A0A096MS76_PAPAN Loading...

Neurogranin

AlphaFold DB (Q92686), UniProt , Accession A0A096MS76, Species PAPAN (Papio anubis, Olive baboon), Gene NRGN, Length 78 aa.

						>A0A096MS76_PAPAN|A0A096MS76|NRGN
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.4	Low	49.2	Very low	214 Å²	214	134.9 Å²	134.9	100%	1.054	78%	0.776	S	S	*	*				0	92.4	0	-83.8	72.7	156.7	0	0	106.6	C3	M1-C3 VanDerWaalsContact C-N 3.34Å; M1-C3 PolarHBondContact O-N 3.45Å
2	D	43.6	Very low	50.8	Low	158 Å²	158	130.2 Å²	130.2	85%	0.845	75%	0.754	S	S	*	*			trans	-96.7	79.8	-152.4	-28.1	-58.2	0	0	0	103.9
3	C	41.1	Very low	52.7	Low	96 Å²	96	128.6 Å²	128.6	65%	0.649	74%	0.741	S	S	*	*			trans	-90.9	-3.2	-165.5	-168.3	0	0	0	0	113.3	M1	M1-C3 VanDerWaalsContact C-N 3.34Å; M1-C3 PolarHBondContact O-N 3.45Å
4	C	39.8	Very low	54.3	Low	92 Å²	92	128.3 Å²	128.3	62%	0.622	74%	0.735	S	S	*	*			trans	-128.4	111	167.1	-58.2	0	0	0	0	104.3	E6	C4-E6 WeakPolarHBondContact CA-OE1 3.09Å; C4-E6 WeakPolarHBondContact CB-OE1 3.44Å
5	T	50.7	Low	55.7	Low	124 Å²	124	128.5 Å²	128.5	76%	0.761	73%	0.733	S	S	*	*			trans	-106.1	119.2	155.5	-151.5	0	0	0	0	104.3	N7	T5-N7 PolarHBondContact O-N 3.45Å
6	E	52.7	Low	57.2	Low	163 Å²	163	126.4 Å²	126.4	76%	0.762	72%	0.718	S	S	*	*	S	Bend	trans	-72	31	-161.4	-32.7	-61.4	97.7	0	0	113.3	C4	C4-E6 WeakPolarHBondContact CA-OE1 3.09Å; C4-E6 WeakPolarHBondContact CB-OE1 3.44Å
7	N	51.9	Low	58.4	Low	129 Å²	129	125.7 Å²	125.7	69%	0.69	71%	0.711	S	S	*	*			trans	-119	16.1	-162.6	-156.6	49.9	0	0	0	115.3	T5	T5-N7 PolarHBondContact O-N 3.45Å
8	A	53.3	Low	59.8	Low	98 Å²	98	125.9 Å²	125.9	81%	0.81	71%	0.71	S	S	*	*			trans	-114.2	26	-176.7	0	0	0	0	0	114.5
9	C	43.1	Very low	61.1	Low	135 Å²	135	123.5 Å²	123.5	91%	0.912	69%	0.694	S	S	*	*			trans	-109	45.1	162.8	-162.6	0	0	0	0	109.5
10	S	52.8	Low	62.3	Low	90 Å²	90	120.9 Å²	120.9	63%	0.629	68%	0.683	S	S	*	*	S	Bend	trans	-91.3	148.5	162	-63.3	0	0	0	0	106.6
11	K	61.4	Low	63.4	Low	185 Å²	185	122.5 Å²	122.5	80%	0.804	69%	0.688	S	S	*	*			trans	-42.9	143.9	-178.3	-56.6	-175.2	175.8	76.1	0	110.4	D13	K11-D13 PolarHBondContact O-N 3.05Å
12	P	69.4	Low	65.3	Low	78 Å²	78	118.8 Å²	118.8	51%	0.506	67%	0.673	S	S	.	*			trans	-51.8	123.9	175.8	23.9	-32.8	0	0	0	107.9	I16 L17	P12-I16 HydrophobicContact CB-CD1 4.41Å; P12-L17 HydrophobicContact CG-CD2 4.32Å
13	D	75.5	Confident	67.6	Low	110 Å²	110	114.3 Å²	114.3	59%	0.588	65%	0.649	S	S	*	*			trans	-53.4	141.9	175.3	-60.6	-77.3	0	0	0	108.6	K11 D15 I16	K11-D13 PolarHBondContact O-N 3.05Å; D13-D15 PolarHBondContact O-N 2.93Å; D13-D15 VanDerWaalsContact O-N 3.09Å; D13-I16 HydrophobicContact CB-CD1 4.23Å; D13-I16 HydrophobicContact CB-CG1 4.37Å; D13-I16 WeakPolarHBondContact O-CA 3.37Å; D13-I16 VanDerWaalsContact O-CB 3.28Å; D13-I16 WeakPolarHBondContact O-CB 3.38Å; D13-I16 PolarHBondContact O-N 3.06Å
