L19-L21 VanDerWaalsContact CD2-CD2 3.47Å; L19-L21 HydrophobicContact CD2-CG 3.47Å; L19-L21 VanDerWaalsContact CD2-CG 3.47Å; L19-L21 HydrophobicContact CG-CD2 3.87Å; L19-L21 HydrophobicContact CG-CG 4.28Å; L21-A25 VanDerWaalsContact CA-O 3.26Å; L21-A25 WeakPolarHBondContact CA-O 3.3Å; L21-V26 HydrophobicContact CD2-CB 4.16Å; L21-V26 HydrophobicContact CD2-CG2 3.68Å; L21-A40 HydrophobicContact CD1-CB 4.07Å; L21-A40 WeakPolarHBondContact CD1-O 3.35Å; L21-A40 HydrophobicContact CD2-CB 3.74Å; L21-S44 VanDerWaalsContact CD1-OG 3.29Å; L21-S44 WeakPolarHBondContact CD1-OG 3.43Å; L21-R83 CarbonylContact O-C 3.52Å; L21-R83 VanDerWaalsContact O-CA 3.25Å; L21-R83 WeakPolarHBondContact O-CA 3.47Å; L21-V84 HydrophobicContact CB-CB 4.15Å; L21-V84 PolarHBondContact N-O 3.36Å; L21-V84 PolarHBondContact O-N 3.32Å
22	S	91.9	Very high	93.2	Very high	25 Å²	25	46.3 Å²	46.3	18%	0.175	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	128.3	166.8	-171.2	0	0	0	0	108.2	G24 A25	S22-G24 PolarHBondContact O-N 2.97Å; S22-G24 VanDerWaalsContact O-N 3.11Å; S22-A25 PolarHBondContact N-O 3.42Å; S22-A25 PolarHBondContact O-N 2.89Å
23	E	85.8	Confident	93.3	Very high	178 Å²	178	44.4 Å²	44.4	83%	0.832	28%	0.275	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.6	34.3	179	-54.1	-172.6	126.2	0	0	113.8	A25	E23-A25 VanDerWaalsContact C-N 3.27Å; E23-A25 PolarHBondContact O-N 3.48Å
24	G	75.9	Confident	93.5	Very high	53 Å²	53	46 Å²	46	55%	0.546	28%	0.275	S	S	.	.	T	Hydrogen-bonded Turn	trans	80.8	-4.4	-179	0	0	0	0	0	115.2	S22	S22-G24 PolarHBondContact O-N 2.97Å; S22-G24 VanDerWaalsContact O-N 3.11Å
25	A	88.1	Confident	93.5	Very high	56 Å²	56	49.7 Å²	49.7	46%	0.463	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	145.5	176.5	0	0	0	0	0	112.3	L21 S22 E23 L27	L21-A25 VanDerWaalsContact CA-O 3.26Å; L21-A25 WeakPolarHBondContact CA-O 3.3Å; S22-A25 PolarHBondContact N-O 3.42Å; S22-A25 PolarHBondContact O-N 2.89Å; E23-A25 VanDerWaalsContact C-N 3.27Å; E23-A25 PolarHBondContact O-N 3.48Å; A25-L27 PolarHBondContact O-N 3.34Å
26	V	92.5	Very high	93.4	Very high	50 Å²	50	50.2 Å²	50.2	30%	0.303	30%	0.299	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.2	116.1	175	-176.6	0	0	0	0	109.8	L19 L21 A40	L19-V26 HydrophobicContact CD1-CG1 4.35Å; L19-V26 HydrophobicContact CD1-CG2 4.24Å; L21-V26 HydrophobicContact CD2-CB 4.16Å; L21-V26 HydrophobicContact CD2-CG2 3.68Å; V26-A40 HydrophobicContact CG2-CB 3.77Å
27	L	92.6	Very high	93.2	Very high	98 Å²	98	54.9 Å²	54.9	51%	0.513	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.2	-36.5	175	-65.6	-173.1	0	0	0	112.6	V20 A25	V20-L27 HydrophobicContact CG1-CB 4.42Å; V20-L27 PolarHBondContact O-N 2.82Å; A25-L27 PolarHBondContact O-N 3.34Å
28	A	94.4	Very high	93	Very high	25 Å²	25	62.7 Å²	62.7	21%	0.207	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.4	144.5	177.5	0	0	0	0	0	109.5	T6 Y18 L19 V20	T6-A28 HydrophobicContact CG2-CB 3.61Å; Y18-A28 HydrophobicContact CE2-CB 4.35Å; L19-A28 CarbonylContact C-O 3.59Å; L19-A28 WeakPolarHBondContact CA-O 3.35Å; V20-A28 HydrophobicContact CB-CB 4.23Å; V20-A28 HydrophobicContact CG2-CB 4.3Å; V20-A28 PolarHBondContact N-O 2.82Å; V20-A28 PolarHBondContact O-N 3.17Å
29	S	95.2	Very high	92.8	Very high	24 Å²	24	63.2 Å²	63.2	17%	0.168	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.1	157.8	175.2	63.8	0	0	0	0	110.4	Y18 L33 N35	Y18-S29 CarbonylContact O-C 3.57Å; Y18-S29 VanDerWaalsContact O-CA 3.27Å; Y18-S29 WeakPolarHBondContact O-CA 3.43Å; S29-L33 WeakPolarHBondContact CB-O 3.48Å; S29-N35 PolarHBondContact OG-N 3.15Å
30	S	96.5	Very high	92.7	Very high	36 Å²	36	63.3 Å²	63.3	25%	0.252	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-163.1	159.6	177.9	-170.4	0	0	0	0	111.6	G17 Y18 L33	G17-S30 CarbonylContact C-O 3.54Å; G17-S30 WeakPolarHBondContact CA-O 3.35Å; Y18-S30 VanDerWaalsContact CZ-CB 3.44Å; Y18-S30 PolarHBondContact N-O 2.81Å; Y18-S30 PolarHBondContact O-N 3.47Å; S30-L33 PolarHBondContact O-N 3.49Å
31	G	96.3	Very high	92.7	Very high	37 Å²	37	66.6 Å²	66.6	38%	0.381	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	63.6	-139	176.7	0	0	0	0	0	111.6	L16 L33 E34	L16-G31 WeakPolarHBondContact O-CA 3.45Å; G31-L33 PolarHBondContact O-N 3.02Å; G31-E34 VanDerWaalsContact O-CB 3.25Å; G31-E34 WeakPolarHBondContact O-CB 3.39Å; G31-E34 PolarHBondContact O-N 2.98Å
32	D	96.8	Very high	92.7	Very high	91 Å²	91	69.1 Å²	69.1	49%	0.487	41%	0.407	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.7	-13.4	-179	-73.7	3.3	0	0	0	114.9	L16 K88	L16-D32 PolarHBondContact O-N 3.43Å; D32-K88 HydrophobicContact CB-CD 3.76Å; D32-K88 WeakPolarHBondContact OD2-CE 3.45Å; D32-K88 IonicContact OD2-NZ 3.85Å; D32-K88 PolarHBondContact OD2-NZ 3.03Å
