A0A096MSH8_PAPAN Loading...

Coiled-coil domain containing 126

AlphaFold DB (A0A6D2Y3E1), UniProt , Accession A0A096MSH8, Species PAPAN (Papio anubis, Olive baboon), Gene CCDC126, Length 140 aa.

						>A0A096MSH8_PAPAN|A0A096MSH8|CCDC126
MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSATNTTNGTSGNLVPVTTNKRTNVSGSIR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.7	Very low	52.8	Low	205 Å²	205	135.4 Å²	135.4	100%	1.01	67%	0.665	S	S	*	*				0	65.1	0	-172.3	175.1	172.1	0	0	109.6
2	F	41.8	Very low	54.7	Low	180 Å²	180	132.8 Å²	132.8	79%	0.789	65%	0.65	S	S	*	*			trans	-128.2	-8.8	-172.8	-65	-73.6	0	0	0	114.2	T4	F2-T4 VanDerWaalsContact C-N 3.34Å; F2-T4 PolarHBondContact O-N 3.14Å
3	F	46.7	Very low	56.6	Low	191 Å²	191	133.7 Å²	133.7	84%	0.838	65%	0.648	S	S	*	*	H	α-helix	trans	-80.7	-11.8	-177.1	-126.7	-92.5	0	0	0	114.1
4	T	47	Very low	58.6	Low	97 Å²	97	131.6 Å²	131.6	60%	0.595	64%	0.641	S	S	*	*	H	α-helix	trans	-84	-23	179.1	55.4	0	0	0	0	113	F2 K8	F2-T4 VanDerWaalsContact C-N 3.34Å; F2-T4 PolarHBondContact O-N 3.14Å; T4-K8 WeakPolarHBondContact O-CB 3.27Å; T4-K8 PolarHBondContact O-N 3.46Å; T4-K8 VanDerWaalsContact O-N 3.09Å
5	I	51.4	Low	60.3	Low	103 Å²	103	127.6 Å²	127.6	53%	0.528	63%	0.632	S	S	.	*	H	α-helix	trans	-77	-40.7	-179.3	-72.3	150.1	0	0	0	111	K8 N9	I5-K8 WeakPolarHBondContact O-CB 2.91Å; I5-K8 PolarHBondContact O-N 2.86Å; I5-N9 PolarHBondContact O-N 2.75Å; I5-N9 PolarHBondContact O-ND2 3.24Å; I5-N9 VanDerWaalsContact O-ND2 3.14Å
6	S	44.9	Very low	61.8	Low	79 Å²	79	126.1 Å²	126.1	55%	0.552	63%	0.626	S	S	*	*	H	α-helix	trans	-69.6	-39.3	175.9	-165.2	0	0	0	0	112.4	K8 N9 M10	S6-K8 PolarHBondContact O-N 3.42Å; S6-N9 PolarHBondContact O-N 3.19Å; S6-M10 PolarHBondContact O-N 3.35Å
7	R	50.8	Low	63.4	Low	198 Å²	198	125.4 Å²	125.4	75%	0.747	62%	0.624	S	S	*	*	H	α-helix	trans	-61.3	-34.7	171.4	-169	177	-177.7	-161.2	0.6	111.7	M10 S11	R7-M10 PolarHBondContact O-N 3.24Å; R7-S11 WeakPolarHBondContact O-CB 3.2Å; R7-S11 PolarHBondContact O-N 3.46Å
8	K	56.8	Low	64.8	Low	137 Å²	137	124.4 Å²	124.4	60%	0.596	62%	0.621	S	S	*	*	H	α-helix	trans	-63.7	-41.9	176.1	-151	167.3	77.4	167.7	0	111.1	T4 I5 S6 Q12	T4-K8 WeakPolarHBondContact O-CB 3.27Å; T4-K8 PolarHBondContact O-N 3.46Å; T4-K8 VanDerWaalsContact O-N 3.09Å; I5-K8 WeakPolarHBondContact O-CB 2.91Å; I5-K8 PolarHBondContact O-N 2.86Å; S6-K8 PolarHBondContact O-N 3.42Å; K8-Q12 WeakPolarHBondContact O-CA 3.41Å; K8-Q12 WeakPolarHBondContact O-CB 3.39Å; K8-Q12 PolarHBondContact O-N 3.18Å
9	N	67.3	Low	66.1	Low	84 Å²	84	123.9 Å²	123.9	45%	0.449	62%	0.62	S	S	.	*	H	α-helix	trans	-64.7	-41.9	176.8	-59.1	-45	0	0	0	112.7	I5 S6 K13	I5-N9 PolarHBondContact O-N 2.75Å; I5-N9 PolarHBondContact O-ND2 3.24Å; I5-N9 VanDerWaalsContact O-ND2 3.14Å; S6-N9 PolarHBondContact O-N 3.19Å; N9-K13 VanDerWaalsContact O-CB 3.27Å; N9-K13 WeakPolarHBondContact O-CB 3.17Å; N9-K13 WeakPolarHBondContact O-CG 3.07Å; N9-K13 PolarHBondContact O-N 2.85Å
