A0A096MQE1_PAPAN Loading...

Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit TMEM258

Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.

AlphaFold DB (P61165), UniProt , Accession A0A096MQE1, Species PAPAN (Papio anubis, Olive baboon), Gene TMEM258, Length 79 aa.

						>A0A096MQE1_PAPAN|A0A096MQE1|TMEM258
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.3	Low	67.5	Low	231 Å²	231	151.7 Å²	151.7	100%	1.138	77%	0.772	S	S	*	*				0	107.9	0	-87.6	-178.5	-84.5	0	0	106.5	L3	M1-L3 PolarHBondContact O-N 3.47Å
2	E	66.8	Low	68.4	Low	160 Å²	160	148.4 Å²	148.4	75%	0.748	77%	0.768	S	S	*	*			trans	-66.3	118.4	-177.8	-63.7	-176.9	138.5	0	0	109.1	E4 A5	E2-E4 PolarHBondContact O-N 3.02Å; E2-E4 VanDerWaalsContact O-N 3.13Å; E2-A5 PolarHBondContact O-N 3.15Å; E2-A5 VanDerWaalsContact O-N 3.13Å
3	L	67.2	Low	68.8	Low	143 Å²	143	141.8 Å²	141.8	75%	0.749	74%	0.738	S	S	*	*	G	3₁₀ helix	trans	-59.7	-21.2	179.4	-72.6	162.2	0	0	0	112	M1 A5 M6	M1-L3 PolarHBondContact O-N 3.47Å; L3-A5 VanDerWaalsContact C-N 3.29Å; L3-A5 PolarHBondContact O-N 3.13Å; L3-M6 HydrophobicContact CD2-SD 4.48Å; L3-M6 PolarHBondContact O-N 3.13Å
4	E	67.4	Low	69.5	Low	188 Å²	188	139.1 Å²	139.1	88%	0.879	73%	0.725	S	S	*	*	G	3₁₀ helix	trans	-70.4	-21	178	-59.1	-163	144.7	0	0	113.8	E2 M6	E2-E4 PolarHBondContact O-N 3.02Å; E2-E4 VanDerWaalsContact O-N 3.13Å; E4-M6 VanDerWaalsContact C-N 3.27Å; E4-M6 PolarHBondContact O-N 2.93Å
5	A	66.7	Low	70.1	Confident	85 Å²	85	135 Å²	135	70%	0.702	71%	0.711	S	S	*	*	G	3₁₀ helix	trans	-80.5	-6.8	175.9	0	0	0	0	0	113.2	E2 L3 S7	E2-A5 PolarHBondContact O-N 3.15Å; E2-A5 VanDerWaalsContact O-N 3.13Å; L3-A5 VanDerWaalsContact C-N 3.29Å; L3-A5 PolarHBondContact O-N 3.13Å; A5-S7 PolarHBondContact O-N 3.31Å
6	M	70.1	Confident	71	Confident	140 Å²	140	130.4 Å²	130.4	69%	0.69	70%	0.698	S	S	*	*	S	Bend	trans	-76.1	94.4	173.6	-68.5	-169.4	177.9	0	0	109.1	L3 E4 R8	L3-M6 HydrophobicContact CD2-SD 4.48Å; L3-M6 PolarHBondContact O-N 3.13Å; E4-M6 VanDerWaalsContact C-N 3.27Å; E4-M6 PolarHBondContact O-N 2.93Å; M6-R8 PolarHBondContact O-N 3.43Å; M6-R8 VanDerWaalsContact O-N 3.15Å
7	S	69.9	Low	71.9	Confident	110 Å²	110	126.6 Å²	126.6	77%	0.769	68%	0.68	S	S	*	*			trans	-51.7	122.9	169.7	59.5	0	0	0	0	109.3	A5 Y9	A5-S7 PolarHBondContact O-N 3.31Å; S7-Y9 PolarHBondContact O-N 3.03Å
8	R	70.6	Confident	72.7	Confident	239 Å²	239	121.2 Å²	121.2	90%	0.902	65%	0.65	S	S	*	*			trans	-54.6	114.2	176.7	-174.7	178.9	-176.9	-177.2	1.5	108.5	M6 T10	M6-R8 PolarHBondContact O-N 3.43Å; M6-R8 VanDerWaalsContact O-N 3.15Å; R8-T10 PolarHBondContact O-N 3.29Å
9	Y	72.2	Confident	73.6	Confident	195 Å²	195	116.6 Å²	116.6	77%	0.765	63%	0.627	S	S	*	*			trans	-64.4	104.1	173.4	-174.8	-96.8	0	0	0	107.8	S7	S7-Y9 PolarHBondContact O-N 3.03Å
10	T	71	Confident	74.5	Confident	110 Å²	110	117.5 Å²	117.5	68%	0.675	63%	0.627	S	S	*	*			trans	-87.8	140.2	168.2	-170.4	0	0	0	0	107.8	R8	R8-T10 PolarHBondContact O-N 3.29Å
11	S	66.9	Low	75.3	Confident	68 Å²	68	114.6 Å²	114.6	48%	0.476	61%	0.611	S	S	.	*			trans	-57.8	127.8	174.4	49.7	0	0	0	0	108.9	V13	S11-V13 PolarHBondContact O-N 3.28Å
12	P	77.7	Confident	77.1	Confident	112 Å²	112	103.7 Å²	103.7	73%	0.727	56%	0.558	S	S	*	*	S	Bend	trans	-64.2	-16.1	-174.6	24.3	-34	0	0	0	113.4
13	V	73.5	Confident	78.4	Confident	63 Å²	63	100.6 Å²	100.6	38%	0.382	55%	0.549	S	S	.	.	S	Bend	trans	-103.7	123.7	177.9	-168.4	0	0	0	0	109.5	S11 F18	S11-V13 PolarHBondContact O-N 3.28Å; V13-F18 HydrophobicContact CB-CE1 3.98Å; V13-F18 HydrophobicContact CG1-CD1 4.09Å; V13-F18 HydrophobicContact CG1-CE1 3.51Å
14	N	79.6	Confident	79.8	Confident	103 Å²	103	97.7 Å²	97.7	55%	0.551	54%	0.537	S	S	*	.			trans	-70.5	125.9	176	-175.3	-19.3	0	0	0	110	A16 V17	N14-A16 PolarHBondContact O-N 3.04Å; N14-A16 WeakPolarHBondContact OD1-CB 3.4Å; N14-A16 PolarHBondContact OD1-N 3.16Å; N14-V17 HydrophobicContact CB-CG2 4.34Å; N14-V17 PolarHBondContact O-N 3.18Å
15	P	77.8	Confident	81.1	Confident	78 Å²	78	90.2 Å²	90.2	51%	0.506	50%	0.503	S	S	.	.	G	3₁₀ helix	trans	-53.8	-25.7	177.3	-27.3	34.8	0	0	0	115	V17 F18	P15-V17 PolarHBondContact O-N 3.04Å; P15-V17 VanDerWaalsContact O-N 3.16Å; P15-F18 HydrophobicContact CB-CD2 4.05Å; P15-F18 HydrophobicContact CB-CE2 3.84Å; P15-F18 HydrophobicContact CB-CZ 4.47Å; P15-F18 HydrophobicContact CG-CE2 4.16Å; P15-F18 HydrophobicContact CG-CZ 4.48Å; P15-F18 PolarHBondContact O-N 2.95Å
16	A	84.3	Confident	82.4	Confident	62 Å²	62	87.5 Å²	87.5	51%	0.512	48%	0.477	S	S	.	.	G	3₁₀ helix	trans	-61.4	-21.4	175.7	0	0	0	0	0	113.8	N14 H20	N14-A16 PolarHBondContact O-N 3.04Å; N14-A16 WeakPolarHBondContact OD1-CB 3.4Å; N14-A16 PolarHBondContact OD1-N 3.16Å; A16-H20 PolarHBondContact O-ND1 3.23Å
17	V	86.5	Confident	83.7	Confident	65 Å²	65	83.2 Å²	83.2	39%	0.394	46%	0.464	S	S	.	.	G	3₁₀ helix	trans	-90.7	-17.4	-178.4	-173.4	0	0	0	0	111.7	N14 P15 H20 L21	N14-V17 HydrophobicContact CB-CG2 4.34Å; N14-V17 PolarHBondContact O-N 3.18Å; P15-V17 PolarHBondContact O-N 3.04Å; P15-V17 VanDerWaalsContact O-N 3.16Å; V17-H20 PolarHBondContact O-N 3Å; V17-L21 HydrophobicContact CG1-CD1 4.03Å; V17-L21 HydrophobicContact CG1-CG 3.94Å; V17-L21 WeakPolarHBondContact O-CG 3.45Å; V17-L21 PolarHBondContact O-N 3.15Å