33	L	95.9	Very high	92.9	Very high	9 Å²	9	68.4 Å²	68.4	5%	0.047	40%	0.401	C	S	.	.	T	Hydrogen-bonded Turn	trans	-108.8	9.1	179.3	-61.9	178.3	0	0	0	112.3	L19 S29 S30 G31 N35 D36 A39 L75 V86 K88	L19-L33 HydrophobicContact CB-CB 4.2Å; L19-L33 HydrophobicContact CB-CD1 4.16Å; S29-L33 WeakPolarHBondContact CB-O 3.48Å; S30-L33 PolarHBondContact O-N 3.49Å; G31-L33 PolarHBondContact O-N 3.02Å; L33-N35 PolarHBondContact O-N 3.35Å; L33-D36 PolarHBondContact O-N 3.01Å; L33-A39 HydrophobicContact CD2-CB 4.42Å; L33-L75 HydrophobicContact CD1-CD2 4.36Å; L33-V86 HydrophobicContact CD1-CG1 3.88Å; L33-K88 HydrophobicContact CD1-CB 4.08Å; L33-K88 HydrophobicContact CG-CB 4.36Å
34	E	96.4	Very high	93.2	Very high	121 Å²	121	61.4 Å²	61.4	57%	0.565	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.1	121.6	-179.4	-173.3	173	-172.6	0	0	111.2	G31 D36	G31-E34 VanDerWaalsContact O-CB 3.25Å; G31-E34 WeakPolarHBondContact O-CB 3.39Å; G31-E34 PolarHBondContact O-N 2.98Å; E34-D36 PolarHBondContact O-N 2.66Å; E34-D36 VanDerWaalsContact O-N 3.09Å
35	N	92.1	Very high	94.1	Very high	123 Å²	123	65.4 Å²	65.4	66%	0.658	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.5	22.6	-177.9	-55	-50.3	0	0	0	114.9	S29 L33 E37	S29-N35 PolarHBondContact OG-N 3.15Å; L33-N35 PolarHBondContact O-N 3.35Å; N35-E37 PolarHBondContact O-N 2.89Å
36	D	93.9	Very high	94.3	Very high	56 Å²	56	66.1 Å²	66.1	30%	0.299	37%	0.372	S	S	.	.			trans	-81.7	80.9	176.9	-168.3	-16.1	0	0	0	111	L33 E34 Q38 A39 A40	L33-D36 PolarHBondContact O-N 3.01Å; E34-D36 PolarHBondContact O-N 2.66Å; E34-D36 VanDerWaalsContact O-N 3.09Å; D36-Q38 PolarHBondContact O-N 2.85Å; D36-Q38 PolarHBondContact OD1-N 2.88Å; D36-A39 HydrophobicContact CB-CB 4.08Å; D36-A39 PolarHBondContact O-N 2.92Å; D36-A39 WeakPolarHBondContact OD1-CB 3.37Å; D36-A39 PolarHBondContact OD1-N 2.85Å; D36-A39 WeakPolarHBondContact OD2-CB 3.35Å; D36-A40 PolarHBondContact O-N 2.94Å
37	E	92.1	Very high	94.3	Very high	151 Å²	151	64.2 Å²	64.2	71%	0.706	36%	0.36	S	S	*	.	H	α-helix	trans	-65.1	-27.8	177.9	-65.5	-171.5	166.3	0	0	112.7	N35 A40 S41	N35-E37 PolarHBondContact O-N 2.89Å; E37-A40 WeakPolarHBondContact O-CB 3.28Å; E37-A40 PolarHBondContact O-N 2.83Å; E37-S41 WeakPolarHBondContact O-CB 3.3Å; E37-S41 PolarHBondContact O-N 2.94Å
38	Q	93.8	Very high	94.1	Very high	164 Å²	164	63.6 Å²	63.6	77%	0.766	37%	0.365	S	S	*	.	H	α-helix	trans	-68.6	-46.6	178.3	-171	178.8	15.6	0	0	110.3	D36 A40 S41 A42	D36-Q38 PolarHBondContact O-N 2.85Å; D36-Q38 PolarHBondContact OD1-N 2.88Å; Q38-A40 VanDerWaalsContact C-N 3.32Å; Q38-A40 PolarHBondContact O-N 2.88Å; Q38-S41 PolarHBondContact O-N 2.99Å; Q38-A42 PolarHBondContact O-N 3.45Å
39	A	93.3	Very high	93.9	Very high	20 Å²	20	66 Å²	66	17%	0.165	38%	0.376	C	S	.	.	H	α-helix	trans	-62.7	-39.8	172.9	0	0	0	0	0	111.7	L33 D36 S41 A42 I43	L33-A39 HydrophobicContact CD2-CB 4.42Å; D36-A39 HydrophobicContact CB-CB 4.08Å; D36-A39 PolarHBondContact O-N 2.92Å; D36-A39 WeakPolarHBondContact OD1-CB 3.37Å; D36-A39 PolarHBondContact OD1-N 2.85Å; D36-A39 WeakPolarHBondContact OD2-CB 3.35Å; A39-S41 VanDerWaalsContact C-N 3.35Å; A39-S41 PolarHBondContact O-N 2.91Å; A39-A42 PolarHBondContact O-N 2.95Å; A39-I43 WeakPolarHBondContact O-CB 3.38Å; A39-I43 VanDerWaalsContact O-CG1 3.27Å; A39-I43 WeakPolarHBondContact O-CG1 3.26Å; A39-I43 PolarHBondContact O-N 3.36Å
40	A	94.2	Very high	93.6	Very high	3 Å²	3	66 Å²	66	3%	0.025	38%	0.378	C	S	.	.	H	α-helix	trans	-57.3	-46.8	175.4	0	0	0	0	0	112.6	L19 L21 V26 D36 E37 Q38 S44	L19-A40 HydrophobicContact CD1-CB 4.12Å; L19-A40 HydrophobicContact CD2-CB 4.14Å; L21-A40 HydrophobicContact CD1-CB 4.07Å; L21-A40 WeakPolarHBondContact CD1-O 3.35Å; L21-A40 HydrophobicContact CD2-CB 3.74Å; V26-A40 HydrophobicContact CG2-CB 3.77Å; D36-A40 PolarHBondContact O-N 2.94Å; E37-A40 WeakPolarHBondContact O-CB 3.28Å; E37-A40 PolarHBondContact O-N 2.83Å; Q38-A40 VanDerWaalsContact C-N 3.32Å; Q38-A40 PolarHBondContact O-N 2.88Å; A40-S44 WeakPolarHBondContact O-CB 3.29Å; A40-S44 PolarHBondContact O-N 2.93Å; A40-S44 PolarHBondContact O-OG 3.11Å
