A0A096MQB4_PAPAN Loading...

cAMP-dependent protein kinase inhibitor

Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.

AlphaFold DB (G7P393), UniProt , Accession A0A096MQB4, Species PAPAN (Papio anubis, Olive baboon), Gene PKIB, Length 87 aa.

						>A0A096MQB4_PAPAN|A0A096MQB4|PKIB
MHILFVDVAMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEETTQDQLEKPQNEEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.1	Very low	54.2	Low	227 Å²	227	161.1 Å²	161.1	100%	1.118	82%	0.816	S	S	*	*				0	101.4	0	-62.7	-57.4	157.4	0	0	107.1
2	H	39.8	Very low	54.5	Low	190 Å²	190	158.3 Å²	158.3	88%	0.88	81%	0.813	S	S	*	*			trans	-85.2	111.4	178.1	-77	85.9	0	0	0	107.7	L4	H2-L4 PolarHBondContact O-N 3.41Å
3	I	53.5	Low	54.5	Low	147 Å²	147	157.5 Å²	157.5	75%	0.754	81%	0.812	S	S	*	*			trans	-78.4	108.9	176.7	-59.9	171.4	0	0	0	106.5	F5	I3-F5 PolarHBondContact O-N 3.2Å
4	L	51.3	Low	55	Low	157 Å²	157	153.8 Å²	153.8	82%	0.822	81%	0.806	S	S	*	*			trans	-74.3	103.1	170.7	-66	172.8	0	0	0	107.6	H2 V6	H2-L4 PolarHBondContact O-N 3.41Å; L4-V6 PolarHBondContact O-N 3.45Å; L4-V6 VanDerWaalsContact O-N 3.14Å
5	F	55.2	Low	55.5	Low	194 Å²	194	150.7 Å²	150.7	85%	0.851	80%	0.803	S	S	*	*			trans	-62.8	110.6	164.6	-110.1	-99.2	0	0	0	107.2	I3 D7	I3-F5 PolarHBondContact O-N 3.2Å; F5-D7 PolarHBondContact O-N 3.39Å; F5-D7 VanDerWaalsContact O-N 3.1Å
6	V	60	Low	55.8	Low	132 Å²	132	153.3 Å²	153.3	80%	0.8	80%	0.804	S	S	*	*			trans	-68	107.1	167.2	179.4	0	0	0	0	105.8	L4 V8	L4-V6 PolarHBondContact O-N 3.45Å; L4-V6 VanDerWaalsContact O-N 3.14Å; V6-V8 PolarHBondContact O-N 3.07Å; V6-V8 VanDerWaalsContact O-N 3.09Å
7	D	52.8	Low	56.4	Low	142 Å²	142	154.1 Å²	154.1	76%	0.759	81%	0.806	S	S	*	*			trans	-61.1	111.2	172.5	-171	55.8	0	0	0	107.8	F5 A9	F5-D7 PolarHBondContact O-N 3.39Å; F5-D7 VanDerWaalsContact O-N 3.1Å; D7-A9 PolarHBondContact O-N 3.25Å
8	V	56.6	Low	56.5	Low	117 Å²	117	151.8 Å²	151.8	71%	0.709	80%	0.8	S	S	*	*			trans	-72.2	90.6	173.4	69.6	0	0	0	0	106.3	V6 M10	V6-V8 PolarHBondContact O-N 3.07Å; V6-V8 VanDerWaalsContact O-N 3.09Å; V8-M10 PolarHBondContact O-N 3.15Å
9	A	57.9	Low	56.6	Low	77 Å²	77	151.9 Å²	151.9	64%	0.636	80%	0.801	S	S	*	*			trans	-59.6	99.1	177.2	0	0	0	0	0	109	D7 R11	D7-A9 PolarHBondContact O-N 3.25Å; A9-R11 PolarHBondContact O-N 3.42Å; A9-R11 VanDerWaalsContact O-N 3.08Å
10	M	64.4	Low	56.8	Low	155 Å²	155	149.9 Å²	149.9	76%	0.764	79%	0.794	S	S	*	*			trans	-59.6	111.6	169.8	-67.2	-67.3	-71.3	0	0	106.7	V8 T12	V8-M10 PolarHBondContact O-N 3.15Å; M10-T12 VanDerWaalsContact C-N 3.29Å; M10-T12 PolarHBondContact O-N 3.32Å
11	R	60	Low	57.1	Low	234 Å²	234	150.6 Å²	150.6	88%	0.883	79%	0.793	S	S	*	*			trans	-65	97.4	171.6	-63.8	-177.9	-167.2	179.9	3.6	106.8	A9 D13	A9-R11 PolarHBondContact O-N 3.42Å; A9-R11 VanDerWaalsContact O-N 3.08Å; R11-D13 PolarHBondContact O-N 3.33Å