18	F	86.8	Confident	84.9	Confident	29 Å²	29	81.2 Å²	81.2	13%	0.127	44%	0.444	C	S	.	.	H	α-helix	trans	-55.4	-49.7	180	-58.3	-23.7	0	0	0	113.2	V13 P15 H20 L21 T22 F70 L73	V13-F18 HydrophobicContact CB-CE1 3.98Å; V13-F18 HydrophobicContact CG1-CD1 4.09Å; V13-F18 HydrophobicContact CG1-CE1 3.51Å; P15-F18 HydrophobicContact CB-CD2 4.05Å; P15-F18 HydrophobicContact CB-CE2 3.84Å; P15-F18 HydrophobicContact CB-CZ 4.47Å; P15-F18 HydrophobicContact CG-CE2 4.16Å; P15-F18 HydrophobicContact CG-CZ 4.48Å; P15-F18 PolarHBondContact O-N 2.95Å; F18-H20 VanDerWaalsContact C-N 3.27Å; F18-H20 PolarHBondContact O-N 3.31Å; F18-L21 PolarHBondContact O-N 3.44Å; F18-L21 VanDerWaalsContact O-N 3.15Å; F18-T22 VanDerWaalsContact O-CG2 3.32Å; F18-T22 WeakPolarHBondContact O-CG2 3.44Å; F18-T22 PolarHBondContact O-N 3.38Å; F18-F70 HydrophobicContact CD1-CD1 4.08Å; F18-F70 HydrophobicContact CD1-CE1 4.27Å; F18-L73 HydrophobicContact CD2-CB 4.03Å; F18-L73 HydrophobicContact CE2-CB 4.21Å
19	P	89.5	Confident	86.1	Confident	34 Å²	34	69.9 Å²	69.9	22%	0.221	40%	0.401	C	S	.	.	H	α-helix	trans	-58.6	-41.2	-179.2	-19.4	30.3	0	0	0	112	T22 V23 W74	P19-T22 PolarHBondContact O-N 3.45Å; P19-T22 PolarHBondContact O-OG1 3.42Å; P19-V23 WeakPolarHBondContact O-CG2 3.36Å; P19-V23 PolarHBondContact O-N 2.65Å; P19-V23 VanDerWaalsContact O-N 3.1Å; P19-W74 HydrophobicContact CB-CD2 4.29Å; P19-W74 HydrophobicContact CB-CG 4.4Å; P19-W74 HydrophobicContact CG-CD2 4.43Å; P19-W74 HydrophobicContact CG-CG 4.1Å
20	H	91.1	Very high	87.2	Confident	135 Å²	135	65.6 Å²	65.6	63%	0.625	39%	0.389	S	S	*	.	H	α-helix	trans	-63.5	-45.6	178.7	-62	89	0	0	0	111.7	A16 V17 F18 V23 V24	A16-H20 PolarHBondContact O-ND1 3.23Å; V17-H20 PolarHBondContact O-N 3Å; F18-H20 VanDerWaalsContact C-N 3.27Å; F18-H20 PolarHBondContact O-N 3.31Å; H20-V23 PolarHBondContact O-N 3.33Å; H20-V24 WeakPolarHBondContact O-CG2 3.37Å; H20-V24 PolarHBondContact O-N 3.15Å; H20-V24 VanDerWaalsContact O-N 3.15Å
21	L	91.3	Very high	88.4	Confident	57 Å²	57	66.3 Å²	66.3	30%	0.298	38%	0.383	S	S	.	.	H	α-helix	trans	-62.9	-43	176.5	-66.1	175.1	0	0	0	111.4	V17 F18 V23 V24 L25 F70	V17-L21 HydrophobicContact CG1-CD1 4.03Å; V17-L21 HydrophobicContact CG1-CG 3.94Å; V17-L21 WeakPolarHBondContact O-CG 3.45Å; V17-L21 PolarHBondContact O-N 3.15Å; F18-L21 PolarHBondContact O-N 3.44Å; F18-L21 VanDerWaalsContact O-N 3.15Å; L21-V23 PolarHBondContact O-N 2.89Å; L21-V24 PolarHBondContact O-N 3.05Å; L21-L25 WeakPolarHBondContact O-CB 3.36Å; L21-L25 WeakPolarHBondContact O-CD1 3.32Å; L21-L25 PolarHBondContact O-N 3.22Å; L21-F70 HydrophobicContact CB-CD1 4.39Å; L21-F70 HydrophobicContact CB-CG 4.35Å; L21-F70 HydrophobicContact CD1-CD1 4.26Å; L21-F70 HydrophobicContact CD1-CE1 3.8Å; L21-F70 HydrophobicContact CD1-CZ 4.03Å
22	T	93	Very high	89.7	Confident	2 Å²	2	66 Å²	66	1%	0.012	37%	0.373	C	S	.	.	H	α-helix	trans	-56.7	-50.1	177.9	60.6	0	0	0	0	112.1	F18 P19 V24 L25 L26 F70 L71 W74	F18-T22 VanDerWaalsContact O-CG2 3.32Å; F18-T22 WeakPolarHBondContact O-CG2 3.44Å; F18-T22 PolarHBondContact O-N 3.38Å; P19-T22 PolarHBondContact O-N 3.45Å; P19-T22 PolarHBondContact O-OG1 3.42Å; T22-V24 VanDerWaalsContact C-N 3.34Å; T22-V24 PolarHBondContact O-N 3.25Å; T22-L25 PolarHBondContact O-N 3.1Å; T22-L26 WeakPolarHBondContact O-CB 3.49Å; T22-L26 WeakPolarHBondContact O-CG 3.48Å; T22-L26 PolarHBondContact O-N 3.43Å; T22-F70 HydrophobicContact CG2-CB 3.32Å; T22-F70 WeakPolarHBondContact CG2-O 3.3Å; T22-L71 HydrophobicContact CG2-CB 4.18Å; T22-W74 HydrophobicContact CG2-CB 4.44Å
23	V	94.3	Very high	90.5	Very high	94 Å²	94	62.6 Å²	62.6	57%	0.57	35%	0.351	S	S	*	.	H	α-helix	trans	-63.9	-44	-175.5	173.3	0	0	0	0	110	P19 H20 L21 A27	P19-V23 WeakPolarHBondContact O-CG2 3.36Å; P19-V23 PolarHBondContact O-N 2.65Å; P19-V23 VanDerWaalsContact O-N 3.1Å; H20-V23 PolarHBondContact O-N 3.33Å; L21-V23 PolarHBondContact O-N 2.89Å; V23-A27 WeakPolarHBondContact O-CB 3.46Å; V23-A27 PolarHBondContact O-N 3.06Å
24	V	95.2	Very high	91.5	Very high	82 Å²	82	62 Å²	62	50%	0.497	35%	0.353	S	S	.	.	H	α-helix	trans	-66.2	-49.2	179.4	174.3	0	0	0	0	111.4	H20 L21 T22 A27 I28	H20-V24 WeakPolarHBondContact O-CG2 3.37Å; H20-V24 PolarHBondContact O-N 3.15Å; H20-V24 VanDerWaalsContact O-N 3.15Å; L21-V24 PolarHBondContact O-N 3.05Å; T22-V24 VanDerWaalsContact C-N 3.34Å; T22-V24 PolarHBondContact O-N 3.25Å; V24-A27 PolarHBondContact O-N 3.23Å; V24-I28 HydrophobicContact CG1-CD1 3.85Å; V24-I28 VanDerWaalsContact O-CG1 3.32Å; V24-I28 WeakPolarHBondContact O-CG1 3.22Å; V24-I28 PolarHBondContact O-N 3.37Å
25	L	94.5	Very high	92.2	Very high	31 Å²	31	63.8 Å²	63.8	16%	0.162	35%	0.352	C	S	.	.	H	α-helix	trans	-65.8	-41.7	-178.5	-88.5	68	0	0	0	111.7	L21 T22 G29 F66 F70	L21-L25 WeakPolarHBondContact O-CB 3.36Å; L21-L25 WeakPolarHBondContact O-CD1 3.32Å; L21-L25 PolarHBondContact O-N 3.22Å; T22-L25 PolarHBondContact O-N 3.1Å; L25-G29 PolarHBondContact O-N 2.87Å; L25-F66 HydrophobicContact CD2-CB 3.61Å; L25-F70 HydrophobicContact CD2-CD2 3.92Å; L25-F70 HydrophobicContact CD2-CE2 4.07Å
26	L	95.1	Very high	92.9	Very high	28 Å²	28	62.5 Å²	62.5	15%	0.147	34%	0.338	C	S	.	.	H	α-helix	trans	-69.3	-38.1	176.5	-70.9	175.1	0	0	0	111.9	T22 G29 M30 M64 V68 L71	T22-L26 WeakPolarHBondContact O-CB 3.49Å; T22-L26 WeakPolarHBondContact O-CG 3.48Å; T22-L26 PolarHBondContact O-N 3.43Å; L26-G29 PolarHBondContact O-N 3.1Å; L26-M30 HydrophobicContact CB-CE 4.21Å; L26-M30 VanDerWaalsContact O-CB 3.23Å; L26-M30 WeakPolarHBondContact O-CB 3.17Å; L26-M30 WeakPolarHBondContact O-CE 3.32Å; L26-M30 VanDerWaalsContact O-CG 3.26Å; L26-M30 WeakPolarHBondContact O-CG 3.45Å; L26-M30 PolarHBondContact O-N 2.96Å; L26-M64 HydrophobicContact CD2-CE 4.31Å; L26-M64 HydrophobicContact CD2-SD 4.14Å; L26-V68 HydrophobicContact CD2-CG2 4.19Å; L26-L71 HydrophobicContact CD1-CD1 3.91Å