41	S	94.4	Very high	93	Very high	77 Å²	77	66.1 Å²	66.1	54%	0.538	38%	0.379	S	S	.	.	H	α-helix	trans	-63	-51.1	178	-174.8	0	0	0	0	111.3	E37 Q38 A39 I43 S44 E45	E37-S41 WeakPolarHBondContact O-CB 3.3Å; E37-S41 PolarHBondContact O-N 2.94Å; Q38-S41 PolarHBondContact O-N 2.99Å; A39-S41 VanDerWaalsContact C-N 3.35Å; A39-S41 PolarHBondContact O-N 2.91Å; S41-I43 VanDerWaalsContact C-N 3.34Å; S41-I43 PolarHBondContact O-N 3.42Å; S41-S44 WeakPolarHBondContact O-CB 3.27Å; S41-S44 PolarHBondContact O-N 3.03Å; S41-S44 VanDerWaalsContact O-N 3.15Å; S41-E45 PolarHBondContact O-N 3.19Å
42	A	95.2	Very high	92.2	Very high	55 Å²	55	67.2 Å²	67.2	46%	0.455	39%	0.389	S	S	.	.	H	α-helix	trans	-60.5	-41.3	-179.8	0	0	0	0	0	112.6	Q38 A39 E45 L46	Q38-A42 PolarHBondContact O-N 3.45Å; A39-A42 PolarHBondContact O-N 2.95Å; A42-E45 PolarHBondContact O-N 3.24Å; A42-L46 WeakPolarHBondContact O-CB 3.46Å; A42-L46 PolarHBondContact O-N 2.78Å
43	I	94.9	Very high	91.1	Very high	9 Å²	9	69.1 Å²	69.1	5%	0.046	39%	0.394	C	S	.	.	H	α-helix	trans	-68.6	-38.8	177.3	-69.1	177.9	0	0	0	111.3	A39 S41 E45 L46 V47 L75 V77 V84 V86	A39-I43 WeakPolarHBondContact O-CB 3.38Å; A39-I43 VanDerWaalsContact O-CG1 3.27Å; A39-I43 WeakPolarHBondContact O-CG1 3.26Å; A39-I43 PolarHBondContact O-N 3.36Å; S41-I43 VanDerWaalsContact C-N 3.34Å; S41-I43 PolarHBondContact O-N 3.42Å; I43-E45 VanDerWaalsContact C-N 3.32Å; I43-E45 PolarHBondContact O-N 2.78Å; I43-L46 PolarHBondContact O-N 3.38Å; I43-V47 HydrophobicContact CG2-CG2 4.15Å; I43-V47 WeakPolarHBondContact O-CB 3.41Å; I43-V47 VanDerWaalsContact O-CG2 3.3Å; I43-V47 WeakPolarHBondContact O-CG2 3.25Å; I43-V47 PolarHBondContact O-N 2.87Å; I43-L75 HydrophobicContact CD1-CD1 4.34Å; I43-V77 HydrophobicContact CG2-CG1 3.95Å; I43-V77 HydrophobicContact CG2-CG2 4.1Å; I43-V84 HydrophobicContact CG2-CG1 4.22Å; I43-V86 HydrophobicContact CD1-CB 4.19Å; I43-V86 HydrophobicContact CD1-CG1 3.47Å; I43-V86 VanDerWaalsContact CD1-CG1 3.47Å; I43-V86 HydrophobicContact CD1-CG2 3.69Å; I43-V86 HydrophobicContact CG2-CG2 3.78Å
44	S	93.2	Very high	89.5	Confident	31 Å²	31	75.3 Å²	75.3	22%	0.217	42%	0.417	C	S	.	.	H	α-helix	trans	-61.3	-43.7	177.3	-62.2	0	0	0	0	111.2	L21 A40 S41 V47 S48	L21-S44 VanDerWaalsContact CD1-OG 3.29Å; L21-S44 WeakPolarHBondContact CD1-OG 3.43Å; A40-S44 WeakPolarHBondContact O-CB 3.29Å; A40-S44 PolarHBondContact O-N 2.93Å; A40-S44 PolarHBondContact O-OG 3.11Å; S41-S44 WeakPolarHBondContact O-CB 3.27Å; S41-S44 PolarHBondContact O-N 3.03Å; S41-S44 VanDerWaalsContact O-N 3.15Å; S44-V47 PolarHBondContact O-N 3.17Å; S44-S48 VanDerWaalsContact O-CB 3.3Å; S44-S48 WeakPolarHBondContact O-CB 3.45Å; S44-S48 PolarHBondContact O-N 3.37Å
45	E	93.7	Very high	87.8	Confident	137 Å²	137	76.6 Å²	76.6	64%	0.64	43%	0.427	S	S	*	.	H	α-helix	trans	-65.8	-42.8	177.1	-163.7	174.5	-153.3	0	0	111.9	S41 A42 I43 S48 T49	S41-E45 PolarHBondContact O-N 3.19Å; A42-E45 PolarHBondContact O-N 3.24Å; I43-E45 VanDerWaalsContact C-N 3.32Å; I43-E45 PolarHBondContact O-N 2.78Å; E45-S48 PolarHBondContact O-N 3.26Å; E45-T49 VanDerWaalsContact O-CB 3.29Å; E45-T49 WeakPolarHBondContact O-CB 3.47Å; E45-T49 PolarHBondContact O-N 2.76Å; E45-T49 PolarHBondContact O-OG1 2.8Å
46	L	93.3	Very high	86.3	Confident	71 Å²	71	78.5 Å²	78.5	37%	0.372	43%	0.431	S	S	.	.	H	α-helix	trans	-60	-47.4	175.5	-178.3	67.1	0	0	0	112	A42 I43 T49 A50 L66 V68	A42-L46 WeakPolarHBondContact O-CB 3.46Å; A42-L46 PolarHBondContact O-N 2.78Å; I43-L46 PolarHBondContact O-N 3.38Å; L46-T49 PolarHBondContact O-N 3.11Å; L46-A50 VanDerWaalsContact O-CB 3.28Å; L46-A50 WeakPolarHBondContact O-CB 3.43Å; L46-A50 PolarHBondContact O-N 2.86Å; L46-L66 HydrophobicContact CD2-CD1 4.26Å; L46-L66 HydrophobicContact CD2-CD2 3.76Å; L46-L66 HydrophobicContact CG-CD1 4.09Å; L46-L66 HydrophobicContact CG-CD2 4.48Å; L46-V68 HydrophobicContact CD2-CG2 3.71Å
47	V	91.3	Very high	84.6	Confident	10 Å²	10	85.3 Å²	85.3	6%	0.061	46%	0.461	C	S	.	.	H	α-helix	trans	-65.8	-44.8	179	169.6	0	0	0	0	111	I43 S44 T49 A50 C51 V77 V79 V84	I43-V47 HydrophobicContact CG2-CG2 4.15Å; I43-V47 WeakPolarHBondContact O-CB 3.41Å; I43-V47 VanDerWaalsContact O-CG2 3.3Å; I43-V47 WeakPolarHBondContact O-CG2 3.25Å; I43-V47 PolarHBondContact O-N 2.87Å; S44-V47 PolarHBondContact O-N 3.17Å; V47-T49 VanDerWaalsContact C-N 3.3Å; V47-T49 PolarHBondContact O-N 3.18Å; V47-A50 PolarHBondContact O-N 2.91Å; V47-C51 VanDerWaalsContact O-CB 3.27Å; V47-C51 WeakPolarHBondContact O-CB 3.25Å; V47-C51 PolarHBondContact O-N 2.96Å; V47-C51 PolarHBondContact O-SG 2.8Å; V47-V77 HydrophobicContact CG2-CG1 3.56Å; V47-V79 HydrophobicContact CG1-CG2 3.48Å; V47-V79 VanDerWaalsContact CG1-CG2 3.48Å; V47-V84 HydrophobicContact CG1-CG2 4.46Å; V47-V84 HydrophobicContact CG2-CG1 4.16Å