14	D	74.8	Confident	70.1	Confident	124 Å²	124	114.5 Å²	114.5	66%	0.663	65%	0.649	S	S	*	*	H	α-helix	trans	-56.1	-30.3	-177	-65	-72.4	0	0	0	111.7	I16 L17 D18	D14-I16 PolarHBondContact O-N 2.83Å; D14-L17 WeakPolarHBondContact O-CA 3.35Å; D14-L17 WeakPolarHBondContact O-CB 3.49Å; D14-L17 PolarHBondContact O-N 2.8Å; D14-D18 PolarHBondContact O-N 2.87Å; D14-D18 VanDerWaalsContact O-N 3.09Å
15	D	74.9	Confident	72.6	Confident	131 Å²	131	112.1 Å²	112.1	70%	0.701	64%	0.64	S	S	*	*	H	α-helix	trans	-59.2	-26.2	173.1	-62.9	-59.3	0	0	0	113.8	D13 I19	D13-D15 PolarHBondContact O-N 2.93Å; D13-D15 VanDerWaalsContact O-N 3.09Å; D15-I19 WeakPolarHBondContact O-CG1 3.4Å
16	I	79.5	Confident	74.6	Confident	96 Å²	96	107.3 Å²	107.3	49%	0.492	61%	0.613	S	S	.	*	H	α-helix	trans	-76.9	-32.8	175	-58.6	169.8	0	0	0	110.2	P12 D13 D14	P12-I16 HydrophobicContact CB-CD1 4.41Å; D13-I16 HydrophobicContact CB-CD1 4.23Å; D13-I16 HydrophobicContact CB-CG1 4.37Å; D13-I16 WeakPolarHBondContact O-CA 3.37Å; D13-I16 VanDerWaalsContact O-CB 3.28Å; D13-I16 WeakPolarHBondContact O-CB 3.38Å; D13-I16 PolarHBondContact O-N 3.06Å; D14-I16 PolarHBondContact O-N 2.83Å
17	L	77.1	Confident	76.5	Confident	114 Å²	114	103.3 Å²	103.3	60%	0.597	60%	0.597	S	S	*	*	H	α-helix	trans	-75.9	-25.6	179.2	-60	177.2	0	0	0	112.2	P12 D14 I19	P12-L17 HydrophobicContact CG-CD2 4.32Å; D14-L17 WeakPolarHBondContact O-CA 3.35Å; D14-L17 WeakPolarHBondContact O-CB 3.49Å; D14-L17 PolarHBondContact O-N 2.8Å; L17-I19 VanDerWaalsContact C-N 3.28Å; L17-I19 PolarHBondContact O-N 2.88Å
18	D	83.7	Confident	78.5	Confident	130 Å²	130	100.2 Å²	100.2	70%	0.695	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.4	-0.2	179	-74.5	-31.3	0	0	0	114.2	D14 P20	D14-D18 PolarHBondContact O-N 2.87Å; D14-D18 VanDerWaalsContact O-N 3.09Å; D18-P20 WeakPolarHBondContact O-CD 3.48Å
19	I	84.7	Confident	80.4	Confident	80 Å²	80	98 Å²	98	41%	0.41	57%	0.571	S	S	.	*	S	Bend	trans	-79.6	119.9	179.1	-56.7	175.6	0	0	0	109.9	D15 L17 L21 A26	D15-I19 WeakPolarHBondContact O-CG1 3.4Å; L17-I19 VanDerWaalsContact C-N 3.28Å; L17-I19 PolarHBondContact O-N 2.88Å; I19-L21 PolarHBondContact O-N 2.75Å; I19-A26 HydrophobicContact CG2-CB 3.34Å
20	P	85	Confident	82.8	Confident	71 Å²	71	93.4 Å²	93.4	46%	0.461	54%	0.543	S	S	.	.			trans	-63.7	127.9	175.1	13.6	-14.9	0	0	0	110.9	D18 D22 D23	D18-P20 WeakPolarHBondContact O-CD 3.48Å; P20-D22 WeakPolarHBondContact CB-OD1 3.49Å; P20-D22 PolarHBondContact O-N 2.85Å; P20-D23 HydrophobicContact CB-CB 4.45Å; P20-D23 HydrophobicContact CG-CB 4.01Å; P20-D23 PolarHBondContact O-N 3.07Å; P20-D23 VanDerWaalsContact O-N 3.09Å
21	L	86.9	Confident	84.8	Confident	154 Å²	154	91.6 Å²	91.6	81%	0.806	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.8	-16.9	-176.6	-61.3	-178.3	0	0	0	113.4	I19 N27	I19-L21 PolarHBondContact O-N 2.75Å; L21-N27 PolarHBondContact O-ND2 3.14Å; L21-N27 PolarHBondContact O-OD1 3.21Å