27	A	96.2	Very high	93.3	Very high	51 Å²	51	65.9 Å²	65.9	42%	0.421	34%	0.341	S	S	.	.	H	α-helix	trans	-62.6	-46.2	176.2	0	0	0	0	0	111.4	V23 V24 F31	V23-A27 WeakPolarHBondContact O-CB 3.46Å; V23-A27 PolarHBondContact O-N 3.06Å; V24-A27 PolarHBondContact O-N 3.23Å; A27-F31 WeakPolarHBondContact O-CB 3.21Å; A27-F31 PolarHBondContact O-N 3.44Å
28	I	95.6	Very high	93.6	Very high	68 Å²	68	66.9 Å²	66.9	35%	0.349	35%	0.347	S	S	.	.	H	α-helix	trans	-65.9	-44.3	176.5	-64.9	169	0	0	0	110.4	V24 M30 F31 F32 F63	V24-I28 HydrophobicContact CG1-CD1 3.85Å; V24-I28 VanDerWaalsContact O-CG1 3.32Å; V24-I28 WeakPolarHBondContact O-CG1 3.22Å; V24-I28 PolarHBondContact O-N 3.37Å; I28-M30 PolarHBondContact O-N 3.45Å; I28-F31 WeakPolarHBondContact O-CB 3.35Å; I28-F31 PolarHBondContact O-N 3.1Å; I28-F32 HydrophobicContact CG2-CD2 3.76Å; I28-F32 HydrophobicContact CG2-CE2 3.6Å; I28-F32 VanDerWaalsContact O-CD2 3.25Å; I28-F32 WeakPolarHBondContact O-CD2 3.1Å; I28-F32 PolarHBondContact O-N 3.37Å; I28-F63 HydrophobicContact CG2-CD1 4.21Å; I28-F63 HydrophobicContact CG2-CD2 4.26Å; I28-F63 HydrophobicContact CG2-CE1 4.39Å; I28-F63 HydrophobicContact CG2-CE2 4.45Å; I28-F63 HydrophobicContact CG2-CG 4.16Å
29	G	96.2	Very high	93.7	Very high	0 Å²	0	67 Å²	67	0%	0	35%	0.348	C	S	.	.	H	α-helix	trans	-58.4	-48.4	176.2	0	0	0	0	0	112.3	L25 L26 F31 F32 T33 M64	L25-G29 PolarHBondContact O-N 2.87Å; L26-G29 PolarHBondContact O-N 3.1Å; G29-F31 VanDerWaalsContact C-N 3.3Å; G29-F31 PolarHBondContact O-N 3.04Å; G29-F32 PolarHBondContact O-N 3.41Å; G29-T33 WeakPolarHBondContact O-CG2 3.16Å; G29-T33 PolarHBondContact O-N 2.85Å; G29-T33 PolarHBondContact O-OG1 3.11Å; G29-M64 VanDerWaalsContact C-SD 3.57Å
30	M	95.4	Very high	93.7	Very high	105 Å²	105	68 Å²	68	52%	0.517	35%	0.349	S	S	.	.	H	α-helix	trans	-62.3	-36.2	176.2	-77.9	-171.6	-75.9	0	0	112.5	L26 I28 T33 A34 M64	L26-M30 HydrophobicContact CB-CE 4.21Å; L26-M30 VanDerWaalsContact O-CB 3.23Å; L26-M30 WeakPolarHBondContact O-CB 3.17Å; L26-M30 WeakPolarHBondContact O-CE 3.32Å; L26-M30 VanDerWaalsContact O-CG 3.26Å; L26-M30 WeakPolarHBondContact O-CG 3.45Å; L26-M30 PolarHBondContact O-N 2.96Å; I28-M30 PolarHBondContact O-N 3.45Å; M30-T33 WeakPolarHBondContact CA-OG1 3.36Å; M30-T33 PolarHBondContact O-N 2.86Å; M30-T33 PolarHBondContact O-OG1 3.37Å; M30-A34 VanDerWaalsContact O-CB 3.29Å; M30-A34 WeakPolarHBondContact O-CB 3.42Å; M30-A34 PolarHBondContact O-N 2.83Å; M30-M64 HydrophobicContact CG-CE 4.48Å; M30-M64 HydrophobicContact CG-SD 4.06Å
31	F	95.8	Very high	93.7	Very high	126 Å²	126	67.4 Å²	67.4	55%	0.553	36%	0.355	S	S	*	.	H	α-helix	trans	-61.9	-46.7	173.8	177.9	-95.6	0	0	0	111.4	A27 I28 G29 A34 W35	A27-F31 WeakPolarHBondContact O-CB 3.21Å; A27-F31 PolarHBondContact O-N 3.44Å; I28-F31 WeakPolarHBondContact O-CB 3.35Å; I28-F31 PolarHBondContact O-N 3.1Å; G29-F31 VanDerWaalsContact C-N 3.3Å; G29-F31 PolarHBondContact O-N 3.04Å; F31-A34 PolarHBondContact O-N 3.1Å; F31-W35 HydrophobicContact CZ-CE3 4.26Å; F31-W35 WeakPolarHBondContact O-CB 3.26Å; F31-W35 PolarHBondContact O-N 3.03Å
32	F	94.5	Very high	93.6	Very high	60 Å²	60	69.5 Å²	69.5	26%	0.263	37%	0.37	S	S	.	.	H	α-helix	trans	-69.2	-34.6	178.1	-78.7	-71.3	0	0	0	113.4	I28 G29 W35 F36 V59 A60 F63	I28-F32 HydrophobicContact CG2-CD2 3.76Å; I28-F32 HydrophobicContact CG2-CE2 3.6Å; I28-F32 VanDerWaalsContact O-CD2 3.25Å; I28-F32 WeakPolarHBondContact O-CD2 3.1Å; I28-F32 PolarHBondContact O-N 3.37Å; G29-F32 PolarHBondContact O-N 3.41Å; F32-W35 PolarHBondContact O-N 2.82Å; F32-F36 WeakPolarHBondContact O-CB 3.25Å; F32-F36 PolarHBondContact O-N 2.95Å; F32-V59 HydrophobicContact CD1-CG1 4.22Å; F32-V59 HydrophobicContact CD2-CG1 4.02Å; F32-V59 HydrophobicContact CE1-CG1 4.13Å; F32-V59 HydrophobicContact CE2-CG1 3.93Å; F32-V59 HydrophobicContact CG-CG1 4.18Å; F32-V59 HydrophobicContact CZ-CG1 3.99Å; F32-A60 HydrophobicContact CB-CB 3.69Å; F32-F63 HydrophobicContact CD2-CD2 4.41Å; F32-F63 HydrophobicContact CE2-CD2 4.48Å; F32-F63 HydrophobicContact CE2-CE2 4.48Å
33	T	94.4	Very high	93.1	Very high	42 Å²	42	70.1 Å²	70.1	26%	0.258	37%	0.374	S	S	.	.	H	α-helix	trans	-67.7	-41.7	174.3	58.6	0	0	0	0	111.6	G29 M30 W35 F36 F37 A60 M64	G29-T33 WeakPolarHBondContact O-CG2 3.16Å; G29-T33 PolarHBondContact O-N 2.85Å; G29-T33 PolarHBondContact O-OG1 3.11Å; M30-T33 WeakPolarHBondContact CA-OG1 3.36Å; M30-T33 PolarHBondContact O-N 2.86Å; M30-T33 PolarHBondContact O-OG1 3.37Å; T33-W35 VanDerWaalsContact C-N 3.33Å; T33-W35 PolarHBondContact O-N 2.89Å; T33-F36 WeakPolarHBondContact O-CB 3.44Å; T33-F36 PolarHBondContact O-N 3.49Å; T33-F37 WeakPolarHBondContact O-CD2 3.28Å; T33-F37 PolarHBondContact O-N 3.42Å; T33-A60 HydrophobicContact CG2-CB 3.9Å; T33-M64 HydrophobicContact CG2-CG 3.84Å
34	A	95.2	Very high	92.5	Very high	51 Å²	51	69.4 Å²	69.4	42%	0.421	37%	0.37	S	S	.	.	H	α-helix	trans	-62	-43.2	173.4	0	0	0	0	0	111.1	M30 F31 F36 F37 V38	M30-A34 VanDerWaalsContact O-CB 3.29Å; M30-A34 WeakPolarHBondContact O-CB 3.42Å; M30-A34 PolarHBondContact O-N 2.83Å; F31-A34 PolarHBondContact O-N 3.1Å; A34-F36 PolarHBondContact O-N 2.95Å; A34-F37 PolarHBondContact O-N 3.33Å; A34-V38 WeakPolarHBondContact O-CG2 3.45Å; A34-V38 PolarHBondContact O-N 2.96Å