48	S	89.9	Confident	83.1	Confident	86 Å²	86	80 Å²	80	60%	0.601	45%	0.446	S	S	*	.	H	α-helix	trans	-57	-47.6	177.2	-177.2	0	0	0	0	110.9	S44 E45 C51 G52	S44-S48 VanDerWaalsContact O-CB 3.3Å; S44-S48 WeakPolarHBondContact O-CB 3.45Å; S44-S48 PolarHBondContact O-N 3.37Å; E45-S48 PolarHBondContact O-N 3.26Å; S48-C51 PolarHBondContact O-N 2.84Å; S48-G52 PolarHBondContact O-N 3.39Å
49	T	90.1	Very high	81.5	Confident	74 Å²	74	80.7 Å²	80.7	45%	0.454	45%	0.452	S	S	.	.	H	α-helix	trans	-62.1	-51.8	177.8	-60.6	0	0	0	0	111.3	E45 L46 V47 C51 G52 F53	E45-T49 VanDerWaalsContact O-CB 3.29Å; E45-T49 WeakPolarHBondContact O-CB 3.47Å; E45-T49 PolarHBondContact O-N 2.76Å; E45-T49 PolarHBondContact O-OG1 2.8Å; L46-T49 PolarHBondContact O-N 3.11Å; V47-T49 VanDerWaalsContact C-N 3.3Å; V47-T49 PolarHBondContact O-N 3.18Å; T49-C51 VanDerWaalsContact C-N 3.33Å; T49-C51 PolarHBondContact O-N 2.86Å; T49-G52 PolarHBondContact O-N 2.85Å; T49-G52 VanDerWaalsContact O-N 3.1Å; T49-F53 HydrophobicContact CG2-CD2 3.96Å; T49-F53 HydrophobicContact CG2-CE2 3.49Å; T49-F53 VanDerWaalsContact CG2-CE2 3.49Å; T49-F53 WeakPolarHBondContact O-CD2 3.32Å; T49-F53 PolarHBondContact O-N 2.82Å; T49-F53 VanDerWaalsContact O-N 3.14Å
50	A	88.1	Confident	80.2	Confident	24 Å²	24	86.5 Å²	86.5	20%	0.198	48%	0.48	C	S	.	.	H	α-helix	trans	-62.5	-37.2	-179	0	0	0	0	0	113	L46 V47 F53 F63 L66	L46-A50 VanDerWaalsContact O-CB 3.28Å; L46-A50 WeakPolarHBondContact O-CB 3.43Å; L46-A50 PolarHBondContact O-N 2.86Å; V47-A50 PolarHBondContact O-N 2.91Å; A50-F53 PolarHBondContact O-N 2.83Å; A50-F63 HydrophobicContact CB-CE1 3.65Å; A50-F63 HydrophobicContact CB-CZ 3.89Å; A50-L66 HydrophobicContact CB-CD1 3.88Å
51	C	83.3	Confident	78.8	Confident	40 Å²	40	90.7 Å²	90.7	27%	0.27	51%	0.505	S	S	.	.	H	α-helix	trans	-72.1	-30.6	174.8	-72.9	0	0	0	0	112.6	V47 S48 T49 F53	V47-C51 VanDerWaalsContact O-CB 3.27Å; V47-C51 WeakPolarHBondContact O-CB 3.25Å; V47-C51 PolarHBondContact O-N 2.96Å; V47-C51 PolarHBondContact O-SG 2.8Å; S48-C51 PolarHBondContact O-N 2.84Å; T49-C51 VanDerWaalsContact C-N 3.33Å; T49-C51 PolarHBondContact O-N 2.86Å; C51-F53 VanDerWaalsContact C-N 3.29Å
52	G	81.1	Confident	77.8	Confident	59 Å²	59	90 Å²	90	61%	0.608	50%	0.499	S	S	*	.	H	α-helix	trans	-67.4	-27.7	173.3	0	0	0	0	0	113.2	S48 T49 R54	S48-G52 PolarHBondContact O-N 3.39Å; T49-G52 PolarHBondContact O-N 2.85Å; T49-G52 VanDerWaalsContact O-N 3.1Å; G52-R54 PolarHBondContact O-N 3.04Å
53	F	72.1	Confident	77.2	Confident	132 Å²	132	89.9 Å²	89.9	58%	0.579	49%	0.488	S	S	*	.			trans	-75	87.4	175.7	-79.8	-70.8	0	0	0	112.3	T49 A50 C51 L55	T49-F53 HydrophobicContact CG2-CD2 3.96Å; T49-F53 HydrophobicContact CG2-CE2 3.49Å; T49-F53 VanDerWaalsContact CG2-CE2 3.49Å; T49-F53 WeakPolarHBondContact O-CD2 3.32Å; T49-F53 PolarHBondContact O-N 2.82Å; T49-F53 VanDerWaalsContact O-N 3.14Å; A50-F53 PolarHBondContact O-N 2.83Å; C51-F53 VanDerWaalsContact C-N 3.29Å; F53-L55 VanDerWaalsContact C-N 3.34Å; F53-L55 PolarHBondContact O-N 3.5Å; F53-L55 VanDerWaalsContact O-N 3.08Å
54	R	64.1	Low	77	Confident	139 Å²	139	98.8 Å²	98.8	53%	0.525	53%	0.527	S	S	.	.			trans	-82.1	77.5	169.4	-61	-153.9	-173.7	-114	-0.2	111.2	G52 H56 G58 M59	G52-R54 PolarHBondContact O-N 3.04Å; R54-H56 PolarHBondContact O-N 2.87Å; R54-G58 PolarHBondContact NH1-O 3.27Å; R54-M59 PolarHBondContact NH1-O 3.39Å
55	L	60.5	Low	77	Confident	148 Å²	148	104.8 Å²	104.8	78%	0.775	55%	0.545	S	S	*	.	S	Bend	trans	-57.9	-29.7	173.5	-82.7	159	0	0	0	112.8	F53	F53-L55 VanDerWaalsContact C-N 3.34Å; F53-L55 PolarHBondContact O-N 3.5Å; F53-L55 VanDerWaalsContact O-N 3.08Å
56	H	59.3	Low	77	Confident	162 Å²	162	99.7 Å²	99.7	75%	0.75	52%	0.521	S	S	*	.	S	Bend	trans	-118.1	139.5	171.9	-63.5	-70.2	0	0	0	108.9	R54 G58	R54-H56 PolarHBondContact O-N 2.87Å; H56-G58 PolarHBondContact O-N 3.42Å
57	H	58.2	Low	77.1	Confident	199 Å²	199	99 Å²	99	92%	0.921	52%	0.523	S	S	*	.	S	Bend	trans	-68.7	28	-176.3	-61.8	14.9	0	0	0	114.1
58	G	60.8	Low	77.4	Confident	39 Å²	39	100.7 Å²	100.7	40%	0.402	53%	0.533	S	S	.	.			trans	-93	152.4	-178.8	0	0	0	0	0	113.2	R54 H56 N60	R54-G58 PolarHBondContact NH1-O 3.27Å; H56-G58 PolarHBondContact O-N 3.42Å; G58-N60 VanDerWaalsContact C-N 3.29Å; G58-N60 PolarHBondContact O-N 3.39Å
59	M	60.5	Low	77.7	Confident	179 Å²	179	101.5 Å²	101.5	88%	0.882	53%	0.534	S	S	*	.	S	Bend	trans	-71.8	-18.2	179.9	-66.4	177.7	63.3	0	0	113.9	R54	R54-M59 PolarHBondContact NH1-O 3.39Å
60	N	65.5	Low	77.9	Confident	143 Å²	143	102.6 Å²	102.6	77%	0.765	53%	0.533	S	S	*	.	S	Bend	trans	-83.4	153.8	-176.8	-74.5	-23.1	0	0	0	113.7	G58	G58-N60 VanDerWaalsContact C-N 3.29Å; G58-N60 PolarHBondContact O-N 3.39Å