12	T	57.8	Low	57.8	Low	127 Å²	127	145.6 Å²	145.6	78%	0.779	78%	0.78	S	S	*	*			trans	-71.8	83.9	166.4	53.7	0	0	0	0	106.3	M10 S14	M10-T12 VanDerWaalsContact C-N 3.29Å; M10-T12 PolarHBondContact O-N 3.32Å; T12-S14 VanDerWaalsContact C-N 3.29Å; T12-S14 PolarHBondContact O-N 3.42Å
13	D	53.7	Low	58.7	Low	149 Å²	149	139.7 Å²	139.7	80%	0.797	77%	0.771	S	S	*	*			trans	-58.2	105.9	160.2	-84.2	-46.6	0	0	0	105.8	R11 S15	R11-D13 PolarHBondContact O-N 3.33Å; D13-S15 PolarHBondContact O-N 2.97Å
14	S	62.1	Low	59	Low	105 Å²	105	137.1 Å²	137.1	73%	0.734	76%	0.762	S	S	*	*			trans	-62.2	88.8	173.1	-179.5	0	0	0	0	106.7	T12 K16	T12-S14 VanDerWaalsContact C-N 3.29Å; T12-S14 PolarHBondContact O-N 3.42Å; S14-K16 PolarHBondContact O-N 2.94Å
15	S	61.7	Low	59.4	Low	108 Å²	108	132.8 Å²	132.8	76%	0.755	75%	0.749	S	S	*	*			trans	-64.4	89.6	162	-172.9	0	0	0	0	105.1	D13 M17	D13-S15 PolarHBondContact O-N 2.97Å; S15-M17 PolarHBondContact O-N 2.77Å
16	K	60.6	Low	59.9	Low	191 Å²	191	130.2 Å²	130.2	83%	0.83	74%	0.744	S	S	*	*			trans	-54.9	79.6	164.5	45.7	-159.8	172.1	-177.2	0	108.2	S14 T18	S14-K16 PolarHBondContact O-N 2.94Å; K16-T18 PolarHBondContact O-N 3.16Å
17	M	66.2	Low	59.9	Low	168 Å²	168	132.3 Å²	132.3	83%	0.828	74%	0.743	S	S	*	*			trans	-63.1	119.9	165.1	-163.3	161.7	80.2	0	0	104.9	S15 D19	S15-M17 PolarHBondContact O-N 2.77Å; M17-D19 PolarHBondContact O-N 3.03Å; M17-D19 VanDerWaalsContact O-N 3.17Å
18	T	57.6	Low	60.5	Low	113 Å²	113	129.8 Å²	129.8	69%	0.693	74%	0.742	S	S	*	*			trans	-40.4	123.2	178.4	50.6	0	0	0	0	109.7	K16 V20	K16-T18 PolarHBondContact O-N 3.16Å; T18-V20 PolarHBondContact O-N 3.39Å
19	D	58.6	Low	61	Low	153 Å²	153	128.8 Å²	128.8	82%	0.818	74%	0.74	S	S	*	*			trans	-64.4	86.9	169.7	-174.3	15.1	0	0	0	107.1	M17 E21	M17-D19 PolarHBondContact O-N 3.03Å; M17-D19 VanDerWaalsContact O-N 3.17Å; D19-E21 PolarHBondContact O-N 3.08Å
20	V	60.9	Low	61.4	Low	111 Å²	111	127.6 Å²	127.6	67%	0.673	73%	0.727	S	S	*	*			trans	-72.8	108.4	167.4	175.6	0	0	0	0	103.9	T18 S22	T18-V20 PolarHBondContact O-N 3.39Å; V20-S22 PolarHBondContact O-N 3.15Å; V20-S22 VanDerWaalsContact O-N 3.1Å
21	E	62.4	Low	61.2	Low	165 Å²	165	124.6 Å²	124.6	77%	0.771	73%	0.727	S	S	*	*			trans	-40.3	122.8	178.3	-69.6	-163.9	164.4	0	0	109.7	D19 G23	D19-E21 PolarHBondContact O-N 3.08Å; E21-G23 PolarHBondContact O-N 3.32Å
22	S	60.6	Low	61.3	Low	122 Å²	122	122.9 Å²	122.9	85%	0.853	72%	0.721	S	S	*	*	G	3₁₀ helix	trans	-59.3	6.8	-177.2	64.5	0	0	0	0	115	V20 V24	V20-S22 PolarHBondContact O-N 3.15Å; V20-S22 VanDerWaalsContact O-N 3.1Å; S22-V24 VanDerWaalsContact C-N 3.31Å; S22-V24 PolarHBondContact O-N 2.9Å
23	G	59.1	Low	61.5	Low	67 Å²	67	121.1 Å²	121.1	69%	0.691	72%	0.719	S	S	*	*	G	3₁₀ helix	trans	-78.1	2.8	-173.6	0	0	0	0	0	116.1	E21	E21-G23 PolarHBondContact O-N 3.32Å