22	D	89.9	Confident	86.4	Confident	136 Å²	136	90.6 Å²	90.6	73%	0.727	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.1	-2.9	178.2	51.4	-35.4	0	0	0	113.3	P20 P24	P20-D22 WeakPolarHBondContact CB-OD1 3.49Å; P20-D22 PolarHBondContact O-N 2.85Å; D22-P24 WeakPolarHBondContact O-CD 3.31Å
23	D	91.9	Very high	87.6	Confident	64 Å²	64	92.7 Å²	92.7	34%	0.342	53%	0.534	S	S	.	.			trans	-66.2	116.5	173.7	172.9	-138.8	0	0	0	110.8	P20 G25 A26 N27	P20-D23 HydrophobicContact CB-CB 4.45Å; P20-D23 HydrophobicContact CG-CB 4.01Å; P20-D23 PolarHBondContact O-N 3.07Å; P20-D23 VanDerWaalsContact O-N 3.09Å; D23-G25 PolarHBondContact O-N 3.18Å; D23-G25 PolarHBondContact OD2-N 3.21Å; D23-A26 HydrophobicContact CB-CB 3.99Å; D23-A26 PolarHBondContact O-N 3.4Å; D23-A26 WeakPolarHBondContact OD1-CB 3.44Å; D23-A26 PolarHBondContact OD1-N 3.14Å; D23-N27 WeakPolarHBondContact O-CB 3.27Å; D23-N27 PolarHBondContact O-N 3.3Å; D23-N27 PolarHBondContact O-ND2 3.33Å
24	P	92.3	Very high	88.5	Confident	101 Å²	101	93.9 Å²	93.9	66%	0.656	54%	0.536	S	S	*	.	H	α-helix	trans	-61.1	-29.5	177.5	24.8	-34.4	0	0	0	112.5	D22 A28	D22-P24 WeakPolarHBondContact O-CD 3.31Å; P24-A28 WeakPolarHBondContact O-CB 3.48Å; P24-A28 PolarHBondContact O-N 3.48Å
25	G	93.8	Very high	89.5	Confident	42 Å²	42	91 Å²	91	43%	0.433	53%	0.53	S	S	.	.	H	α-helix	trans	-66	-54.2	177.2	0	0	0	0	0	112.2	D23 N27 A28 A29	D23-G25 PolarHBondContact O-N 3.18Å; D23-G25 PolarHBondContact OD2-N 3.21Å; G25-N27 VanDerWaalsContact C-N 3.34Å; G25-N27 PolarHBondContact O-N 3.39Å; G25-A28 PolarHBondContact O-N 3.45Å; G25-A29 PolarHBondContact O-N 3.43Å
26	A	91.2	Very high	90.4	Very high	22 Å²	22	88.4 Å²	88.4	18%	0.182	52%	0.522	C	S	.	.	H	α-helix	trans	-57.1	-45	174.8	0	0	0	0	0	112.3	I19 D23 A28 A29 A30	I19-A26 HydrophobicContact CG2-CB 3.34Å; D23-A26 HydrophobicContact CB-CB 3.99Å; D23-A26 PolarHBondContact O-N 3.4Å; D23-A26 WeakPolarHBondContact OD1-CB 3.44Å; D23-A26 PolarHBondContact OD1-N 3.14Å; A26-A28 PolarHBondContact O-N 2.97Å; A26-A29 PolarHBondContact O-N 3.21Å; A26-A30 WeakPolarHBondContact O-CB 3.5Å; A26-A30 PolarHBondContact O-N 2.97Å
27	N	92.9	Very high	91.1	Very high	79 Å²	79	90 Å²	90	42%	0.422	53%	0.525	S	S	.	.	H	α-helix	trans	-62.5	-42.7	178.7	-78.5	-33	0	0	0	112.4	L21 D23 G25 A30 A31	L21-N27 PolarHBondContact O-ND2 3.14Å; L21-N27 PolarHBondContact O-OD1 3.21Å; D23-N27 WeakPolarHBondContact O-CB 3.27Å; D23-N27 PolarHBondContact O-N 3.3Å; D23-N27 PolarHBondContact O-ND2 3.33Å; G25-N27 VanDerWaalsContact C-N 3.34Å; G25-N27 PolarHBondContact O-N 3.39Å; N27-A30 PolarHBondContact O-N 3.37Å; N27-A31 VanDerWaalsContact O-CB 3.31Å; N27-A31 WeakPolarHBondContact O-CB 3.43Å; N27-A31 PolarHBondContact O-N 3Å
28	A	95.3	Very high	91.8	Very high	64 Å²	64	94 Å²	94	53%	0.529	53%	0.533	S	S	.	.	H	α-helix	trans	-63.9	-41	175.5	0	0	0	0	0	112.1	P24 G25 A26 K32	P24-A28 WeakPolarHBondContact O-CB 3.48Å; P24-A28 PolarHBondContact O-N 3.48Å; G25-A28 PolarHBondContact O-N 3.45Å; A26-A28 PolarHBondContact O-N 2.97Å; A28-K32 WeakPolarHBondContact O-CB 3.15Å; A28-K32 PolarHBondContact O-N 2.98Å