61	V	66.4	Low	78.1	Confident	90 Å²	90	104.6 Å²	104.6	55%	0.545	56%	0.556	S	S	.	*			trans	-57.8	131.6	172.4	-178.4	0	0	0	0	108.9	F63	V61-F63 PolarHBondContact O-N 3.41Å; V61-F63 VanDerWaalsContact O-N 3.13Å
62	P	72.4	Confident	78.6	Confident	64 Å²	64	108.9 Å²	108.9	42%	0.416	57%	0.572	S	S	.	*	S	Bend	trans	-70.2	-11.3	-168.6	22.8	-30.2	0	0	0	114.5
63	F	83.2	Confident	79.3	Confident	52 Å²	52	108.2 Å²	108.2	23%	0.228	55%	0.553	C	S	.	*			trans	-144.4	153	-178.4	56.7	-91.2	0	0	0	112.1	A50 V61 L66	A50-F63 HydrophobicContact CB-CE1 3.65Å; A50-F63 HydrophobicContact CB-CZ 3.89Å; V61-F63 PolarHBondContact O-N 3.41Å; V61-F63 VanDerWaalsContact O-N 3.13Å; F63-L66 HydrophobicContact CD2-CB 4.25Å; F63-L66 HydrophobicContact CE2-CB 4.01Å; F63-L66 HydrophobicContact CZ-CD1 4.44Å
64	K	89.4	Confident	80.4	Confident	196 Å²	196	102.8 Å²	102.8	85%	0.852	53%	0.53	S	S	*	.	S	Bend	trans	-89	-26.9	171.7	-65.8	-175.8	-179.7	179.6	0	113	T78	K64-T78 WeakPolarHBondContact O-CG2 3.47Å
65	R	93.3	Very high	82	Confident	157 Å²	157	97.2 Å²	97.2	59%	0.592	51%	0.511	S	S	*	.			trans	-153.7	135.9	-177.8	-174.2	170.7	67.1	-158.7	-1.8	109.8	V77	R65-V77 CarbonylContact C-O 3.6Å; R65-V77 WeakPolarHBondContact CA-O 3.27Å
66	L	93.9	Very high	83.8	Confident	29 Å²	29	91.8 Å²	91.8	15%	0.152	48%	0.482	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	136.6	170.2	-173.8	159.2	0	0	0	107.9	L46 A50 F63 V68 V77	L46-L66 HydrophobicContact CD2-CD1 4.26Å; L46-L66 HydrophobicContact CD2-CD2 3.76Å; L46-L66 HydrophobicContact CG-CD1 4.09Å; L46-L66 HydrophobicContact CG-CD2 4.48Å; A50-L66 HydrophobicContact CB-CD1 3.88Å; F63-L66 HydrophobicContact CD2-CB 4.25Å; F63-L66 HydrophobicContact CE2-CB 4.01Å; F63-L66 HydrophobicContact CZ-CD1 4.44Å; L66-V68 HydrophobicContact CD2-CG2 3.59Å; L66-V77 HydrophobicContact CB-CB 4.3Å; L66-V77 PolarHBondContact N-O 3.19Å; L66-V77 PolarHBondContact O-N 3.02Å
67	S	95.8	Very high	85.5	Confident	58 Å²	58	84.1 Å²	84.1	41%	0.406	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	119.1	179	-55	0	0	0	0	109.9	L75 L76	S67-L75 CarbonylContact C-O 3.58Å; S67-L75 WeakPolarHBondContact CA-O 3.21Å; S67-L76 VanDerWaalsContact OG-CD2 3.26Å; S67-L76 WeakPolarHBondContact OG-CD2 3.5Å
68	V	96.4	Very high	87.2	Confident	44 Å²	44	77 Å²	77	27%	0.267	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	105.4	172.1	-170.9	0	0	0	0	107.5	L46 L66 F70 T74 L75	L46-V68 HydrophobicContact CD2-CG2 3.71Å; L66-V68 HydrophobicContact CD2-CG2 3.59Å; V68-F70 HydrophobicContact CB-CE2 4.16Å; V68-F70 HydrophobicContact CG1-CD2 4.36Å; V68-F70 HydrophobicContact CG1-CE1 4.43Å; V68-F70 HydrophobicContact CG1-CE2 3.58Å; V68-F70 HydrophobicContact CG1-CZ 3.63Å; V68-T74 CarbonylContact O-C 3.59Å; V68-T74 WeakPolarHBondContact O-CA 3.33Å; V68-L75 HydrophobicContact CB-CB 4.27Å; V68-L75 PolarHBondContact N-O 3.01Å; V68-L75 PolarHBondContact O-N 2.68Å
69	V	96.2	Very high	88.7	Confident	104 Å²	104	77.8 Å²	77.8	63%	0.63	42%	0.415	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.8	112	-173.3	-176.2	0	0	0	0	109.2	T74	V69-T74 HydrophobicContact CG2-CG2 3.98Å
70	F	94.4	Very high	90.1	Very high	96 Å²	96	73 Å²	73	42%	0.421	40%	0.398	S	S	.	.			trans	-93.8	179.7	169	-58.9	-87.4	0	0	0	109.7	V68 H73 L75 N91	V68-F70 HydrophobicContact CB-CE2 4.16Å; V68-F70 HydrophobicContact CG1-CD2 4.36Å; V68-F70 HydrophobicContact CG1-CE1 4.43Å; V68-F70 HydrophobicContact CG1-CE2 3.58Å; V68-F70 HydrophobicContact CG1-CZ 3.63Å; F70-H73 CarbonylContact C-O 3.59Å; F70-H73 WeakPolarHBondContact CA-O 3.21Å; F70-H73 VanDerWaalsContact CB-O 3.32Å; F70-H73 WeakPolarHBondContact CB-O 3.38Å; F70-H73 AromaticContact CD2-CD2 3.67Å; F70-H73 AromaticContact CD2-CE1 3.92Å; F70-H73 AromaticContact CD2-NE2 3.3Å; F70-H73 VanDerWaalsContact CD2-NE2 3.3Å; F70-H73 WeakPolarHBondContact CD2-NE2 3.38Å; F70-H73 AromaticContact CE2-NE2 3.83Å; F70-H73 AromaticContact CG-CE1 3.95Å; F70-H73 AromaticContact CG-NE2 3.8Å; F70-H73 PolarHBondContact N-O 3.25Å; F70-L75 HydrophobicContact CE2-CD1 3.9Å; F70-L75 HydrophobicContact CE2-CG 4.04Å; F70-N91 PolarHBondContact O-ND2 2.94Å
71	G	92.9	Very high	91.1	Very high	66 Å²	66	69.6 Å²	69.6	68%	0.68	40%	0.397	S	S	*	.	S	Bend	trans	-58.8	-56.5	177.4	0	0	0	0	0	112.6	N91	G71-N91 PolarHBondContact O-ND2 3.44Å
72	E	93.5	Very high	92.1	Very high	131 Å²	131	72.8 Å²	72.8	61%	0.612	41%	0.406	S	S	*	.	S	Bend	trans	-94.4	-19.6	-172.2	-59.1	-52.7	124.5	0	0	114.5	Q90 N91	E72-Q90 VanDerWaalsContact O-CD 3.31Å; E72-Q90 PolarHBondContact O-NE2 3.3Å; E72-N91 WeakPolarHBondContact O-CB 3.27Å; E72-N91 PolarHBondContact O-N 3.49Å