24	V	60.5	Low	62.1	Low	93 Å²	93	117 Å²	117	56%	0.564	71%	0.712	S	S	*	*	G	3₁₀ helix	trans	-126	53.4	174.3	-150.8	0	0	0	0	111.7	S22 N26 F27	S22-V24 VanDerWaalsContact C-N 3.31Å; S22-V24 PolarHBondContact O-N 2.9Å; V24-N26 HydrophobicContact CG1-CB 4.43Å; V24-N26 PolarHBondContact O-N 2.98Å; V24-F27 HydrophobicContact CB-CB 4.16Å; V24-F27 HydrophobicContact CG1-CB 3.64Å; V24-F27 WeakPolarHBondContact O-CB 3.48Å; V24-F27 PolarHBondContact O-N 3.19Å
25	A	59.7	Low	62.1	Low	66 Å²	66	122.4 Å²	122.4	55%	0.545	72%	0.716	S	S	.	*	H	α-helix	trans	-49.3	-29.2	163.5	0	0	0	0	0	111.7	F27 A28 S29	A25-F27 VanDerWaalsContact C-N 3.29Å; A25-F27 PolarHBondContact O-N 3.46Å; A25-A28 PolarHBondContact O-N 3.27Å; A25-S29 WeakPolarHBondContact O-CB 3.31Å; A25-S29 PolarHBondContact O-N 3.13Å; A25-S29 PolarHBondContact O-OG 3.08Å; A25-S29 VanDerWaalsContact O-OG 3.07Å
26	N	64.4	Low	62.5	Low	139 Å²	139	127.4 Å²	127.4	74%	0.743	72%	0.718	S	S	*	*	H	α-helix	trans	-66.2	-25.2	177	-149.9	38.6	0	0	0	114.1	V24 S30	V24-N26 HydrophobicContact CG1-CB 4.43Å; V24-N26 PolarHBondContact O-N 2.98Å; N26-S30 WeakPolarHBondContact O-CB 3.31Å; N26-S30 PolarHBondContact O-N 3.21Å
27	F	59.5	Low	62.6	Low	176 Å²	176	126.1 Å²	126.1	77%	0.772	72%	0.72	S	S	*	*	H	α-helix	trans	-77.9	-46.4	176.2	-176.7	-96	0	0	0	110.6	V24 A25 S30	V24-F27 HydrophobicContact CB-CB 4.16Å; V24-F27 HydrophobicContact CG1-CB 3.64Å; V24-F27 WeakPolarHBondContact O-CB 3.48Å; V24-F27 PolarHBondContact O-N 3.19Å; A25-F27 VanDerWaalsContact C-N 3.29Å; A25-F27 PolarHBondContact O-N 3.46Å; F27-S30 PolarHBondContact O-N 3.07Å
28	A	67.2	Low	62.8	Low	89 Å²	89	121.2 Å²	121.2	74%	0.736	71%	0.707	S	S	*	*	H	α-helix	trans	-73.2	-30.7	178.9	0	0	0	0	0	113.3	A25	A25-A28 PolarHBondContact O-N 3.27Å
29	S	66	Low	63.3	Low	97 Å²	97	123.4 Å²	123.4	68%	0.678	71%	0.713	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.2	0.4	175.2	-58.4	0	0	0	0	113.6	A25 A31	A25-S29 WeakPolarHBondContact O-CB 3.31Å; A25-S29 PolarHBondContact O-N 3.13Å; A25-S29 PolarHBondContact O-OG 3.08Å; A25-S29 VanDerWaalsContact O-OG 3.07Å; S29-A31 PolarHBondContact O-N 3.44Å; S29-A31 VanDerWaalsContact O-N 3.1Å
30	S	65.4	Low	63.7	Low	51 Å²	51	120.4 Å²	120.4	36%	0.357	70%	0.702	S	S	.	*			trans	-70.2	109.9	177.9	-165	0	0	0	0	110.4	N26 F27 R32 A33	N26-S30 WeakPolarHBondContact O-CB 3.31Å; N26-S30 PolarHBondContact O-N 3.21Å; F27-S30 PolarHBondContact O-N 3.07Å; S30-R32 PolarHBondContact O-N 3.05Å; S30-R32 WeakPolarHBondContact OG-CB 3.2Å; S30-R32 PolarHBondContact OG-N 2.83Å; S30-A33 PolarHBondContact O-N 3.35Å
31	A	62.3	Low	64	Low	93 Å²	93	121.9 Å²	121.9	77%	0.769	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.4	4.8	167.6	0	0	0	0	0	113.5	S29 A33	S29-A31 PolarHBondContact O-N 3.44Å; S29-A31 VanDerWaalsContact O-N 3.1Å; A31-A33 PolarHBondContact O-N 2.78Å