29	A	92.8	Very high	92.3	Very high	53 Å²	53	88.9 Å²	88.9	44%	0.438	51%	0.51	S	S	.	.	H	α-helix	trans	-63.8	-48.4	176.3	0	0	0	0	0	111.7	G25 A26 A31 K32 I33	G25-A29 PolarHBondContact O-N 3.43Å; A26-A29 PolarHBondContact O-N 3.21Å; A29-A31 PolarHBondContact O-N 3.42Å; A29-K32 WeakPolarHBondContact O-CB 3.32Å; A29-K32 PolarHBondContact O-N 3.49Å; A29-I33 WeakPolarHBondContact O-CG1 3.4Å; A29-I33 PolarHBondContact O-N 3.38Å
30	A	92.3	Very high	92.7	Very high	38 Å²	38	88.1 Å²	88.1	31%	0.314	51%	0.505	S	S	.	.	H	α-helix	trans	-58.7	-46.2	176.6	0	0	0	0	0	111.5	A26 N27 K32 I33 Q34	A26-A30 WeakPolarHBondContact O-CB 3.5Å; A26-A30 PolarHBondContact O-N 2.97Å; N27-A30 PolarHBondContact O-N 3.37Å; A30-K32 VanDerWaalsContact C-N 3.31Å; A30-K32 PolarHBondContact O-N 3.29Å; A30-I33 PolarHBondContact O-N 2.87Å; A30-Q34 WeakPolarHBondContact O-CB 3.39Å; A30-Q34 VanDerWaalsContact O-CG 3.27Å; A30-Q34 WeakPolarHBondContact O-CG 3.46Å; A30-Q34 PolarHBondContact O-N 2.89Å
31	A	94.9	Very high	93	Very high	52 Å²	52	87.7 Å²	87.7	43%	0.43	50%	0.498	S	S	.	.	H	α-helix	trans	-58.9	-41.5	176.9	0	0	0	0	0	112.1	N27 A29 Q34 A35	N27-A31 VanDerWaalsContact O-CB 3.31Å; N27-A31 WeakPolarHBondContact O-CB 3.43Å; N27-A31 PolarHBondContact O-N 3Å; A29-A31 PolarHBondContact O-N 3.42Å; A31-Q34 PolarHBondContact O-N 3.11Å; A31-A35 VanDerWaalsContact O-CB 3.27Å; A31-A35 WeakPolarHBondContact O-CB 3.39Å; A31-A35 PolarHBondContact O-N 3.01Å
32	K	96	Very high	93.1	Very high	164 Å²	164	83 Å²	83	71%	0.713	48%	0.481	S	S	*	.	H	α-helix	trans	-64	-42.5	176.8	-172.9	175.1	-178	178.4	0	112.1	A28 A29 A30 S36	A28-K32 WeakPolarHBondContact O-CB 3.15Å; A28-K32 PolarHBondContact O-N 2.98Å; A29-K32 WeakPolarHBondContact O-CB 3.32Å; A29-K32 PolarHBondContact O-N 3.49Å; A30-K32 VanDerWaalsContact C-N 3.31Å; A30-K32 PolarHBondContact O-N 3.29Å; K32-S36 WeakPolarHBondContact O-CB 3.22Å; K32-S36 PolarHBondContact O-N 3.06Å
33	I	94.3	Very high	92.9	Very high	121 Å²	121	83.3 Å²	83.3	62%	0.621	47%	0.472	S	S	*	.	H	α-helix	trans	-63.6	-48.9	176.9	-66.7	165.9	0	0	0	110.2	A29 A30 A35 S36 F37	A29-I33 WeakPolarHBondContact O-CG1 3.4Å; A29-I33 PolarHBondContact O-N 3.38Å; A30-I33 PolarHBondContact O-N 2.87Å; I33-A35 PolarHBondContact O-N 3.32Å; I33-S36 PolarHBondContact O-N 3.27Å; I33-F37 WeakPolarHBondContact O-CB 3.47Å; I33-F37 PolarHBondContact O-N 2.9Å
34	Q	93.9	Very high	92.7	Very high	135 Å²	135	85.5 Å²	85.5	63%	0.631	48%	0.478	S	S	*	.	H	α-helix	trans	-60.5	-43.9	178.9	-69.8	174.8	13	0	0	112	A30 A31 F37 R38	A30-Q34 WeakPolarHBondContact O-CB 3.39Å; A30-Q34 VanDerWaalsContact O-CG 3.27Å; A30-Q34 WeakPolarHBondContact O-CG 3.46Å; A30-Q34 PolarHBondContact O-N 2.89Å; A31-Q34 PolarHBondContact O-N 3.11Å; Q34-F37 PolarHBondContact O-N 3.43Å; Q34-R38 WeakPolarHBondContact O-CB 3.03Å; Q34-R38 PolarHBondContact O-N 3.46Å