35	W	93	Very high	91.6	Very high	140 Å²	140	74 Å²	74	53%	0.53	38%	0.383	S	S	.	.	H	α-helix	trans	-60.5	-43	175.7	-172.2	-86.5	0	0	0	112.3	F31 F32 T33 F37 V38 Y39	F31-W35 HydrophobicContact CZ-CE3 4.26Å; F31-W35 WeakPolarHBondContact O-CB 3.26Å; F31-W35 PolarHBondContact O-N 3.03Å; F32-W35 PolarHBondContact O-N 2.82Å; T33-W35 VanDerWaalsContact C-N 3.33Å; T33-W35 PolarHBondContact O-N 2.89Å; W35-F37 PolarHBondContact O-N 2.78Å; W35-V38 PolarHBondContact O-N 3.06Å; W35-Y39 VanDerWaalsContact O-CB 3.29Å; W35-Y39 WeakPolarHBondContact O-CB 3.29Å; W35-Y39 PolarHBondContact O-N 3.31Å
36	F	92.7	Very high	90.7	Very high	50 Å²	50	82.4 Å²	82.4	22%	0.219	42%	0.415	C	S	.	.	H	α-helix	trans	-59.1	-45.1	173.8	175.8	-99.7	0	0	0	111.7	F32 T33 A34 Y39 E40 E53 I56	F32-F36 WeakPolarHBondContact O-CB 3.25Å; F32-F36 PolarHBondContact O-N 2.95Å; T33-F36 WeakPolarHBondContact O-CB 3.44Å; T33-F36 PolarHBondContact O-N 3.49Å; A34-F36 PolarHBondContact O-N 2.95Å; F36-Y39 WeakPolarHBondContact O-CB 3.23Å; F36-Y39 PolarHBondContact O-N 2.92Å; F36-E40 WeakPolarHBondContact O-CB 3.34Å; F36-E40 PolarHBondContact O-N 3.22Å; F36-E53 HydrophobicContact CE2-CB 4.2Å; F36-I56 HydrophobicContact CB-CG2 3.9Å; F36-I56 HydrophobicContact CD2-CG2 4.45Å
37	F	92.4	Very high	89.9	Confident	133 Å²	133	84.6 Å²	84.6	58%	0.583	43%	0.429	S	S	*	.	H	α-helix	trans	-65.5	-43.5	177.3	-70.1	-38.1	0	0	0	112.7	T33 A34 W35 Y39 E40 V41	T33-F37 WeakPolarHBondContact O-CD2 3.28Å; T33-F37 PolarHBondContact O-N 3.42Å; A34-F37 PolarHBondContact O-N 3.33Å; W35-F37 PolarHBondContact O-N 2.78Å; F37-Y39 PolarHBondContact O-N 3.4Å; F37-E40 PolarHBondContact O-N 2.96Å; F37-V41 WeakPolarHBondContact O-CG1 3.43Å; F37-V41 WeakPolarHBondContact O-CG2 3.46Å; F37-V41 PolarHBondContact O-N 3.41Å
38	V	93.1	Very high	89	Confident	86 Å²	86	87.1 Å²	87.1	52%	0.521	43%	0.428	S	S	.	.	H	α-helix	trans	-58.5	-42.7	174.6	171.2	0	0	0	0	110.5	A34 W35 V41 T42	A34-V38 WeakPolarHBondContact O-CG2 3.45Å; A34-V38 PolarHBondContact O-N 2.96Å; W35-V38 PolarHBondContact O-N 3.06Å; V38-V41 WeakPolarHBondContact O-CG2 3.17Å; V38-T42 VanDerWaalsContact O-CB 3.25Å; V38-T42 WeakPolarHBondContact O-CB 3.25Å; V38-T42 PolarHBondContact O-N 3.22Å; V38-T42 VanDerWaalsContact O-N 3.08Å; V38-T42 PolarHBondContact O-OG1 3.44Å
39	Y	89.9	Confident	88.5	Confident	33 Å²	33	88.1 Å²	88.1	13%	0.129	43%	0.434	C	S	.	.	H	α-helix	trans	-62.9	-45.5	176.2	175.2	-87.7	0	0	0	111.4	W35 F36 F37 T42 S43 D49 K52 E53	W35-Y39 VanDerWaalsContact O-CB 3.29Å; W35-Y39 WeakPolarHBondContact O-CB 3.29Å; W35-Y39 PolarHBondContact O-N 3.31Å; F36-Y39 WeakPolarHBondContact O-CB 3.23Å; F36-Y39 PolarHBondContact O-N 2.92Å; F37-Y39 PolarHBondContact O-N 3.4Å; Y39-T42 PolarHBondContact O-N 3.48Å; Y39-S43 WeakPolarHBondContact CE1-OG 3.36Å; Y39-S43 WeakPolarHBondContact CE2-OG 3.44Å; Y39-S43 WeakPolarHBondContact O-CB 3.41Å; Y39-S43 PolarHBondContact O-N 3.14Å; Y39-S43 PolarHBondContact O-OG 3.19Å; Y39-S43 PolarHBondContact OH-OG 2.94Å; Y39-D49 PolarHBondContact OH-N 3.04Å; Y39-K52 HydrophobicContact CD2-CD 4.36Å; Y39-K52 HydrophobicContact CE1-CD 4.41Å; Y39-K52 HydrophobicContact CE1-CG 4.47Å; Y39-K52 HydrophobicContact CE2-CD 3.41Å; Y39-K52 VanDerWaalsContact CE2-CD 3.41Å; Y39-K52 HydrophobicContact CE2-CG 4.26Å; Y39-K52 VanDerWaalsContact CZ-CD 3.46Å; Y39-K52 WeakPolarHBondContact OH-CD 3.41Å; Y39-K52 WeakPolarHBondContact OH-CE 3.25Å; Y39-K52 PolarHBondContact OH-NZ 3.41Å; Y39-E53 HydrophobicContact CD1-CG 3.88Å; Y39-E53 HydrophobicContact CE1-CG 3.26Å; Y39-E53 WeakPolarHBondContact CE1-OE1 3.27Å; Y39-E53 PolarHBondContact OH-OE1 3.35Å
40	E	89.1	Confident	88.1	Confident	55 Å²	55	93.5 Å²	93.5	26%	0.257	46%	0.461	S	S	.	.	H	α-helix	trans	-65.9	-40.8	-179	-176.5	59.2	-156.4	0	0	112.9	F36 F37 R48	F36-E40 WeakPolarHBondContact O-CB 3.34Å; F36-E40 PolarHBondContact O-N 3.22Å; F37-E40 PolarHBondContact O-N 2.96Å; E40-R48 PolarHBondContact O-NH2 3.5Å; E40-R48 IonicContact OE1-CZ 2.9Å; E40-R48 IonicContact OE1-NH1 2.97Å; E40-R48 PolarHBondContact OE1-NH1 2.91Å; E40-R48 IonicContact OE1-NH2 2.67Å; E40-R48 PolarHBondContact OE1-NH2 2.9Å; E40-R48 IonicContact OE2-CZ 3.83Å; E40-R48 IonicContact OE2-NH1 3.09Å
41	V	90.6	Very high	87.8	Confident	122 Å²	122	97.4 Å²	97.4	74%	0.739	47%	0.472	S	S	*	.	H	α-helix	trans	-76.5	-27.6	-179.7	-58.4	0	0	0	0	113.2	F37 V38	F37-V41 WeakPolarHBondContact O-CG1 3.43Å; F37-V41 WeakPolarHBondContact O-CG2 3.46Å; F37-V41 PolarHBondContact O-N 3.41Å; V38-V41 WeakPolarHBondContact O-CG2 3.17Å
42	T	89	Confident	87.4	Confident	101 Å²	101	94.4 Å²	94.4	62%	0.62	46%	0.459	S	S	*	.	H	α-helix	trans	-88.3	-27	179.3	-49.5	0	0	0	0	111.6	V38 Y39 T44	V38-T42 VanDerWaalsContact O-CB 3.25Å; V38-T42 WeakPolarHBondContact O-CB 3.25Å; V38-T42 PolarHBondContact O-N 3.22Å; V38-T42 VanDerWaalsContact O-N 3.08Å; V38-T42 PolarHBondContact O-OG1 3.44Å; Y39-T42 PolarHBondContact O-N 3.48Å; T42-T44 PolarHBondContact O-N 2.85Å
43	S	83	Confident	87.3	Confident	14 Å²	14	92.9 Å²	92.9	10%	0.098	45%	0.452	C	S	.	.			trans	-76.7	114.6	-176.6	-63.6	0	0	0	0	111.7	Y39 R48	Y39-S43 WeakPolarHBondContact CE1-OG 3.36Å; Y39-S43 WeakPolarHBondContact CE2-OG 3.44Å; Y39-S43 WeakPolarHBondContact O-CB 3.41Å; Y39-S43 PolarHBondContact O-N 3.14Å; Y39-S43 PolarHBondContact O-OG 3.19Å; Y39-S43 PolarHBondContact OH-OG 2.94Å; S43-R48 PolarHBondContact O-NE 3.46Å; S43-R48 PolarHBondContact O-NH2 3.34Å