32	R	62.1	Low	64	Low	198 Å²	198	120.1 Å²	120.1	75%	0.747	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.8	-19.5	171.7	-164.3	166	-168.4	170	3	112.4	S30 G34	S30-R32 PolarHBondContact O-N 3.05Å; S30-R32 WeakPolarHBondContact OG-CB 3.2Å; S30-R32 PolarHBondContact OG-N 2.83Å; R32-G34 PolarHBondContact O-N 2.85Å
33	A	60.6	Low	64	Low	90 Å²	90	120.8 Å²	120.8	74%	0.744	69%	0.69	S	S	*	*	S	Bend	trans	-74.6	103.7	163.7	0	0	0	0	0	108.8	S30 A31	S30-A33 PolarHBondContact O-N 3.35Å; A31-A33 PolarHBondContact O-N 2.78Å
34	G	66	Low	63.9	Low	63 Å²	63	122 Å²	122	65%	0.649	69%	0.689	S	S	*	*	S	Bend	trans	111.4	57	177	0	0	0	0	0	114.4	R32	R32-G34 PolarHBondContact O-N 2.85Å
35	R	62.2	Low	63.7	Low	218 Å²	218	120.8 Å²	120.8	82%	0.823	68%	0.684	S	S	*	*			trans	-171.7	28.9	156.8	-103.6	167.7	-150.7	-87.4	3.5	111.5
36	R	70.6	Confident	63.6	Low	213 Å²	213	121.7 Å²	121.7	80%	0.804	69%	0.692	S	S	*	*	S	Bend	trans	-89.7	3.7	-172.5	-70.4	-174.7	61.5	-173.6	-3.1	114.9
37	N	63	Low	63.2	Low	163 Å²	163	118 Å²	118	87%	0.872	68%	0.681	S	S	*	*	S	Bend	trans	-130.1	1.6	179.3	-64.9	-15	0	0	0	113.6	L39	N37-L39 PolarHBondContact O-N 3.14Å
38	A	69.8	Low	63.1	Low	65 Å²	65	113.7 Å²	113.7	54%	0.537	67%	0.669	S	S	.	*	S	Bend	trans	-73.7	117.6	165.1	0	0	0	0	0	105.2	P40	A38-P40 WeakPolarHBondContact O-CD 3.41Å
39	L	68	Low	62.8	Low	159 Å²	159	116.6 Å²	116.6	83%	0.832	67%	0.672	S	S	*	*			trans	-41.1	116.2	161.6	-131.2	161.3	0	0	0	105.2	N37 D41	N37-L39 PolarHBondContact O-N 3.14Å; L39-D41 PolarHBondContact O-N 3.22Å
40	P	66.8	Low	62.9	Low	91 Å²	91	115.2 Å²	115.2	59%	0.591	67%	0.673	S	S	*	*			trans	-53.3	124.5	176.4	19.9	-29.6	0	0	0	105.4	A38 I42	A38-P40 WeakPolarHBondContact O-CD 3.41Å; P40-I42 HydrophobicContact CB-CG1 4.06Å; P40-I42 HydrophobicContact CG-CD1 4.3Å; P40-I42 HydrophobicContact CG-CG1 4.03Å; P40-I42 PolarHBondContact O-N 2.71Å
41	D	67.2	Low	63.1	Low	142 Å²	142	116.4 Å²	116.4	76%	0.759	68%	0.678	S	S	*	*			trans	-68	78.9	169.8	-175.8	14.9	0	0	0	105.3	L39 Q43	L39-D41 PolarHBondContact O-N 3.22Å; D41-Q43 PolarHBondContact O-N 3.01Å
42	I	62.7	Low	63.9	Low	127 Å²	127	116 Å²	116	65%	0.651	67%	0.669	S	S	*	*			trans	-69.6	91.3	172.7	-52.7	178.7	0	0	0	102.4	P40 S44	P40-I42 HydrophobicContact CB-CG1 4.06Å; P40-I42 HydrophobicContact CG-CD1 4.3Å; P40-I42 HydrophobicContact CG-CG1 4.03Å; P40-I42 PolarHBondContact O-N 2.71Å; I42-S44 VanDerWaalsContact C-N 3.28Å; I42-S44 PolarHBondContact O-N 3.27Å
43	Q	61.5	Low	64.9	Low	136 Å²	136	110.7 Å²	110.7	64%	0.636	66%	0.656	S	S	*	*			trans	-52.2	106.3	166.5	-61.5	-165.2	-63	0	0	105.3	D41 S45 A46	D41-Q43 PolarHBondContact O-N 3.01Å; Q43-S45 WeakPolarHBondContact CB-OG 3.39Å; Q43-S45 PolarHBondContact O-N 3.1Å; Q43-A46 PolarHBondContact O-N 3.25Å