73	H	95.4	Very high	93.1	Very high	44 Å²	44	74.6 Å²	74.6	20%	0.204	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.6	165.6	-174.7	67.7	-87.3	0	0	0	112.2	L16 F70 K88 R89 N91	L16-H73 HydrophobicContact CD1-CB 4.44Å; F70-H73 CarbonylContact C-O 3.59Å; F70-H73 WeakPolarHBondContact CA-O 3.21Å; F70-H73 VanDerWaalsContact CB-O 3.32Å; F70-H73 WeakPolarHBondContact CB-O 3.38Å; F70-H73 AromaticContact CD2-CD2 3.67Å; F70-H73 AromaticContact CD2-CE1 3.92Å; F70-H73 AromaticContact CD2-NE2 3.3Å; F70-H73 VanDerWaalsContact CD2-NE2 3.3Å; F70-H73 WeakPolarHBondContact CD2-NE2 3.38Å; F70-H73 AromaticContact CE2-NE2 3.83Å; F70-H73 AromaticContact CG-CE1 3.95Å; F70-H73 AromaticContact CG-NE2 3.8Å; F70-H73 PolarHBondContact N-O 3.25Å; H73-K88 HydrophobicContact CB-CG 4.29Å; H73-K88 WeakPolarHBondContact CD2-CE 3.45Å; H73-K88 VanDerWaalsContact CG-CE 3.48Å; H73-R89 CarbonylContact C-O 3.59Å; H73-R89 WeakPolarHBondContact CA-O 3.48Å; H73-R89 VanDerWaalsContact CB-O 3.27Å; H73-R89 WeakPolarHBondContact CB-O 3.46Å; H73-N91 WeakPolarHBondContact CA-OD1 3.25Å; H73-N91 PolarHBondContact N-ND2 3.05Å; H73-N91 PolarHBondContact O-ND2 2.7Å
74	T	96.8	Very high	93.6	Very high	18 Å²	18	73 Å²	73	11%	0.11	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	134.7	174.7	-65.4	0	0	0	0	109.7	V68 V69 L76 K88 R89 N91	V68-T74 CarbonylContact O-C 3.59Å; V68-T74 WeakPolarHBondContact O-CA 3.33Å; V69-T74 HydrophobicContact CG2-CG2 3.98Å; T74-L76 HydrophobicContact CG2-CD2 3.72Å; T74-L76 HydrophobicContact CG2-CG 4.13Å; T74-K88 WeakPolarHBondContact O-CA 3.45Å; T74-R89 PolarHBondContact N-O 3.05Å; T74-R89 PolarHBondContact O-N 3.25Å; T74-N91 WeakPolarHBondContact CB-OD1 3.38Å; T74-N91 PolarHBondContact N-OD1 3.44Å; T74-N91 PolarHBondContact OG1-OD1 2.83Å
75	L	97.6	Very high	93.9	Very high	22 Å²	22	65.6 Å²	65.6	12%	0.115	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	118.3	165.4	-60.6	176.8	0	0	0	109.1	L33 I43 S67 V68 F70 V86 K88	L33-L75 HydrophobicContact CD1-CD2 4.36Å; I43-L75 HydrophobicContact CD1-CD1 4.34Å; S67-L75 CarbonylContact C-O 3.58Å; S67-L75 WeakPolarHBondContact CA-O 3.21Å; V68-L75 HydrophobicContact CB-CB 4.27Å; V68-L75 PolarHBondContact N-O 3.01Å; V68-L75 PolarHBondContact O-N 2.68Å; F70-L75 HydrophobicContact CE2-CD1 3.9Å; F70-L75 HydrophobicContact CE2-CG 4.04Å; L75-V86 HydrophobicContact CD2-CG1 4.46Å; L75-K88 HydrophobicContact CD2-CB 3.68Å; L75-K88 HydrophobicContact CD2-CD 4.48Å; L75-K88 HydrophobicContact CD2-CG 3.84Å
76	L	96.9	Very high	94.1	Very high	34 Å²	34	58.1 Å²	58.1	18%	0.178	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	121.9	175.8	-61.4	173.3	0	0	0	108.8	S67 T74 V86 V87 R89	S67-L76 VanDerWaalsContact OG-CD2 3.26Å; S67-L76 WeakPolarHBondContact OG-CD2 3.5Å; T74-L76 HydrophobicContact CG2-CD2 3.72Å; T74-L76 HydrophobicContact CG2-CG 4.13Å; L76-V86 CarbonylContact O-C 3.58Å; L76-V86 WeakPolarHBondContact O-CA 3.46Å; L76-V87 PolarHBondContact N-O 3.49Å; L76-V87 PolarHBondContact O-N 3.48Å; L76-R89 HydrophobicContact CD1-CG 4.18Å
77	V	96.3	Very high	94.3	Very high	1 Å²	1	57.1 Å²	57.1	1%	0.006	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	131.1	-175.3	-171.7	0	0	0	0	110.7	I43 V47 R65 L66 V84 F85 V86	I43-V77 HydrophobicContact CG2-CG1 3.95Å; I43-V77 HydrophobicContact CG2-CG2 4.1Å; V47-V77 HydrophobicContact CG2-CG1 3.56Å; R65-V77 CarbonylContact C-O 3.6Å; R65-V77 WeakPolarHBondContact CA-O 3.27Å; L66-V77 HydrophobicContact CB-CB 4.3Å; L66-V77 PolarHBondContact N-O 3.19Å; L66-V77 PolarHBondContact O-N 3.02Å; V77-V84 HydrophobicContact CG1-CG1 3.58Å; V77-F85 CarbonylContact C-O 3.59Å; V77-F85 VanDerWaalsContact CA-O 3.28Å; V77-F85 WeakPolarHBondContact CA-O 3.46Å; V77-V86 HydrophobicContact CG1-CG2 4.33Å; V77-V86 HydrophobicContact CG2-CG1 4.32Å; V77-V86 HydrophobicContact CG2-CG2 4.25Å
78	T	94.2	Very high	94.4	Very high	49 Å²	49	56 Å²	56	30%	0.301	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.4	142.4	176.2	-62.2	0	0	0	0	109.9	K64 F85	K64-T78 WeakPolarHBondContact O-CG2 3.47Å; T78-F85 PolarHBondContact N-O 3.08Å; T78-F85 PolarHBondContact O-N 3.05Å
79	V	91.4	Very high	94.4	Very high	57 Å²	57	57.6 Å²	57.6	35%	0.345	32%	0.323	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	129	172.4	-172.7	0	0	0	0	109	V47 R83 V84	V47-V79 HydrophobicContact CG1-CG2 3.48Å; V47-V79 VanDerWaalsContact CG1-CG2 3.48Å; V79-R83 WeakPolarHBondContact CA-O 3.22Å; V79-V84 HydrophobicContact CG2-CG2 4.3Å