35	A	95.4	Very high	92.3	Very high	63 Å²	63	87.7 Å²	87.7	52%	0.521	48%	0.478	S	S	.	.	H	α-helix	trans	-62.4	-44.8	177.3	0	0	0	0	0	111.8	A31 I33 R38 G39	A31-A35 VanDerWaalsContact O-CB 3.27Å; A31-A35 WeakPolarHBondContact O-CB 3.39Å; A31-A35 PolarHBondContact O-N 3.01Å; I33-A35 PolarHBondContact O-N 3.32Å; A35-R38 PolarHBondContact O-N 2.83Å; A35-G39 PolarHBondContact O-N 3.19Å
36	S	94.6	Very high	91.6	Very high	77 Å²	77	92 Å²	92	54%	0.538	49%	0.49	S	S	.	.	H	α-helix	trans	-60.6	-46.1	176.5	-173.9	0	0	0	0	111.6	K32 I33 G39 H40	K32-S36 WeakPolarHBondContact O-CB 3.22Å; K32-S36 PolarHBondContact O-N 3.06Å; I33-S36 PolarHBondContact O-N 3.27Å; S36-G39 PolarHBondContact O-N 2.92Å; S36-H40 WeakPolarHBondContact O-CB 3.27Å; S36-H40 PolarHBondContact O-N 3.45Å
37	F	94.5	Very high	91	Very high	129 Å²	129	100.1 Å²	100.1	57%	0.566	52%	0.521	S	S	*	.	H	α-helix	trans	-65	-45.6	179.3	-176.4	-101.6	0	0	0	112.4	I33 Q34 G39 H40 M41	I33-F37 WeakPolarHBondContact O-CB 3.47Å; I33-F37 PolarHBondContact O-N 2.9Å; Q34-F37 PolarHBondContact O-N 3.43Å; F37-G39 VanDerWaalsContact C-N 3.29Å; F37-G39 PolarHBondContact O-N 2.9Å; F37-H40 WeakPolarHBondContact O-CB 3.35Å; F37-H40 PolarHBondContact O-N 3.01Å; F37-H40 VanDerWaalsContact O-N 3.11Å; F37-M41 HydrophobicContact CD1-CG 4.2Å; F37-M41 HydrophobicContact CD2-CE 4.07Å; F37-M41 HydrophobicContact CE1-CE 4.15Å; F37-M41 HydrophobicContact CE1-CG 3.84Å; F37-M41 HydrophobicContact CE2-CE 3.22Å; F37-M41 HydrophobicContact CE2-CG 4.37Å; F37-M41 HydrophobicContact CZ-CE 3.28Å; F37-M41 HydrophobicContact CZ-CG 3.95Å; F37-M41 HydrophobicContact CZ-SD 4.33Å; F37-M41 WeakPolarHBondContact O-CG 3.37Å; F37-M41 PolarHBondContact O-N 3.06Å
38	R	92.7	Very high	90	Very high	199 Å²	199	100.4 Å²	100.4	75%	0.751	53%	0.529	S	S	*	.	H	α-helix	trans	-58.7	-42.9	175.1	-176.8	168.8	124	100.3	-3.4	111.2	Q34 A35 M41 A42	Q34-R38 WeakPolarHBondContact O-CB 3.03Å; Q34-R38 PolarHBondContact O-N 3.46Å; A35-R38 PolarHBondContact O-N 2.83Å; R38-M41 PolarHBondContact O-N 2.9Å; R38-A42 WeakPolarHBondContact O-CB 3.34Å; R38-A42 PolarHBondContact O-N 3.36Å
39	G	94.2	Very high	88.2	Confident	22 Å²	22	99.7 Å²	99.7	23%	0.227	53%	0.527	C	S	.	.	H	α-helix	trans	-62.8	-41.7	173.8	0	0	0	0	0	112.9	A35 S36 F37 A42 R43	A35-G39 PolarHBondContact O-N 3.19Å; S36-G39 PolarHBondContact O-N 2.92Å; F37-G39 VanDerWaalsContact C-N 3.29Å; F37-G39 PolarHBondContact O-N 2.9Å; G39-A42 PolarHBondContact O-N 3.38Å; G39-R43 WeakPolarHBondContact O-CG 3.46Å; G39-R43 PolarHBondContact O-N 2.94Å
40	H	93	Very high	86.5	Confident	64 Å²	64	103.9 Å²	103.9	30%	0.296	54%	0.538	S	S	.	.	H	α-helix	trans	-61.8	-45.2	175.9	-179.2	89	0	0	0	111.7	S36 F37 R43 K44	S36-H40 WeakPolarHBondContact O-CB 3.27Å; S36-H40 PolarHBondContact O-N 3.45Å; F37-H40 WeakPolarHBondContact O-CB 3.35Å; F37-H40 PolarHBondContact O-N 3.01Å; F37-H40 VanDerWaalsContact O-N 3.11Å; H40-R43 PolarHBondContact O-N 3.02Å; H40-K44 WeakPolarHBondContact NE2-CD 3.28Å; H40-K44 PolarHBondContact O-N 3.24Å