44	T	80.9	Confident	87.2	Confident	80 Å²	80	96 Å²	96	49%	0.491	47%	0.466	S	S	.	.			trans	-72.2	158	170.9	71.4	0	0	0	0	110.9	T42 Y46 T47 R48	T42-T44 PolarHBondContact O-N 2.85Å; T44-Y46 PolarHBondContact O-N 2.81Å; T44-T47 PolarHBondContact N-OG1 3.47Å; T44-T47 PolarHBondContact O-N 3.4Å; T44-T47 PolarHBondContact O-OG1 3.32Å; T44-T47 PolarHBondContact OG1-OG1 2.89Å; T44-T47 VanDerWaalsContact OG1-OG1 3.1Å; T44-R48 WeakPolarHBondContact O-CG 3.35Å; T44-R48 PolarHBondContact O-N 3.29Å
45	K	77.7	Confident	87.1	Confident	177 Å²	177	99.1 Å²	99.1	77%	0.77	48%	0.476	S	S	*	.	T	Hydrogen-bonded Turn	trans	-48.6	-29	-178.9	-172.9	178	178.9	-178.1	0	114.5
46	Y	75	Confident	87.1	Confident	209 Å²	209	93.8 Å²	93.8	82%	0.82	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91	-17	-176.3	-59.7	-75.7	0	0	0	114.5	T44	T44-Y46 PolarHBondContact O-N 2.81Å
47	T	77.8	Confident	87.2	Confident	74 Å²	74	93.2 Å²	93.2	45%	0.454	46%	0.459	S	S	.	.	T	Hydrogen-bonded Turn	trans	-108.9	8	-177.6	58.9	0	0	0	0	112.5	T44 K52	T44-T47 PolarHBondContact N-OG1 3.47Å; T44-T47 PolarHBondContact O-N 3.4Å; T44-T47 PolarHBondContact O-OG1 3.32Å; T44-T47 PolarHBondContact OG1-OG1 2.89Å; T44-T47 VanDerWaalsContact OG1-OG1 3.1Å; T47-K52 PolarHBondContact O-NZ 3.45Å
48	R	77	Confident	87.3	Confident	103 Å²	103	90.9 Å²	90.9	39%	0.389	45%	0.453	S	S	.	.			trans	-84.5	116.7	179.5	-78.1	173.5	-177	-136.8	-9.4	110.2	E40 S43 T44 E53	E40-R48 PolarHBondContact O-NH2 3.5Å; E40-R48 IonicContact OE1-CZ 2.9Å; E40-R48 IonicContact OE1-NH1 2.97Å; E40-R48 PolarHBondContact OE1-NH1 2.91Å; E40-R48 IonicContact OE1-NH2 2.67Å; E40-R48 PolarHBondContact OE1-NH2 2.9Å; E40-R48 IonicContact OE2-CZ 3.83Å; E40-R48 IonicContact OE2-NH1 3.09Å; S43-R48 PolarHBondContact O-NE 3.46Å; S43-R48 PolarHBondContact O-NH2 3.34Å; T44-R48 WeakPolarHBondContact O-CG 3.35Å; T44-R48 PolarHBondContact O-N 3.29Å; R48-E53 WeakPolarHBondContact CB-OE1 3.29Å
49	D	86.2	Confident	87.4	Confident	90 Å²	90	89.1 Å²	89.1	48%	0.481	44%	0.442	S	S	.	.			trans	-109.2	119.8	168.6	-46.1	-67.6	0	0	0	109	Y39 Y51 K52 E53	Y39-D49 PolarHBondContact OH-N 3.04Å; D49-Y51 PolarHBondContact O-N 2.89Å; D49-K52 HydrophobicContact CB-CD 4.36Å; D49-K52 HydrophobicContact CB-CG 4.13Å; D49-K52 WeakPolarHBondContact O-CG 3.28Å; D49-K52 PolarHBondContact O-N 3.5Å; D49-K52 WeakPolarHBondContact OD2-CE 3.49Å; D49-K52 IonicContact OD2-NZ 3.97Å; D49-K52 PolarHBondContact OD2-NZ 2.89Å; D49-E53 PolarHBondContact O-N 3.21Å
50	I	86.9	Confident	87.7	Confident	112 Å²	112	87.8 Å²	87.8	57%	0.574	44%	0.437	S	S	*	.	H	α-helix	trans	-59.3	-30.4	-179.7	-170	60.8	0	0	0	112.5	E53 L54	I50-E53 PolarHBondContact O-N 3.44Å; I50-L54 VanDerWaalsContact O-CB 3.3Å; I50-L54 WeakPolarHBondContact O-CB 3.3Å; I50-L54 PolarHBondContact O-N 2.85Å
51	Y	89.7	Confident	88	Confident	187 Å²	187	88.6 Å²	88.6	73%	0.733	45%	0.449	S	S	*	.	H	α-helix	trans	-63.4	-44.4	-178.8	-70.1	-75	0	0	0	112.5	D49 L55	D49-Y51 PolarHBondContact O-N 2.89Å; Y51-L55 WeakPolarHBondContact O-CB 3.21Å; Y51-L55 VanDerWaalsContact O-CG 3.25Å; Y51-L55 WeakPolarHBondContact O-CG 3.46Å; Y51-L55 PolarHBondContact O-N 3.5Å
52	K	88	Confident	88.3	Confident	64 Å²	64	87 Å²	87	28%	0.278	44%	0.436	S	S	.	.	H	α-helix	trans	-72.4	-37	177.5	56.7	179.9	149.3	164.6	0	111.8	Y39 T47 D49 L54 L55 I56	Y39-K52 HydrophobicContact CD2-CD 4.36Å; Y39-K52 HydrophobicContact CE1-CD 4.41Å; Y39-K52 HydrophobicContact CE1-CG 4.47Å; Y39-K52 HydrophobicContact CE2-CD 3.41Å; Y39-K52 VanDerWaalsContact CE2-CD 3.41Å; Y39-K52 HydrophobicContact CE2-CG 4.26Å; Y39-K52 VanDerWaalsContact CZ-CD 3.46Å; Y39-K52 WeakPolarHBondContact OH-CD 3.41Å; Y39-K52 WeakPolarHBondContact OH-CE 3.25Å; Y39-K52 PolarHBondContact OH-NZ 3.41Å; T47-K52 PolarHBondContact O-NZ 3.45Å; D49-K52 HydrophobicContact CB-CD 4.36Å; D49-K52 HydrophobicContact CB-CG 4.13Å; D49-K52 WeakPolarHBondContact O-CG 3.28Å; D49-K52 PolarHBondContact O-N 3.5Å; D49-K52 WeakPolarHBondContact OD2-CE 3.49Å; D49-K52 IonicContact OD2-NZ 3.97Å; D49-K52 PolarHBondContact OD2-NZ 2.89Å; K52-L54 VanDerWaalsContact C-N 3.32Å; K52-L54 PolarHBondContact O-N 3.46Å; K52-L55 PolarHBondContact O-N 3.41Å; K52-I56 WeakPolarHBondContact O-CB 3.42Å; K52-I56 WeakPolarHBondContact O-CD1 3.41Å; K52-I56 WeakPolarHBondContact O-CG1 3.08Å; K52-I56 PolarHBondContact O-N 3.47Å
53	E	91.8	Very high	88.6	Confident	27 Å²	27	85.9 Å²	85.9	13%	0.126	42%	0.423	C	S	.	.	H	α-helix	trans	-59.2	-47.6	175.6	-73.6	166.8	-148.3	0	0	110.6	F36 Y39 R48 D49 I50 S57	F36-E53 HydrophobicContact CE2-CB 4.2Å; Y39-E53 HydrophobicContact CD1-CG 3.88Å; Y39-E53 HydrophobicContact CE1-CG 3.26Å; Y39-E53 WeakPolarHBondContact CE1-OE1 3.27Å; Y39-E53 PolarHBondContact OH-OE1 3.35Å; R48-E53 WeakPolarHBondContact CB-OE1 3.29Å; D49-E53 PolarHBondContact O-N 3.21Å; I50-E53 PolarHBondContact O-N 3.44Å; E53-S57 VanDerWaalsContact O-CB 3.26Å; E53-S57 WeakPolarHBondContact O-CB 3.44Å; E53-S57 PolarHBondContact O-N 2.89Å; E53-S57 PolarHBondContact O-OG 3Å