80	S	89.6	Confident	94.4	Very high	77 Å²	77	56.3 Å²	56.3	54%	0.538	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.8	122.4	173.5	-179.8	0	0	0	0	110	Q82 R83	S80-Q82 PolarHBondContact O-N 3.22Å; S80-R83 PolarHBondContact N-O 3.26Å; S80-R83 PolarHBondContact O-N 3.49Å
81	G	87.6	Confident	94.2	Very high	72 Å²	72	54 Å²	54	74%	0.742	30%	0.303	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.2	-129.1	-166	0	0	0	0	0	110.3
82	Q	87.8	Confident	93.6	Very high	157 Å²	157	59.2 Å²	59.2	73%	0.734	30%	0.302	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.5	15	176.5	-66.1	176.3	-14.2	0	0	113	S80	S80-Q82 PolarHBondContact O-N 3.22Å
83	R	92.6	Very high	92.2	Very high	102 Å²	102	56.3 Å²	56.3	39%	0.385	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	138	-175.3	-63.7	179.3	-173.3	172.4	0.6	111.7	L21 V79 S80 F85	L21-R83 CarbonylContact O-C 3.52Å; L21-R83 VanDerWaalsContact O-CA 3.25Å; L21-R83 WeakPolarHBondContact O-CA 3.47Å; V79-R83 WeakPolarHBondContact CA-O 3.22Å; S80-R83 PolarHBondContact N-O 3.26Å; S80-R83 PolarHBondContact O-N 3.49Å; R83-F85 HydrophobicContact CB-CD2 4.4Å; R83-F85 HydrophobicContact CB-CE2 3.62Å; R83-F85 HydrophobicContact CB-CZ 3.89Å
84	V	94.3	Very high	90.4	Very high	20 Å²	20	66 Å²	66	12%	0.121	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	128.8	171.5	-174.4	0	0	0	0	108.1	V20 L21 I43 V47 V77 V79 V86	V20-V84 WeakPolarHBondContact CA-O 3.38Å; L21-V84 HydrophobicContact CB-CB 4.15Å; L21-V84 PolarHBondContact N-O 3.36Å; L21-V84 PolarHBondContact O-N 3.32Å; I43-V84 HydrophobicContact CG2-CG1 4.22Å; V47-V84 HydrophobicContact CG1-CG2 4.46Å; V47-V84 HydrophobicContact CG2-CG1 4.16Å; V77-V84 HydrophobicContact CG1-CG1 3.58Å; V79-V84 HydrophobicContact CG2-CG2 4.3Å; V84-V86 HydrophobicContact CG1-CG2 4.24Å
85	F	95.8	Very high	88.4	Confident	39 Å²	39	73.2 Å²	73.2	17%	0.171	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	126.6	177.9	-62.6	-93	0	0	0	108.8	L9 V20 V77 T78 R83	L9-F85 HydrophobicContact CD1-CD1 4.34Å; V20-F85 HydrophobicContact CG1-CD1 4.27Å; V20-F85 HydrophobicContact CG1-CE1 4.06Å; V20-F85 HydrophobicContact CG2-CD1 4.11Å; V20-F85 HydrophobicContact CG2-CE1 4.39Å; V77-F85 CarbonylContact C-O 3.59Å; V77-F85 VanDerWaalsContact CA-O 3.28Å; V77-F85 WeakPolarHBondContact CA-O 3.46Å; T78-F85 PolarHBondContact N-O 3.08Å; T78-F85 PolarHBondContact O-N 3.05Å; R83-F85 HydrophobicContact CB-CD2 4.4Å; R83-F85 HydrophobicContact CB-CE2 3.62Å; R83-F85 HydrophobicContact CB-CZ 3.89Å
86	V	97.1	Very high	86.7	Confident	0 Å²	0	77.6 Å²	77.6	0%	0	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	133.9	-180	-175.3	0	0	0	0	108.7	Y18 L19 L33 I43 L75 L76 V77 V84	Y18-V86 CarbonylContact C-O 3.53Å; Y18-V86 WeakPolarHBondContact CA-O 3.47Å; Y18-V86 WeakPolarHBondContact CB-O 3.09Å; L19-V86 HydrophobicContact CB-CB 4.12Å; L19-V86 HydrophobicContact CD2-CB 4.3Å; L19-V86 HydrophobicContact CD2-CG2 3.89Å; L19-V86 PolarHBondContact N-O 3.43Å; L19-V86 WeakPolarHBondContact O-CB 3.45Å; L19-V86 PolarHBondContact O-N 3.3Å; L33-V86 HydrophobicContact CD1-CG1 3.88Å; I43-V86 HydrophobicContact CD1-CB 4.19Å; I43-V86 HydrophobicContact CD1-CG1 3.47Å; I43-V86 VanDerWaalsContact CD1-CG1 3.47Å; I43-V86 HydrophobicContact CD1-CG2 3.69Å; I43-V86 HydrophobicContact CG2-CG2 3.78Å; L75-V86 HydrophobicContact CD2-CG1 4.46Å; L76-V86 CarbonylContact O-C 3.58Å; L76-V86 WeakPolarHBondContact O-CA 3.46Å; V77-V86 HydrophobicContact CG1-CG2 4.33Å; V77-V86 HydrophobicContact CG2-CG1 4.32Å; V77-V86 HydrophobicContact CG2-CG2 4.25Å; V84-V86 HydrophobicContact CG1-CG2 4.24Å
87	V	97.6	Very high	85.3	Confident	9 Å²	9	83.1 Å²	83.1	6%	0.055	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	124.8	171.5	-174.4	0	0	0	0	108.9	L9 I12 Q15 L76 R89	L9-V87 HydrophobicContact CD2-CG2 3.83Å; I12-V87 HydrophobicContact CD1-CB 4.46Å; I12-V87 HydrophobicContact CD1-CG1 4.14Å; I12-V87 HydrophobicContact CD1-CG2 3.74Å; I12-V87 HydrophobicContact CG2-CG1 4.37Å; Q15-V87 HydrophobicContact CB-CG1 4.12Å; Q15-V87 HydrophobicContact CG-CG1 3.76Å; L76-V87 PolarHBondContact N-O 3.49Å; L76-V87 PolarHBondContact O-N 3.48Å; V87-R89 HydrophobicContact CG1-CG 3.85Å