41	M	90.1	Very high	84.3	Confident	62 Å²	62	113.6 Å²	113.6	31%	0.305	57%	0.566	S	S	.	*	H	α-helix	trans	-66.1	-39.4	178.1	-68.9	-57.4	157.5	0	0	112.5	F37 R38 K44 K45	F37-M41 HydrophobicContact CD1-CG 4.2Å; F37-M41 HydrophobicContact CD2-CE 4.07Å; F37-M41 HydrophobicContact CE1-CE 4.15Å; F37-M41 HydrophobicContact CE1-CG 3.84Å; F37-M41 HydrophobicContact CE2-CE 3.22Å; F37-M41 HydrophobicContact CE2-CG 4.37Å; F37-M41 HydrophobicContact CZ-CE 3.28Å; F37-M41 HydrophobicContact CZ-CG 3.95Å; F37-M41 HydrophobicContact CZ-SD 4.33Å; F37-M41 WeakPolarHBondContact O-CG 3.37Å; F37-M41 PolarHBondContact O-N 3.06Å; R38-M41 PolarHBondContact O-N 2.9Å; M41-K44 PolarHBondContact O-N 3.31Å; M41-K45 WeakPolarHBondContact O-CG 3.49Å; M41-K45 PolarHBondContact O-N 3.45Å
42	A	89.4	Confident	82.1	Confident	55 Å²	55	113.2 Å²	113.2	46%	0.455	57%	0.568	S	S	.	*	H	α-helix	trans	-61.2	-45.6	173.1	0	0	0	0	0	111.6	R38 G39 K44 K45 I46	R38-A42 WeakPolarHBondContact O-CB 3.34Å; R38-A42 PolarHBondContact O-N 3.36Å; G39-A42 PolarHBondContact O-N 3.38Å; A42-K44 PolarHBondContact O-N 3.07Å; A42-K45 PolarHBondContact O-N 3.25Å; A42-I46 PolarHBondContact O-N 3.02Å
43	R	86	Confident	79.9	Confident	144 Å²	144	116.8 Å²	116.8	54%	0.543	58%	0.577	S	S	.	*	H	α-helix	trans	-64.3	-37.4	176.8	-72.7	-171.3	-60.1	-90.7	1.7	112.9	G39 H40 I46 K47	G39-R43 WeakPolarHBondContact O-CG 3.46Å; G39-R43 PolarHBondContact O-N 2.94Å; H40-R43 PolarHBondContact O-N 3.02Å; R43-I46 WeakPolarHBondContact O-CG1 3.49Å; R43-K47 WeakPolarHBondContact O-CB 3.39Å; R43-K47 PolarHBondContact O-N 3.4Å
44	K	88	Confident	77.5	Confident	109 Å²	109	121.1 Å²	121.1	47%	0.474	59%	0.591	S	S	.	*	H	α-helix	trans	-63.6	-44.9	174.7	-81.4	-175.3	63.6	173.9	0	111.6	H40 M41 A42 I46 K47 S48	H40-K44 WeakPolarHBondContact NE2-CD 3.28Å; H40-K44 PolarHBondContact O-N 3.24Å; M41-K44 PolarHBondContact O-N 3.31Å; A42-K44 PolarHBondContact O-N 3.07Å; K44-I46 PolarHBondContact O-N 3Å; K44-K47 PolarHBondContact O-N 2.85Å; K44-S48 PolarHBondContact O-N 3.2Å; K44-S48 PolarHBondContact O-OG 3.02Å
45	K	83.3	Confident	75.2	Confident	148 Å²	148	117.8 Å²	117.8	64%	0.643	59%	0.593	S	S	*	*	H	α-helix	trans	-62.8	-38.6	-179.8	-71.7	177.9	-179.3	-173.4	0	113.4	M41 A42 S48	M41-K45 WeakPolarHBondContact O-CG 3.49Å; M41-K45 PolarHBondContact O-N 3.45Å; A42-K45 PolarHBondContact O-N 3.25Å; K45-S48 PolarHBondContact O-OG 3.26Å
46	I	79.9	Confident	72.7	Confident	133 Å²	133	121.5 Å²	121.5	68%	0.682	61%	0.611	S	S	*	*	H	α-helix	trans	-69.7	-36.6	175.7	64.3	173.4	0	0	0	112	A42 R43 K44 G49	A42-I46 PolarHBondContact O-N 3.02Å; R43-I46 WeakPolarHBondContact O-CG1 3.49Å; K44-I46 PolarHBondContact O-N 3Å; I46-G49 PolarHBondContact O-N 3.47Å
47	K	76.6	Confident	70.2	Confident	192 Å²	192	120.4 Å²	120.4	84%	0.835	61%	0.612	S	S	*	*	H	α-helix	trans	-73.8	-30.5	-178.2	-170	171.6	-178.1	172.3	0	111.7	R43 K44 G49	R43-K47 WeakPolarHBondContact O-CB 3.39Å; R43-K47 PolarHBondContact O-N 3.4Å; K44-K47 PolarHBondContact O-N 2.85Å; K47-G49 PolarHBondContact O-N 3.46Å