54	L	92.1	Very high	89.2	Confident	107 Å²	107	87.9 Å²	87.9	56%	0.56	43%	0.431	S	S	*	.	H	α-helix	trans	-65.5	-42.7	178.4	-171.3	62.2	0	0	0	111.7	I50 K52 S57 L58	I50-L54 VanDerWaalsContact O-CB 3.3Å; I50-L54 WeakPolarHBondContact O-CB 3.3Å; I50-L54 PolarHBondContact O-N 2.85Å; K52-L54 VanDerWaalsContact C-N 3.32Å; K52-L54 PolarHBondContact O-N 3.46Å; L54-S57 WeakPolarHBondContact CA-OG 3.28Å; L54-S57 PolarHBondContact O-OG 3.44Å; L54-S57 VanDerWaalsContact O-OG 3.13Å; L54-L58 WeakPolarHBondContact O-CB 3.33Å; L54-L58 PolarHBondContact O-N 3.48Å
55	L	93.2	Very high	89.8	Confident	117 Å²	117	85.8 Å²	85.8	61%	0.613	43%	0.426	S	S	*	.	H	α-helix	trans	-63.1	-47.5	177.9	-75.5	172.2	0	0	0	112.3	Y51 K52 L58 V59	Y51-L55 WeakPolarHBondContact O-CB 3.21Å; Y51-L55 VanDerWaalsContact O-CG 3.25Å; Y51-L55 WeakPolarHBondContact O-CG 3.46Å; Y51-L55 PolarHBondContact O-N 3.5Å; K52-L55 PolarHBondContact O-N 3.41Å; L55-L58 PolarHBondContact O-N 2.85Å; L55-V59 VanDerWaalsContact O-CG2 3.3Å; L55-V59 WeakPolarHBondContact O-CG2 3.25Å; L55-V59 PolarHBondContact O-N 3.38Å
56	I	92.8	Very high	90.6	Very high	29 Å²	29	82.7 Å²	82.7	15%	0.149	41%	0.413	C	S	.	.	H	α-helix	trans	-66.3	-45.4	-178.9	-62.8	161.7	0	0	0	110.1	F36 K52 L58 V59 A60	F36-I56 HydrophobicContact CB-CG2 3.9Å; F36-I56 HydrophobicContact CD2-CG2 4.45Å; K52-I56 WeakPolarHBondContact O-CB 3.42Å; K52-I56 WeakPolarHBondContact O-CD1 3.41Å; K52-I56 WeakPolarHBondContact O-CG1 3.08Å; K52-I56 PolarHBondContact O-N 3.47Å; I56-L58 PolarHBondContact O-N 3.03Å; I56-V59 PolarHBondContact O-N 3Å; I56-A60 VanDerWaalsContact O-CB 3.28Å; I56-A60 WeakPolarHBondContact O-CB 3.41Å; I56-A60 PolarHBondContact O-N 2.95Å
57	S	94.4	Very high	91.5	Very high	37 Å²	37	72.8 Å²	72.8	26%	0.259	37%	0.374	S	S	.	.	H	α-helix	trans	-67.2	-34.6	179.3	59.1	0	0	0	0	112.8	E53 L54 A60 S61	E53-S57 VanDerWaalsContact O-CB 3.26Å; E53-S57 WeakPolarHBondContact O-CB 3.44Å; E53-S57 PolarHBondContact O-N 2.89Å; E53-S57 PolarHBondContact O-OG 3Å; L54-S57 WeakPolarHBondContact CA-OG 3.28Å; L54-S57 PolarHBondContact O-OG 3.44Å; L54-S57 VanDerWaalsContact O-OG 3.13Å; S57-A60 PolarHBondContact O-N 3.08Å; S57-S61 VanDerWaalsContact O-CB 3.28Å; S57-S61 WeakPolarHBondContact O-CB 3.49Å; S57-S61 PolarHBondContact O-N 2.85Å; S57-S61 PolarHBondContact O-OG 2.89Å
58	L	95.2	Very high	92.3	Very high	85 Å²	85	72.4 Å²	72.4	45%	0.445	37%	0.371	S	S	.	.	H	α-helix	trans	-63.8	-49.9	173.4	-170.8	165.5	0	0	0	110.3	L54 L55 I56 A60 S61 L62	L54-L58 WeakPolarHBondContact O-CB 3.33Å; L54-L58 PolarHBondContact O-N 3.48Å; L55-L58 PolarHBondContact O-N 2.85Å; I56-L58 PolarHBondContact O-N 3.03Å; L58-A60 VanDerWaalsContact C-N 3.34Å; L58-A60 PolarHBondContact O-N 3.18Å; L58-S61 PolarHBondContact O-N 3.38Å; L58-S61 PolarHBondContact O-OG 3.39Å; L58-L62 HydrophobicContact CD2-CD1 3.52Å; L58-L62 HydrophobicContact CD2-CG 4.05Å; L58-L62 WeakPolarHBondContact O-CG 3.42Å; L58-L62 PolarHBondContact O-N 2.92Å
59	V	95.3	Very high	93	Very high	49 Å²	49	71 Å²	71	30%	0.297	37%	0.371	S	S	.	.	H	α-helix	trans	-60.1	-46.3	176.6	174.2	0	0	0	0	110.7	F32 L55 I56 S61 L62 F63	F32-V59 HydrophobicContact CD1-CG1 4.22Å; F32-V59 HydrophobicContact CD2-CG1 4.02Å; F32-V59 HydrophobicContact CE1-CG1 4.13Å; F32-V59 HydrophobicContact CE2-CG1 3.93Å; F32-V59 HydrophobicContact CG-CG1 4.18Å; F32-V59 HydrophobicContact CZ-CG1 3.99Å; L55-V59 VanDerWaalsContact O-CG2 3.3Å; L55-V59 WeakPolarHBondContact O-CG2 3.25Å; L55-V59 PolarHBondContact O-N 3.38Å; I56-V59 PolarHBondContact O-N 3Å; V59-S61 PolarHBondContact O-N 3.29Å; V59-L62 PolarHBondContact O-N 2.73Å; V59-F63 HydrophobicContact CG1-CD2 3.75Å; V59-F63 HydrophobicContact CG1-CE2 3.73Å; V59-F63 VanDerWaalsContact O-CD2 3.25Å; V59-F63 WeakPolarHBondContact O-CD2 3.41Å; V59-F63 PolarHBondContact O-N 3.49Å; V59-F63 VanDerWaalsContact O-N 3.14Å
60	A	95.9	Very high	93.2	Very high	4 Å²	4	69 Å²	69	3%	0.033	36%	0.358	C	S	.	.	H	α-helix	trans	-58.4	-48	177.9	0	0	0	0	0	112.3	F32 T33 I56 S57 L58 F63 M64	F32-A60 HydrophobicContact CB-CB 3.69Å; T33-A60 HydrophobicContact CG2-CB 3.9Å; I56-A60 VanDerWaalsContact O-CB 3.28Å; I56-A60 WeakPolarHBondContact O-CB 3.41Å; I56-A60 PolarHBondContact O-N 2.95Å; S57-A60 PolarHBondContact O-N 3.08Å; L58-A60 VanDerWaalsContact C-N 3.34Å; L58-A60 PolarHBondContact O-N 3.18Å; A60-F63 PolarHBondContact O-N 2.95Å; A60-M64 VanDerWaalsContact O-CB 3.29Å; A60-M64 WeakPolarHBondContact O-CB 3.13Å; A60-M64 VanDerWaalsContact O-CG 3.27Å; A60-M64 WeakPolarHBondContact O-CG 3.43Å; A60-M64 PolarHBondContact O-N 3.48Å
61	S	96.1	Very high	93.4	Very high	72 Å²	72	66.6 Å²	66.6	50%	0.503	35%	0.346	S	S	.	.	H	α-helix	trans	-68.4	-34.9	-178	59.6	0	0	0	0	112.9	S57 L58 V59 G65	S57-S61 VanDerWaalsContact O-CB 3.28Å; S57-S61 WeakPolarHBondContact O-CB 3.49Å; S57-S61 PolarHBondContact O-N 2.85Å; S57-S61 PolarHBondContact O-OG 2.89Å; L58-S61 PolarHBondContact O-N 3.38Å; L58-S61 PolarHBondContact O-OG 3.39Å; V59-S61 PolarHBondContact O-N 3.29Å; S61-G65 WeakPolarHBondContact O-CA 3.26Å; S61-G65 PolarHBondContact O-N 2.71Å
62	L	96	Very high	93.5	Very high	89 Å²	89	60 Å²	60	47%	0.466	32%	0.323	S	S	.	.	H	α-helix	trans	-62.6	-52.8	172.5	-74.2	178.7	0	0	0	111.3	L58 V59 M64 G65 F66	L58-L62 HydrophobicContact CD2-CD1 3.52Å; L58-L62 HydrophobicContact CD2-CG 4.05Å; L58-L62 WeakPolarHBondContact O-CG 3.42Å; L58-L62 PolarHBondContact O-N 2.92Å; V59-L62 PolarHBondContact O-N 2.73Å; L62-M64 PolarHBondContact O-N 2.91Å; L62-G65 PolarHBondContact O-N 3.41Å; L62-F66 HydrophobicContact CD2-CE2 4.38Å; L62-F66 WeakPolarHBondContact O-CD2 3.29Å; L62-F66 PolarHBondContact O-N 3.38Å