44	S	56.2	Low	66.2	Low	93 Å²	93	110.6 Å²	110.6	65%	0.65	64%	0.643	S	S	*	*	G	3₁₀ helix	trans	-57.5	-8.3	-177.5	-156.1	0	0	0	0	111.8	I42 A46 A47	I42-S44 VanDerWaalsContact C-N 3.28Å; I42-S44 PolarHBondContact O-N 3.27Å; S44-A46 VanDerWaalsContact C-N 3.26Å; S44-A46 PolarHBondContact O-N 3.46Å; S44-A47 WeakPolarHBondContact O-CB 3.39Å; S44-A47 PolarHBondContact O-N 3.07Å; S44-A47 VanDerWaalsContact O-N 3.07Å
45	S	57.2	Low	67.2	Low	68 Å²	68	111.6 Å²	111.6	48%	0.476	64%	0.637	S	S	.	*	G	3₁₀ helix	trans	-61	-24.1	170.7	60.3	0	0	0	0	114.5	Q43 A47 T48	Q43-S45 WeakPolarHBondContact CB-OG 3.39Å; Q43-S45 PolarHBondContact O-N 3.1Å; S45-A47 PolarHBondContact O-N 3.41Å; S45-T48 PolarHBondContact O-OG1 2.91Å
46	A	56.7	Low	68.4	Low	85 Å²	85	106.8 Å²	106.8	70%	0.702	63%	0.627	S	S	*	*	G	3₁₀ helix	trans	-75.4	-15.4	173.2	0	0	0	0	0	112.7	Q43 S44	Q43-A46 PolarHBondContact O-N 3.25Å; S44-A46 VanDerWaalsContact C-N 3.26Å; S44-A46 PolarHBondContact O-N 3.46Å
47	A	57.2	Low	69.3	Low	62 Å²	62	103.1 Å²	103.1	51%	0.512	62%	0.617	S	S	.	*	G	3₁₀ helix	trans	-84.9	-14.8	177.9	0	0	0	0	0	113.1	S44 S45 T51	S44-A47 WeakPolarHBondContact O-CB 3.39Å; S44-A47 PolarHBondContact O-N 3.07Å; S44-A47 VanDerWaalsContact O-N 3.07Å; S45-A47 PolarHBondContact O-N 3.41Å; A47-T51 PolarHBondContact O-OG1 2.84Å; A47-T51 VanDerWaalsContact O-OG1 3.13Å
48	T	56.5	Low	70.5	Confident	84 Å²	84	100.4 Å²	100.4	52%	0.515	60%	0.602	S	S	.	*	T	Hydrogen-bonded Turn	trans	-88.4	-25.8	-174.6	51	0	0	0	0	114.1	S45 G50	S45-T48 PolarHBondContact O-OG1 2.91Å; T48-G50 VanDerWaalsContact C-N 3.3Å; T48-G50 PolarHBondContact O-N 3.42Å
49	D	61.1	Low	71.4	Confident	151 Å²	151	105 Å²	105	81%	0.807	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.9	0.3	-169.7	-80.9	7.6	0	0	0	115.2
50	G	67.8	Low	72.4	Confident	67 Å²	67	101.5 Å²	101.5	69%	0.691	61%	0.607	S	S	*	*	T	Hydrogen-bonded Turn	trans	-127.8	-7.5	-177.9	0	0	0	0	0	115.9	T48	T48-G50 VanDerWaalsContact C-N 3.3Å; T48-G50 PolarHBondContact O-N 3.42Å
51	T	69.5	Low	73.4	Confident	76 Å²	76	103.4 Å²	103.4	47%	0.466	61%	0.611	S	S	.	*	T	Hydrogen-bonded Turn	trans	-119.4	-2.2	-169.3	59.1	0	0	0	0	114.2	A47 D53 L54 P55	A47-T51 PolarHBondContact O-OG1 2.84Å; A47-T51 VanDerWaalsContact O-OG1 3.13Å; T51-D53 PolarHBondContact O-N 2.91Å; T51-D53 VanDerWaalsContact O-N 3.16Å; T51-L54 WeakPolarHBondContact O-CB 3.38Å; T51-L54 PolarHBondContact O-N 3.34Å; T51-P55 WeakPolarHBondContact O-CD 3.39Å
52	S	79.3	Confident	74.2	Confident	84 Å²	84	101.4 Å²	101.4	59%	0.587	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.2	-34	177.5	58.7	0	0	0	0	113.3	P55	S52-P55 VanDerWaalsContact O-CD 3.31Å; S52-P55 WeakPolarHBondContact O-CD 3.2Å
53	D	84	Confident	75.2	Confident	88 Å²	88	102.1 Å²	102.1	47%	0.471	62%	0.618	S	S	.	*	T	Hydrogen-bonded Turn	trans	-91.6	-6.6	-176.6	-59.4	-6.9	0	0	0	112.4	T51 L56 K57	T51-D53 PolarHBondContact O-N 2.91Å; T51-D53 VanDerWaalsContact O-N 3.16Å; D53-L56 PolarHBondContact O-N 3.29Å; D53-K57 VanDerWaalsContact O-CG 3.31Å; D53-K57 WeakPolarHBondContact O-CG 3.36Å; D53-K57 PolarHBondContact O-N 3.1Å