88	K	97.8	Very high	83.6	Confident	35 Å²	35	90.7 Å²	90.7	15%	0.152	47%	0.473	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.1	122.7	166.9	-171.4	-177.6	-175.4	-173	0	108.2	Q15 L16 G17 D32 L33 H73 T74 L75	Q15-K88 WeakPolarHBondContact CA-O 3.26Å; L16-K88 HydrophobicContact CB-CB 4.43Å; L16-K88 HydrophobicContact CB-CD 4.16Å; L16-K88 HydrophobicContact CB-CG 4.2Å; L16-K88 HydrophobicContact CD1-CD 4.43Å; L16-K88 HydrophobicContact CD1-CG 4.36Å; L16-K88 PolarHBondContact N-O 3.21Å; G17-K88 PolarHBondContact O-N 3.39Å; D32-K88 HydrophobicContact CB-CD 3.76Å; D32-K88 WeakPolarHBondContact OD2-CE 3.45Å; D32-K88 IonicContact OD2-NZ 3.85Å; D32-K88 PolarHBondContact OD2-NZ 3.03Å; L33-K88 HydrophobicContact CD1-CB 4.08Å; L33-K88 HydrophobicContact CG-CB 4.36Å; H73-K88 HydrophobicContact CB-CG 4.29Å; H73-K88 WeakPolarHBondContact CD2-CE 3.45Å; H73-K88 VanDerWaalsContact CG-CE 3.48Å; T74-K88 WeakPolarHBondContact O-CA 3.45Å; L75-K88 HydrophobicContact CD2-CB 3.68Å; L75-K88 HydrophobicContact CD2-CD 4.48Å; L75-K88 HydrophobicContact CD2-CG 3.84Å
89	R	96.5	Very high	81.7	Confident	77 Å²	77	98.3 Å²	98.3	29%	0.291	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	142.3	175	-65.3	-173.9	71.6	-151	-5.3	110.9	I12 P13 D14 H73 T74 L76 V87	I12-R89 HydrophobicContact CG2-CG 4.3Å; P13-R89 PolarHBondContact O-NE 2.83Å; P13-R89 PolarHBondContact O-NH2 3.02Å; D14-R89 VanDerWaalsContact O-CA 3.25Å; D14-R89 WeakPolarHBondContact O-CA 3.42Å; D14-R89 IonicContact OD2-NH2 3.59Å; H73-R89 CarbonylContact C-O 3.59Å; H73-R89 WeakPolarHBondContact CA-O 3.48Å; H73-R89 VanDerWaalsContact CB-O 3.27Å; H73-R89 WeakPolarHBondContact CB-O 3.46Å; T74-R89 PolarHBondContact N-O 3.05Å; T74-R89 PolarHBondContact O-N 3.25Å; L76-R89 HydrophobicContact CD1-CG 4.18Å; V87-R89 HydrophobicContact CG1-CG 3.85Å
90	Q	95.5	Very high	81.2	Confident	76 Å²	76	100.4 Å²	100.4	36%	0.355	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62	135.6	168.9	-171.6	68.7	17.8	0	0	109.4	D14 L16 E72 R92	D14-Q90 HydrophobicContact CB-CB 4.26Å; D14-Q90 PolarHBondContact O-N 2.89Å; L16-Q90 HydrophobicContact CD1-CB 4.09Å; L16-Q90 HydrophobicContact CD2-CB 4.43Å; L16-Q90 HydrophobicContact CG-CB 4.37Å; E72-Q90 VanDerWaalsContact O-CD 3.31Å; E72-Q90 PolarHBondContact O-NE2 3.3Å; Q90-R92 PolarHBondContact O-N 2.98Å
91	N	92.1	Very high	80.8	Confident	49 Å²	49	101.6 Å²	101.6	26%	0.262	53%	0.526	S	S	.	.			trans	-73.3	107.7	169.3	-69.3	-13.6	0	0	0	107.8	F70 G71 E72 H73 T74	F70-N91 PolarHBondContact O-ND2 2.94Å; G71-N91 PolarHBondContact O-ND2 3.44Å; E72-N91 WeakPolarHBondContact O-CB 3.27Å; E72-N91 PolarHBondContact O-N 3.49Å; H73-N91 WeakPolarHBondContact CA-OD1 3.25Å; H73-N91 PolarHBondContact N-ND2 3.05Å; H73-N91 PolarHBondContact O-ND2 2.7Å; T74-N91 WeakPolarHBondContact CB-OD1 3.38Å; T74-N91 PolarHBondContact N-OD1 3.44Å; T74-N91 PolarHBondContact OG1-OD1 2.83Å
92	R	78.8	Confident	80.4	Confident	175 Å²	175	103.2 Å²	103.2	66%	0.66	51%	0.514	S	S	*	.			trans	-78.9	135.5	162.4	-70.1	-170	174	-163.8	1.7	108.4	D14 Q90 R94	D14-R92 IonicContact OD1-CZ 2.7Å; D14-R92 IonicContact OD1-NE 2.83Å; D14-R92 PolarHBondContact OD1-NE 2.99Å; D14-R92 IonicContact OD1-NH2 3.06Å; D14-R92 PolarHBondContact OD1-NH2 2.93Å; D14-R92 WeakPolarHBondContact OD2-CD 3.25Å; D14-R92 IonicContact OD2-CZ 2.68Å; D14-R92 IonicContact OD2-NE 3.05Å; D14-R92 PolarHBondContact OD2-NE 3.09Å; D14-R92 IonicContact OD2-NH2 3.55Å; Q90-R92 PolarHBondContact O-N 2.98Å; R92-R94 PolarHBondContact O-N 3.34Å; R92-R94 VanDerWaalsContact O-N 3.11Å
93	G	65.3	Low	80	Confident	70 Å²	70	100.1 Å²	100.1	72%	0.722	50%	0.501	S	S	*	.			trans	-51.4	121	158	0	0	0	0	0	106.8	E95	G93-E95 PolarHBondContact O-N 3.28Å
94	R	56.9	Low	79.2	Confident	248 Å²	248	99.9 Å²	99.9	94%	0.936	51%	0.509	S	S	*	.			trans	-70	81.2	176.3	-77	-174.9	177.4	-173.7	0.3	107.6	R92	R92-R94 PolarHBondContact O-N 3.34Å; R92-R94 VanDerWaalsContact O-N 3.11Å
95	E	55.3	Low	78.2	Confident	168 Å²	168	105.3 Å²	105.3	79%	0.785	54%	0.535	S	S	*	.			trans	-68.3	135.4	156.6	-70.4	-176.3	171.4	0	0	107	G93 I97	G93-E95 PolarHBondContact O-N 3.28Å; E95-I97 PolarHBondContact O-N 2.9Å
96	P	60.6	Low	76.9	Confident	114 Å²	114	110 Å²	110	74%	0.74	56%	0.561	S	S	*	*			trans	-52.3	129.4	173.5	-20.4	30.3	0	0	0	109	D98	P96-D98 PolarHBondContact O-N 2.98Å
97	I	67.4	Low	75.4	Confident	151 Å²	151	118.5 Å²	118.5	77%	0.774	60%	0.604	S	S	*	*			trans	-76.7	108.5	166.2	-55.4	171	0	0	0	104.4	E95 V99	E95-I97 PolarHBondContact O-N 2.9Å; I97-V99 PolarHBondContact O-N 2.99Å
98	D	60.9	Low	73.5	Confident	160 Å²	160	127.6 Å²	127.6	86%	0.856	65%	0.649	S	S	*	*			trans	-59.8	119.1	169.1	-77.4	-31.9	0	0	0	108	P96	P96-D98 PolarHBondContact O-N 2.98Å
99	V	55.4	Low	71.3	Confident	208 Å²	208	136 Å²	136	100%	1.261	70%	0.695	S	S	*	*			trans	-106.2	0	177.2	-85.7	0	0	0	0	110.8	I97	I97-V99 PolarHBondContact O-N 2.99Å

Retrieved 99 of 99 residues in 17.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).