63	F	95.9	Very high	93.5	Very high	77 Å²	77	59.4 Å²	59.4	34%	0.338	32%	0.323	S	S	.	.	H	α-helix	trans	-64.4	-41.5	-179.2	-80.2	-71.4	0	0	0	112.5	I28 F32 V59 A60 G67	I28-F63 HydrophobicContact CG2-CD1 4.21Å; I28-F63 HydrophobicContact CG2-CD2 4.26Å; I28-F63 HydrophobicContact CG2-CE1 4.39Å; I28-F63 HydrophobicContact CG2-CE2 4.45Å; I28-F63 HydrophobicContact CG2-CG 4.16Å; F32-F63 HydrophobicContact CD2-CD2 4.41Å; F32-F63 HydrophobicContact CE2-CD2 4.48Å; F32-F63 HydrophobicContact CE2-CE2 4.48Å; V59-F63 HydrophobicContact CG1-CD2 3.75Å; V59-F63 HydrophobicContact CG1-CE2 3.73Å; V59-F63 VanDerWaalsContact O-CD2 3.25Å; V59-F63 WeakPolarHBondContact O-CD2 3.41Å; V59-F63 PolarHBondContact O-N 3.49Å; V59-F63 VanDerWaalsContact O-N 3.14Å; A60-F63 PolarHBondContact O-N 2.95Å; F63-G67 PolarHBondContact O-N 2.92Å
64	M	95	Very high	93.3	Very high	56 Å²	56	65.2 Å²	65.2	28%	0.276	34%	0.344	S	S	.	.	H	α-helix	trans	-64.6	-43	174.6	-74.6	-64.2	-67.9	0	0	111.7	L26 G29 M30 T33 A60 L62 G67 V68	L26-M64 HydrophobicContact CD2-CE 4.31Å; L26-M64 HydrophobicContact CD2-SD 4.14Å; G29-M64 VanDerWaalsContact C-SD 3.57Å; M30-M64 HydrophobicContact CG-CE 4.48Å; M30-M64 HydrophobicContact CG-SD 4.06Å; T33-M64 HydrophobicContact CG2-CG 3.84Å; A60-M64 VanDerWaalsContact O-CB 3.29Å; A60-M64 WeakPolarHBondContact O-CB 3.13Å; A60-M64 VanDerWaalsContact O-CG 3.27Å; A60-M64 WeakPolarHBondContact O-CG 3.43Å; A60-M64 PolarHBondContact O-N 3.48Å; L62-M64 PolarHBondContact O-N 2.91Å; M64-G67 PolarHBondContact O-N 3.34Å; M64-V68 VanDerWaalsContact O-CG2 3.28Å; M64-V68 WeakPolarHBondContact O-CG2 3.45Å; M64-V68 PolarHBondContact O-N 3.13Å
65	G	94.6	Very high	93.2	Very high	37 Å²	37	64.7 Å²	64.7	38%	0.381	35%	0.345	S	S	.	.	H	α-helix	trans	-59.9	-53.4	177.9	0	0	0	0	0	111.9	S61 L62 G67 V68 L69	S61-G65 WeakPolarHBondContact O-CA 3.26Å; S61-G65 PolarHBondContact O-N 2.71Å; L62-G65 PolarHBondContact O-N 3.41Å; G65-G67 VanDerWaalsContact C-N 3.34Å; G65-G67 PolarHBondContact O-N 2.88Å; G65-V68 PolarHBondContact O-N 3.02Å; G65-L69 WeakPolarHBondContact O-CG 3.11Å; G65-L69 PolarHBondContact O-N 3.36Å
66	F	93.5	Very high	92.8	Very high	112 Å²	112	60.7 Å²	60.7	49%	0.491	33%	0.332	S	S	.	.	H	α-helix	trans	-63.2	-39.7	175.9	-74.9	-67.3	0	0	0	112.3	L25 L62 V68 L69 F70	L25-F66 HydrophobicContact CD2-CB 3.61Å; L62-F66 HydrophobicContact CD2-CE2 4.38Å; L62-F66 WeakPolarHBondContact O-CD2 3.29Å; L62-F66 PolarHBondContact O-N 3.38Å; F66-V68 VanDerWaalsContact C-N 3.31Å; F66-V68 PolarHBondContact O-N 3.3Å; F66-L69 HydrophobicContact CD1-CD1 4.18Å; F66-L69 PolarHBondContact O-N 2.87Å; F66-F70 VanDerWaalsContact O-CD2 3.25Å; F66-F70 WeakPolarHBondContact O-CD2 3.39Å; F66-F70 PolarHBondContact O-N 2.92Å; F66-F70 VanDerWaalsContact O-N 3.11Å
67	G	94.7	Very high	92.6	Very high	0 Å²	0	63.7 Å²	63.7	0%	0	35%	0.347	C	S	.	.	H	α-helix	trans	-58.9	-41.6	176.5	0	0	0	0	0	112.7	F63 M64 G65 L71	F63-G67 PolarHBondContact O-N 2.92Å; M64-G67 PolarHBondContact O-N 3.34Å; G65-G67 VanDerWaalsContact C-N 3.34Å; G65-G67 PolarHBondContact O-N 2.88Å; G67-L71 PolarHBondContact O-N 2.9Å; G67-L71 VanDerWaalsContact O-N 3.1Å
68	V	93.6	Very high	91.8	Very high	66 Å²	66	71 Å²	71	40%	0.4	37%	0.371	S	S	.	.	H	α-helix	trans	-68.9	-39.1	176.1	172.8	0	0	0	0	111.7	L26 M64 G65 F66 F70 L71 L72	L26-V68 HydrophobicContact CD2-CG2 4.19Å; M64-V68 VanDerWaalsContact O-CG2 3.28Å; M64-V68 WeakPolarHBondContact O-CG2 3.45Å; M64-V68 PolarHBondContact O-N 3.13Å; G65-V68 PolarHBondContact O-N 3.02Å; F66-V68 VanDerWaalsContact C-N 3.31Å; F66-V68 PolarHBondContact O-N 3.3Å; V68-F70 VanDerWaalsContact C-N 3.34Å; V68-F70 PolarHBondContact O-N 3.27Å; V68-L71 WeakPolarHBondContact O-CB 3.1Å; V68-L71 PolarHBondContact O-N 2.67Å; V68-L72 HydrophobicContact CG1-CD1 4.45Å; V68-L72 WeakPolarHBondContact O-CG 3.25Å; V68-L72 PolarHBondContact O-N 3.24Å
69	L	92.3	Very high	90.6	Very high	74 Å²	74	74.2 Å²	74.2	39%	0.387	39%	0.393	S	S	.	.	H	α-helix	trans	-57.8	-46.7	175.3	-69.8	176.7	0	0	0	111.6	G65 F66 L71 L72 L73 V79	G65-L69 WeakPolarHBondContact O-CG 3.11Å; G65-L69 PolarHBondContact O-N 3.36Å; F66-L69 HydrophobicContact CD1-CD1 4.18Å; F66-L69 PolarHBondContact O-N 2.87Å; L69-L71 VanDerWaalsContact C-N 3.25Å; L69-L71 PolarHBondContact O-N 2.95Å; L69-L72 PolarHBondContact O-N 3.34Å; L69-L73 WeakPolarHBondContact O-CG 3.45Å; L69-L73 PolarHBondContact O-N 3.43Å; L69-L73 VanDerWaalsContact O-N 3.1Å; L69-V79 HydrophobicContact CD2-CG1 4.34Å; L69-V79 HydrophobicContact CD2-CG2 4.35Å
70	F	90.1	Very high	90.4	Very high	49 Å²	49	75.5 Å²	75.5	22%	0.215	40%	0.398	C	S	.	.	H	α-helix	trans	-66.8	-28.5	176.2	-75.9	-74.5	0	0	0	112.4	F18 L21 T22 L25 F66 V68 L73 W74	F18-F70 HydrophobicContact CD1-CD1 4.08Å; F18-F70 HydrophobicContact CD1-CE1 4.27Å; L21-F70 HydrophobicContact CB-CD1 4.39Å; L21-F70 HydrophobicContact CB-CG 4.35Å; L21-F70 HydrophobicContact CD1-CD1 4.26Å; L21-F70 HydrophobicContact CD1-CE1 3.8Å; L21-F70 HydrophobicContact CD1-CZ 4.03Å; T22-F70 HydrophobicContact CG2-CB 3.32Å; T22-F70 WeakPolarHBondContact CG2-O 3.3Å; L25-F70 HydrophobicContact CD2-CD2 3.92Å; L25-F70 HydrophobicContact CD2-CE2 4.07Å; F66-F70 VanDerWaalsContact O-CD2 3.25Å; F66-F70 WeakPolarHBondContact O-CD2 3.39Å; F66-F70 PolarHBondContact O-N 2.92Å; F66-F70 VanDerWaalsContact O-N 3.11Å; V68-F70 VanDerWaalsContact C-N 3.34Å; V68-F70 PolarHBondContact O-N 3.27Å; F70-L73 HydrophobicContact CD1-CD1 4.21Å; F70-L73 PolarHBondContact O-N 3.49Å; F70-W74 WeakPolarHBondContact O-CB 3.49Å; F70-W74 PolarHBondContact O-N 2.97Å