54	L	86.7	Confident	76.1	Confident	88 Å²	88	103.8 Å²	103.8	46%	0.461	62%	0.624	S	S	.	*	H	α-helix	trans	-62.4	-42.8	-179.4	-174.7	62.8	0	0	0	112.9	T51 L56 K57 L58	T51-L54 WeakPolarHBondContact O-CB 3.38Å; T51-L54 PolarHBondContact O-N 3.34Å; L54-L56 VanDerWaalsContact C-N 3.32Å; L54-L56 PolarHBondContact O-N 3.29Å; L54-K57 PolarHBondContact O-N 2.72Å; L54-L58 HydrophobicContact CD1-CG 4.47Å; L54-L58 HydrophobicContact CG-CD1 4.37Å; L54-L58 WeakPolarHBondContact O-CG 3.18Å; L54-L58 PolarHBondContact O-N 3.05Å; L54-L58 VanDerWaalsContact O-N 3.08Å
55	P	87.4	Confident	76.9	Confident	83 Å²	83	108.1 Å²	108.1	54%	0.539	63%	0.633	S	S	.	*	H	α-helix	trans	-58.4	-43.7	176.6	-22	33.1	0	0	0	112.4	T51 S52 L58 E59	T51-P55 WeakPolarHBondContact O-CD 3.39Å; S52-P55 VanDerWaalsContact O-CD 3.31Å; S52-P55 WeakPolarHBondContact O-CD 3.2Å; P55-L58 PolarHBondContact O-N 3.25Å; P55-E59 PolarHBondContact O-N 2.77Å; P55-E59 VanDerWaalsContact O-N 3.15Å
56	L	87.3	Confident	77.4	Confident	117 Å²	117	111.8 Å²	111.8	61%	0.613	65%	0.648	S	S	*	*	H	α-helix	trans	-65.7	-40	178.9	-64.4	173.3	0	0	0	112	D53 L54 L58 E59 A60	D53-L56 PolarHBondContact O-N 3.29Å; L54-L56 VanDerWaalsContact C-N 3.32Å; L54-L56 PolarHBondContact O-N 3.29Å; L56-L58 VanDerWaalsContact C-N 3.3Å; L56-L58 PolarHBondContact O-N 3.41Å; L56-E59 PolarHBondContact O-N 3.3Å; L56-A60 PolarHBondContact O-N 3.17Å
57	K	88.8	Confident	77.8	Confident	136 Å²	136	112.3 Å²	112.3	59%	0.591	65%	0.652	S	S	*	*	H	α-helix	trans	-65.1	-33.7	177.6	-73.7	171	-175.9	172.6	0	112.5	D53 L54	D53-K57 VanDerWaalsContact O-CG 3.31Å; D53-K57 WeakPolarHBondContact O-CG 3.36Å; D53-K57 PolarHBondContact O-N 3.1Å; L54-K57 PolarHBondContact O-N 2.72Å
58	L	89.5	Confident	77.9	Confident	106 Å²	106	118.5 Å²	118.5	56%	0.555	67%	0.667	S	S	*	*	H	α-helix	trans	-73.7	-37.7	176.8	-67.6	174.8	0	0	0	112.1	L54 P55 L56 A60 L61	L54-L58 HydrophobicContact CD1-CG 4.47Å; L54-L58 HydrophobicContact CG-CD1 4.37Å; L54-L58 WeakPolarHBondContact O-CG 3.18Å; L54-L58 PolarHBondContact O-N 3.05Å; L54-L58 VanDerWaalsContact O-N 3.08Å; P55-L58 PolarHBondContact O-N 3.25Å; L56-L58 VanDerWaalsContact C-N 3.3Å; L56-L58 PolarHBondContact O-N 3.41Å; L58-A60 VanDerWaalsContact C-N 3.27Å; L58-A60 PolarHBondContact O-N 3.34Å; L58-L61 HydrophobicContact CD2-CD1 4.23Å; L58-L61 WeakPolarHBondContact O-CB 3.47Å; L58-L61 PolarHBondContact O-N 2.7Å; L58-L61 VanDerWaalsContact O-N 3.15Å
59	E	88.3	Confident	78	Confident	161 Å²	161	123 Å²	123	75%	0.752	68%	0.683	S	S	*	*	H	α-helix	trans	-64.4	-32.1	175.7	-172.6	175.2	-171.9	0	0	112.6	P55 L56 L61	P55-E59 PolarHBondContact O-N 2.77Å; P55-E59 VanDerWaalsContact O-N 3.15Å; L56-E59 PolarHBondContact O-N 3.3Å; E59-L61 PolarHBondContact O-N 2.82Å