48	S	72.1	Confident	67.9	Low	85 Å²	85	120.8 Å²	120.8	59%	0.594	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.3	6.8	175.8	63.1	0	0	0	0	114.2	K44 K45 E50	K44-S48 PolarHBondContact O-N 3.2Å; K44-S48 PolarHBondContact O-OG 3.02Å; K45-S48 PolarHBondContact O-OG 3.26Å; S48-E50 PolarHBondContact O-N 2.87Å; S48-E50 VanDerWaalsContact O-N 3.14Å
49	G	57.2	Low	65.4	Low	48 Å²	48	114.9 Å²	114.9	50%	0.495	63%	0.629	S	S	.	*	T	Hydrogen-bonded Turn	trans	72.9	4.1	169.1	0	0	0	0	0	115.7	I46 K47 R51	I46-G49 PolarHBondContact O-N 3.47Å; K47-G49 PolarHBondContact O-N 3.46Å; G49-R51 PolarHBondContact O-N 3.36Å
50	E	57.8	Low	62.9	Low	141 Å²	141	116.4 Å²	116.4	66%	0.659	65%	0.645	S	S	*	*			trans	-80.6	74.6	176.6	-159.1	-175.3	139.2	0	0	110.2	S48 G52	S48-E50 PolarHBondContact O-N 2.87Å; S48-E50 VanDerWaalsContact O-N 3.14Å; E50-G52 PolarHBondContact O-N 2.82Å
51	R	46.9	Very low	60.8	Low	242 Å²	242	119.1 Å²	119.1	91%	0.913	67%	0.668	S	S	*	*			trans	-75.2	29.9	175.2	-71.6	-173.2	-66.9	-129.5	-3.7	113.7	G49	G49-R51 PolarHBondContact O-N 3.36Å
52	G	48.7	Very low	58.5	Low	45 Å²	45	119.9 Å²	119.9	46%	0.464	69%	0.692	S	S	.	*			trans	-179	99.6	179.5	0	0	0	0	0	115	E50	E50-G52 PolarHBondContact O-N 2.82Å
53	R	48.7	Very low	56.4	Low	238 Å²	238	120.6 Å²	120.6	90%	0.898	71%	0.705	S	S	*	*				-174	115.3	125.9	-96.8	160.9	-157.3	-96	5.7	110.6
54	K	44.5	Very low	54.5	Low	213 Å²	213	118.7 Å²	118.7	93%	0.926	72%	0.72	S	S	*	*			trans	-18.5	120.4	156.1	-176.4	-176.3	176	-178	0	114.6
55	G	44.7	Very low	52.6	Low	64 Å²	64	116.8 Å²	116.8	66%	0.66	73%	0.731	S	S	*	*			trans	-121.7	140	152.8	0	0	0	0	0	109	G57	G55-G57 PolarHBondContact O-N 3.09Å
56	P	43.7	Very low	50.9	Low	141 Å²	141	115.3 Å²	115.3	92%	0.916	73%	0.734	S	S	*	*			trans	-80.9	112	176.3	33.1	-27.6	0	0	0	108.3
57	G	42.5	Very low	49.6	Very low	54 Å²	54	113.8 Å²	113.8	56%	0.557	74%	0.741	S	S	*	*			trans	-146.9	147.3	168.2	0	0	0	0	0	106.7	G55 G59	G55-G57 PolarHBondContact O-N 3.09Å; G57-G59 PolarHBondContact O-N 2.78Å
58	P	46.5	Very low	48.3	Very low	137 Å²	137	115.7 Å²	115.7	89%	0.89	74%	0.743	S	S	*	*			trans	-57.1	113.8	-171.1	25.6	-31.8	0	0	0	107.3	G60	P58-G60 PolarHBondContact O-N 3.17Å
59	G	39.8	Very low	47.1	Very low	75 Å²	75	115.2 Å²	115.2	77%	0.773	75%	0.751	S	S	*	*			trans	-61.7	85.4	164.7	0	0	0	0	0	106.1	G57	G57-G59 PolarHBondContact O-N 2.78Å
60	G	41.6	Very low	47	Very low	54 Å²	54	116.6 Å²	116.6	56%	0.557	77%	0.766	S	S	*	*			trans	-53.6	127.4	156.4	0	0	0	0	0	105.3	P58 G62	P58-G60 PolarHBondContact O-N 3.17Å; G60-G62 PolarHBondContact O-N 3.32Å
61	P	49.9	Very low	46.8	Very low	122 Å²	122	115.4 Å²	115.4	79%	0.792	78%	0.78	S	S	*	*			trans	-60.4	113.1	-176.4	25.5	-31.6	0	0	0	106.6	G63	P61-G63 PolarHBondContact O-N 3.43Å