71	L	91.1	Very high	90.1	Very high	61 Å²	61	79.3 Å²	79.3	32%	0.319	42%	0.417	S	S	.	.	H	α-helix	trans	-67	-45.3	177.1	-174.5	165.5	0	0	0	109.6	T22 L26 G67 V68 L69 L73 W74 V75	T22-L71 HydrophobicContact CG2-CB 4.18Å; L26-L71 HydrophobicContact CD1-CD1 3.91Å; G67-L71 PolarHBondContact O-N 2.9Å; G67-L71 VanDerWaalsContact O-N 3.1Å; V68-L71 WeakPolarHBondContact O-CB 3.1Å; V68-L71 PolarHBondContact O-N 2.67Å; L69-L71 VanDerWaalsContact C-N 3.25Å; L69-L71 PolarHBondContact O-N 2.95Å; L71-L73 VanDerWaalsContact C-N 3.31Å; L71-L73 PolarHBondContact O-N 2.65Å; L71-W74 WeakPolarHBondContact O-CB 2.78Å; L71-W74 PolarHBondContact O-N 3.1Å; L71-W74 VanDerWaalsContact O-N 3.1Å; L71-V75 HydrophobicContact CD2-CG2 3.95Å; L71-V75 WeakPolarHBondContact O-CG2 3.42Å; L71-V75 PolarHBondContact O-N 3.23Å
72	L	92.1	Very high	89.8	Confident	47 Å²	47	79.7 Å²	79.7	25%	0.246	41%	0.412	C	S	.	.	H	α-helix	trans	-57.7	-46.2	174.7	-66	174.3	0	0	0	110.8	V68 L69 W74 V75 G76 I77 V79	V68-L72 HydrophobicContact CG1-CD1 4.45Å; V68-L72 WeakPolarHBondContact O-CG 3.25Å; V68-L72 PolarHBondContact O-N 3.24Å; L69-L72 PolarHBondContact O-N 3.34Å; L72-W74 VanDerWaalsContact C-N 3.31Å; L72-W74 PolarHBondContact O-N 3.46Å; L72-V75 PolarHBondContact O-N 2.97Å; L72-G76 PolarHBondContact O-N 2.91Å; L72-I77 CarbonylContact C-O 3.12Å; L72-I77 HydrophobicContact CB-CB 4.28Å; L72-I77 WeakPolarHBondContact CB-O 3.46Å; L72-I77 HydrophobicContact CD2-CB 4.26Å; L72-I77 HydrophobicContact CD2-CD1 4.17Å; L72-I77 HydrophobicContact CD2-CG2 4.29Å; L72-I77 CarbonylContact O-C 3.59Å; L72-I77 PolarHBondContact O-N 2.78Å; L72-I77 VanDerWaalsContact O-O 3.06Å; L72-V79 HydrophobicContact CB-CG2 4.24Å; L72-V79 HydrophobicContact CD1-CG2 3.53Å
73	L	88.7	Confident	89.4	Confident	52 Å²	52	79.1 Å²	79.1	27%	0.272	41%	0.409	S	S	.	.	H	α-helix	trans	-61.4	-36.6	175.1	-65.6	177.7	0	0	0	113	F18 L69 F70 L71 G76 Y78	F18-L73 HydrophobicContact CD2-CB 4.03Å; F18-L73 HydrophobicContact CE2-CB 4.21Å; L69-L73 WeakPolarHBondContact O-CG 3.45Å; L69-L73 PolarHBondContact O-N 3.43Å; L69-L73 VanDerWaalsContact O-N 3.1Å; F70-L73 HydrophobicContact CD1-CD1 4.21Å; F70-L73 PolarHBondContact O-N 3.49Å; L71-L73 VanDerWaalsContact C-N 3.31Å; L71-L73 PolarHBondContact O-N 2.65Å; L73-G76 PolarHBondContact O-N 2.9Å; L73-Y78 HydrophobicContact CD2-CD1 4.13Å
74	W	86.8	Confident	89	Confident	149 Å²	149	79.3 Å²	79.3	56%	0.564	41%	0.414	S	S	*	.	H	α-helix	trans	-66.7	-41.4	176.2	175.4	31.1	0	0	0	112.3	P19 T22 F70 L71 L72 G76	P19-W74 HydrophobicContact CB-CD2 4.29Å; P19-W74 HydrophobicContact CB-CG 4.4Å; P19-W74 HydrophobicContact CG-CD2 4.43Å; P19-W74 HydrophobicContact CG-CG 4.1Å; T22-W74 HydrophobicContact CG2-CB 4.44Å; F70-W74 WeakPolarHBondContact O-CB 3.49Å; F70-W74 PolarHBondContact O-N 2.97Å; L71-W74 WeakPolarHBondContact O-CB 2.78Å; L71-W74 PolarHBondContact O-N 3.1Å; L71-W74 VanDerWaalsContact O-N 3.1Å; L72-W74 VanDerWaalsContact C-N 3.31Å; L72-W74 PolarHBondContact O-N 3.46Å; W74-G76 PolarHBondContact O-N 3.17Å
75	V	90.1	Very high	88.6	Confident	96 Å²	96	80.8 Å²	80.8	58%	0.582	42%	0.423	S	S	*	.	H	α-helix	trans	-70.3	-15.2	175.1	177.6	0	0	0	0	111.8	L71 L72 I77	L71-V75 HydrophobicContact CD2-CG2 3.95Å; L71-V75 WeakPolarHBondContact O-CG2 3.42Å; L71-V75 PolarHBondContact O-N 3.23Å; L72-V75 PolarHBondContact O-N 2.97Å; V75-I77 HydrophobicContact CG1-CD1 4.07Å; V75-I77 HydrophobicContact CG1-CG1 4.12Å
76	G	85.6	Confident	88.2	Confident	33 Å²	33	83.9 Å²	83.9	34%	0.34	43%	0.426	S	S	.	.	T	Hydrogen-bonded Turn	trans	87.8	14.2	-176.5	0	0	0	0	0	113.5	L72 L73 W74 Y78	L72-G76 PolarHBondContact O-N 2.91Å; L73-G76 PolarHBondContact O-N 2.9Å; W74-G76 PolarHBondContact O-N 3.17Å; G76-Y78 WeakPolarHBondContact O-CD2 2.9Å; G76-Y78 WeakPolarHBondContact O-CE2 3.36Å; G76-Y78 PolarHBondContact O-N 3.38Å
77	I	87.4	Confident	87.8	Confident	92 Å²	92	81.8 Å²	81.8	47%	0.472	42%	0.421	S	S	.	.			trans	-86.6	102.6	169.5	-57.7	173.3	0	0	0	106.9	L72 V75	L72-I77 CarbonylContact C-O 3.12Å; L72-I77 HydrophobicContact CB-CB 4.28Å; L72-I77 WeakPolarHBondContact CB-O 3.46Å; L72-I77 HydrophobicContact CD2-CB 4.26Å; L72-I77 HydrophobicContact CD2-CD1 4.17Å; L72-I77 HydrophobicContact CD2-CG2 4.29Å; L72-I77 CarbonylContact O-C 3.59Å; L72-I77 PolarHBondContact O-N 2.78Å; L72-I77 VanDerWaalsContact O-O 3.06Å; V75-I77 HydrophobicContact CG1-CD1 4.07Å; V75-I77 HydrophobicContact CG1-CG1 4.12Å
78	Y	77.9	Confident	87.2	Confident	192 Å²	192	88.6 Å²	88.6	75%	0.753	46%	0.456	S	S	*	.			trans	-77.4	131.7	176.8	-51.4	-75.6	0	0	0	109.8	L73 G76	L73-Y78 HydrophobicContact CD2-CD1 4.13Å; G76-Y78 WeakPolarHBondContact O-CD2 2.9Å; G76-Y78 WeakPolarHBondContact O-CE2 3.36Å; G76-Y78 PolarHBondContact O-N 3.38Å
79	V	70.7	Confident	86.6	Confident	152 Å²	152	90.6 Å²	90.6	92%	0.921	46%	0.461	S	S	*	.			trans	-100.1	0	172	-179.2	0	0	0	0	109.3	L69 L72	L69-V79 HydrophobicContact CD2-CG1 4.34Å; L69-V79 HydrophobicContact CD2-CG2 4.35Å; L72-V79 HydrophobicContact CB-CG2 4.24Å; L72-V79 HydrophobicContact CD1-CG2 3.53Å

Retrieved 79 of 79 residues in 542.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).