60	A	88.7	Confident	77.8	Confident	86 Å²	86	124.8 Å²	124.8	71%	0.711	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.9	-11.5	175.8	0	0	0	0	0	114.1	L56 L58	L56-A60 PolarHBondContact O-N 3.17Å; L58-A60 VanDerWaalsContact C-N 3.27Å; L58-A60 PolarHBondContact O-N 3.34Å
61	L	88.6	Confident	77.1	Confident	131 Å²	131	129.5 Å²	129.5	69%	0.686	69%	0.692	S	S	*	*			trans	-84.6	119	177.7	-63.2	176.4	0	0	0	109.9	L58 E59	L58-L61 HydrophobicContact CD2-CD1 4.23Å; L58-L61 WeakPolarHBondContact O-CB 3.47Å; L58-L61 PolarHBondContact O-N 2.7Å; L58-L61 VanDerWaalsContact O-N 3.15Å; E59-L61 PolarHBondContact O-N 2.82Å
62	S	84.1	Confident	76.5	Confident	101 Å²	101	134.7 Å²	134.7	71%	0.706	71%	0.711	S	S	*	*			trans	-123.7	129.2	173.6	176.1	0	0	0	0	108.8	K64	S62-K64 PolarHBondContact O-N 2.74Å
63	V	83.1	Confident	74.9	Confident	141 Å²	141	138.8 Å²	138.8	86%	0.855	72%	0.721	S	S	*	*			trans	-77.8	110.7	170.5	-179.5	0	0	0	0	106.8	E65	V63-E65 PolarHBondContact O-N 2.92Å
64	K	80.9	Confident	73.4	Confident	172 Å²	172	140.4 Å²	140.4	75%	0.748	74%	0.735	S	S	*	*			trans	-77.5	116.8	166.4	-64	-177.7	-176.7	178	0	106.4	S62 D66	S62-K64 PolarHBondContact O-N 2.74Å; K64-D66 VanDerWaalsContact C-N 3.31Å; K64-D66 PolarHBondContact O-N 2.9Å
65	E	72.9	Confident	71.5	Confident	183 Å²	183	142.4 Å²	142.4	86%	0.855	75%	0.75	S	S	*	*			trans	-66.2	99.3	165.6	-172.8	173.3	-168.5	0	0	106.5	V63 A67	V63-E65 PolarHBondContact O-N 2.92Å; E65-A67 PolarHBondContact O-N 2.81Å
66	D	66.8	Low	70	Confident	145 Å²	145	146.4 Å²	146.4	78%	0.775	76%	0.762	S	S	*	*			trans	-62.7	104.7	169.2	-75.8	-37.4	0	0	0	106.4	K64 K68	K64-D66 VanDerWaalsContact C-N 3.31Å; K64-D66 PolarHBondContact O-N 2.9Å; D66-K68 VanDerWaalsContact C-N 3.33Å; D66-K68 PolarHBondContact O-N 2.85Å
67	A	64.8	Low	68.3	Low	96 Å²	96	147.7 Å²	147.7	79%	0.793	77%	0.769	S	S	*	*			trans	-58.7	91.7	-176.6	0	0	0	0	0	111.3	E65	E65-A67 PolarHBondContact O-N 2.81Å
68	K	60.8	Low	66.6	Low	193 Å²	193	149 Å²	149	84%	0.839	78%	0.778	S	S	*	*			trans	-158.1	123.8	154	-66.6	-156.7	179.1	-163.9	0	106.3	D66	D66-K68 VanDerWaalsContact C-N 3.33Å; D66-K68 PolarHBondContact O-N 2.85Å
69	E	58.1	Low	64.8	Low	178 Å²	178	151.9 Å²	151.9	83%	0.832	79%	0.793	S	S	*	*			cis	-161.1	151.6	6.8	-178.5	168	178.5	0	0	103.7	D71	E69-D71 PolarHBondContact O-N 3.08Å
70	K	57.1	Low	63.2	Low	189 Å²	189	151.9 Å²	151.9	82%	0.822	79%	0.793	S	S	*	*			trans	-56	106.2	175.5	-68.1	-88.4	-174.6	174.1	0	109.4
71	D	52.8	Low	61.8	Low	165 Å²	165	156.3 Å²	156.3	88%	0.882	80%	0.796	S	S	*	*			trans	-121.1	104	146.2	-103	-23.2	0	0	0	107	E69 E73	E69-D71 PolarHBondContact O-N 3.08Å; D71-E73 PolarHBondContact O-N 2.9Å