62	G	40.7	Very low	47.3	Very low	78 Å²	78	107.4 Å²	107.4	80%	0.804	77%	0.773	S	S	*	*			trans	-61.8	82.5	149.8	0	0	0	0	0	105.6	G60 A64	G60-G62 PolarHBondContact O-N 3.32Å; G62-A64 PolarHBondContact O-N 3.09Å
63	G	46.5	Very low	47.8	Very low	70 Å²	70	109 Å²	109	72%	0.722	79%	0.79	S	S	*	*			trans	-69.6	77.8	177.1	0	0	0	0	0	109.1	P61	P61-G63 PolarHBondContact O-N 3.43Å
64	A	45.7	Very low	48.7	Very low	104 Å²	104	101.1 Å²	101.1	86%	0.86	78%	0.782	S	S	*	*			trans	-68.9	117	146.6	0	0	0	0	0	106.4	G62	G62-A64 PolarHBondContact O-N 3.09Å
65	G	47.6	Very low	49.9	Very low	69 Å²	69	97.6 Å²	97.6	71%	0.711	78%	0.781	S	S	*	*			trans	152.2	93.7	172.4	0	0	0	0	0	113.1	A67	G65-A67 PolarHBondContact O-N 2.93Å
66	V	47.4	Very low	51.3	Low	117 Å²	117	100.2 Å²	100.2	71%	0.709	79%	0.789	S	S	*	*			trans	-47.5	110.8	160.1	62.4	0	0	0	0	109.4	R68	V66-R68 HydrophobicContact CG1-CG 4.14Å; V66-R68 HydrophobicContact CG2-CG 3.84Å; V66-R68 PolarHBondContact O-N 2.82Å
67	A	52.5	Low	52.7	Low	100 Å²	100	97.2 Å²	97.2	83%	0.826	78%	0.784	S	S	*	*			trans	-73.6	85.4	166.2	0	0	0	0	0	107.4	G65 G69	G65-A67 PolarHBondContact O-N 2.93Å; A67-G69 PolarHBondContact O-N 3.17Å
68	R	49.9	Very low	53.9	Low	232 Å²	232	106.4 Å²	106.4	88%	0.875	82%	0.82	S	S	*	*			trans	-73.2	85.5	160.5	-63.9	-178.7	176.7	-164.7	-2	106.3	V66	V66-R68 HydrophobicContact CG1-CG 4.14Å; V66-R68 HydrophobicContact CG2-CG 3.84Å; V66-R68 PolarHBondContact O-N 2.82Å
69	G	47.2	Very low	54.3	Low	75 Å²	75	104.9 Å²	104.9	77%	0.773	82%	0.817	S	S	*	*			trans	-124	109.6	176.5	0	0	0	0	0	109.6	A67	A67-G69 PolarHBondContact O-N 3.17Å
70	G	53.8	Low	55	Low	77 Å²	77	106.4 Å²	106.4	79%	0.794	82%	0.819	S	S	*	*			trans	161.1	49.9	174.8	0	0	0	0	0	115	G72	G70-G72 PolarHBondContact O-N 3.09Å
71	A	55.1	Low	55.8	Low	117 Å²	117	109.3 Å²	109.3	97%	0.967	83%	0.834	S	S	*	*			trans	-78.5	106.5	155.5	0	0	0	0	0	106.6
72	G	57.1	Low	56.1	Low	74 Å²	74	108.6 Å²	108.6	76%	0.763	84%	0.836	S	S	*	*			trans	-146.7	105.7	-179.7	0	0	0	0	0	111.5	G70	G70-G72 PolarHBondContact O-N 3.09Å
73	G	58.2	Low	57.1	Low	79 Å²	79	110.5 Å²	110.5	81%	0.814	84%	0.838	S	S	*	*			trans	83.4	80.5	154.1	0	0	0	0	0	117.2
74	G	67.1	Low	57.8	Low	72 Å²	72	113.2 Å²	113.2	74%	0.742	85%	0.846	S	S	*	*	P	Polyproline II helix	trans	-77.6	141.2	151.6	0	0	0	0	0	109.7	S76	G74-S76 PolarHBondContact O-N 3.07Å
75	P	70	Confident	58.7	Low	139 Å²	139	113.9 Å²	113.9	90%	0.903	85%	0.845	S	S	*	*	P	Polyproline II helix	trans	-73.2	123.4	172.3	30.1	-31.4	0	0	0	109.2
76	S	74.5	Confident	59.5	Low	118 Å²	118	117.3 Å²	117.3	83%	0.825	86%	0.855	S	S	*	*	P	Polyproline II helix	trans	-98.4	140.1	164.6	53.5	0	0	0	0	108.8	G74	G74-S76 PolarHBondContact O-N 3.07Å
77	G	73.6	Confident	60.5	Low	78 Å²	78	117.3 Å²	117.3	80%	0.804	87%	0.867	S	S	*	*	P	Polyproline II helix	trans	-53.4	169.6	-170.2	0	0	0	0	0	116.3
78	D	67.3	Low	61.3	Low	247 Å²	247	118.9 Å²	118.9	100%	1.321	87%	0.871	S	S	*	*			cis	-132	0	38.2	-136.9	-103.8	0	0	0	111.7

Retrieved 78 of 78 residues in 34.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).