72	E	55.7	Low	60.2	Low	185 Å²	185	156 Å²	156	86%	0.864	80%	0.801	S	S	*	*			trans	-61.4	109.4	166	-79.5	176.3	146.2	0	0	108.5
73	E	46.6	Very low	58.8	Low	171 Å²	171	160 Å²	160	80%	0.799	81%	0.809	S	S	*	*			trans	-134.5	101.4	147.7	-164.1	173.5	179.3	0	0	109.1	D71 T75	D71-E73 PolarHBondContact O-N 2.9Å; E73-T75 PolarHBondContact O-N 3.09Å
74	T	52.9	Low	57.6	Low	122 Å²	122	160.6 Å²	160.6	75%	0.748	81%	0.807	S	S	*	*			trans	-47.2	113.9	164.8	-4.7	0	0	0	0	110.3
75	T	46.6	Very low	56.5	Low	129 Å²	129	161 Å²	161	79%	0.791	81%	0.812	S	S	*	*			trans	-127.2	69.6	153.9	-30.9	0	0	0	0	108.2	E73	E73-T75 PolarHBondContact O-N 3.09Å
76	Q	55.3	Low	55.6	Low	168 Å²	168	161.8 Å²	161.8	79%	0.785	82%	0.816	S	S	*	*			trans	-72.9	151.6	152.8	-69	-173.4	-23.7	0	0	108.2
77	D	51.8	Low	54.6	Low	143 Å²	143	167.6 Å²	167.6	77%	0.765	83%	0.834	S	S	*	*			trans	68.1	94.1	173.8	-80.5	-13.8	0	0	0	117.1
78	Q	53.3	Low	54.1	Low	164 Å²	164	171.2 Å²	171.2	77%	0.766	84%	0.836	S	S	*	*				-163.6	71	120.8	-76.5	-53.9	19.3	0	0	108.7	E80	Q78-E80 VanDerWaalsContact C-N 3.32Å; Q78-E80 PolarHBondContact O-N 3.19Å
79	L	51.8	Low	53.7	Low	166 Å²	166	170.1 Å²	170.1	87%	0.869	84%	0.836	S	S	*	*			trans	-89.9	77.4	156.4	-174.3	88.5	0	0	0	106.8	K81	L79-K81 PolarHBondContact O-N 3.31Å; L79-K81 VanDerWaalsContact O-N 3.08Å
80	E	54	Low	53.5	Low	162 Å²	162	169.6 Å²	169.6	76%	0.757	84%	0.836	S	S	*	*			trans	-65.1	109	169.3	-84	-173.4	160.5	0	0	108.9	Q78	Q78-E80 VanDerWaalsContact C-N 3.32Å; Q78-E80 PolarHBondContact O-N 3.19Å
81	K	59.6	Low	53.3	Low	179 Å²	179	168.5 Å²	168.5	78%	0.778	84%	0.837	S	S	*	*			trans	-62.9	131.6	161.4	-94.1	179.6	172.8	-174.2	0	108.2	L79 Q83	L79-K81 PolarHBondContact O-N 3.31Å; L79-K81 VanDerWaalsContact O-N 3.08Å; K81-Q83 PolarHBondContact O-N 3.14Å; K81-Q83 VanDerWaalsContact O-N 3.14Å
82	P	55.3	Low	53.3	Low	123 Å²	123	168.7 Å²	168.7	80%	0.799	83%	0.834	S	S	*	*			trans	-70.2	113.9	169.4	27.8	-30.2	0	0	0	108.6	N84	P82-N84 PolarHBondContact O-N 3.1Å
83	Q	55.5	Low	53.1	Low	187 Å²	187	167.6 Å²	167.6	87%	0.874	83%	0.832	S	S	*	*			trans	-70.9	103.1	160.9	-68	-179.1	-77.3	0	0	106.8	K81	K81-Q83 PolarHBondContact O-N 3.14Å; K81-Q83 VanDerWaalsContact O-N 3.14Å
84	N	57.5	Low	53.6	Low	152 Å²	152	167.4 Å²	167.4	81%	0.813	84%	0.835	S	S	*	*			trans	-84.5	111.6	163.4	66.9	-24.6	0	0	0	108.3	P82	P82-N84 PolarHBondContact O-N 3.1Å
85	E	58.4	Low	53.7	Low	182 Å²	182	170.8 Å²	170.8	85%	0.85	84%	0.841	S	S	*	*			trans	-66.4	132.6	175.3	-64.1	-179.4	163	0	0	110.4
86	E	53	Low	54.3	Low	198 Å²	198	174.3 Å²	174.3	93%	0.925	85%	0.846	S	S	*	*			trans	-68.1	122.6	163.6	179.1	179.4	-178.3	0	0	109.1
87	K	45.6	Very low	54.2	Low	268 Å²	268	174.9 Å²	174.9	100%	1.165	85%	0.851	S	S	*	*			trans	-153.8	0	153.1	-168.7	162.9	179.8	-74.3	0	112.3

Retrieved 87 of 87 residues in 19.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).