10	M	60.9	Low	67.3	Low	143 Å²	143	121.2 Å²	121.2	70%	0.704	61%	0.61	S	S	*	*	H	α-helix	trans	-72.9	-41.5	179.7	-130.9	63.5	137.5	0	0	112.1	S6 R7 K13 L14	S6-M10 PolarHBondContact O-N 3.35Å; R7-M10 PolarHBondContact O-N 3.24Å; M10-K13 PolarHBondContact O-N 2.84Å; M10-L14 VanDerWaalsContact O-CB 3.25Å; M10-L14 WeakPolarHBondContact O-CB 3.43Å; M10-L14 PolarHBondContact O-N 3.09Å
11	S	68.9	Low	68.4	Low	72 Å²	72	121.2 Å²	121.2	50%	0.503	61%	0.607	S	S	.	*	H	α-helix	trans	-68.2	-34.5	174.1	-173.3	0	0	0	0	112.2	R7 S15	R7-S11 WeakPolarHBondContact O-CB 3.2Å; R7-S11 PolarHBondContact O-N 3.46Å; S11-S15 WeakPolarHBondContact O-CB 3.31Å; S11-S15 PolarHBondContact O-N 3Å
12	Q	76	Confident	70.6	Confident	104 Å²	104	113.5 Å²	113.5	49%	0.486	58%	0.579	S	S	.	*	H	α-helix	trans	-72.3	-40.6	176.1	-176.8	176.2	-28.8	0	0	110.3	K8 S15 L16	K8-Q12 WeakPolarHBondContact O-CA 3.41Å; K8-Q12 WeakPolarHBondContact O-CB 3.39Å; K8-Q12 PolarHBondContact O-N 3.18Å; Q12-S15 PolarHBondContact O-N 3.33Å; Q12-L16 WeakPolarHBondContact O-CB 3.29Å; Q12-L16 PolarHBondContact O-N 3.38Å
13	K	79.3	Confident	72.9	Confident	145 Å²	145	109.6 Å²	109.6	63%	0.63	57%	0.566	S	S	*	*	H	α-helix	trans	-64.5	-40.2	171.7	-77.5	-173.4	175.4	-163.9	0	112.2	N9 M10 L16 L17	N9-K13 VanDerWaalsContact O-CB 3.27Å; N9-K13 WeakPolarHBondContact O-CB 3.17Å; N9-K13 WeakPolarHBondContact O-CG 3.07Å; N9-K13 PolarHBondContact O-N 2.85Å; M10-K13 PolarHBondContact O-N 2.84Å; K13-L16 PolarHBondContact O-N 3.47Å; K13-L17 VanDerWaalsContact O-CB 3.29Å; K13-L17 WeakPolarHBondContact O-CB 3.25Å; K13-L17 PolarHBondContact O-N 3.32Å
14	L	85.4	Confident	74.8	Confident	104 Å²	104	104.8 Å²	104.8	55%	0.545	55%	0.548	S	S	.	.	H	α-helix	trans	-67.3	-40.9	175.5	-168.8	69.5	0	0	0	111.3	M10 L17 L18	M10-L14 VanDerWaalsContact O-CB 3.25Å; M10-L14 WeakPolarHBondContact O-CB 3.43Å; M10-L14 PolarHBondContact O-N 3.09Å; L14-L17 WeakPolarHBondContact O-CB 3.11Å; L14-L17 PolarHBondContact O-N 3.4Å; L14-L18 HydrophobicContact CG-CD1 4.06Å; L14-L18 WeakPolarHBondContact O-CB 3.23Å; L14-L18 WeakPolarHBondContact O-CD1 3.36Å; L14-L18 VanDerWaalsContact O-CG 3.27Å; L14-L18 WeakPolarHBondContact O-CG 3.4Å; L14-L18 PolarHBondContact O-N 2.81Å
15	S	83.1	Confident	76.7	Confident	72 Å²	72	107.1 Å²	107.1	50%	0.503	55%	0.546	S	S	.	.	H	α-helix	trans	-64.7	-42.6	174.4	-178.2	0	0	0	0	111.8	S11 Q12 L18 L19	S11-S15 WeakPolarHBondContact O-CB 3.31Å; S11-S15 PolarHBondContact O-N 3Å; Q12-S15 PolarHBondContact O-N 3.33Å; S15-L18 PolarHBondContact O-N 2.83Å; S15-L19 VanDerWaalsContact O-CB 3.31Å; S15-L19 WeakPolarHBondContact O-CB 3.17Å; S15-L19 PolarHBondContact O-N 2.92Å
16	L	84.8	Confident	78.5	Confident	103 Å²	103	104 Å²	104	54%	0.539	54%	0.539	S	S	.	.	H	α-helix	trans	-63.5	-42.1	173.1	-122.9	122	0	0	0	111.4	Q12 K13 L19 V20	Q12-L16 WeakPolarHBondContact O-CB 3.29Å; Q12-L16 PolarHBondContact O-N 3.38Å; K13-L16 PolarHBondContact O-N 3.47Å; L16-L19 PolarHBondContact O-N 2.82Å; L16-V20 WeakPolarHBondContact O-CB 3.43Å; L16-V20 VanDerWaalsContact O-CG2 3.23Å; L16-V20 WeakPolarHBondContact O-CG2 3.27Å; L16-V20 PolarHBondContact O-N 2.81Å
17	L	89.1	Confident	80.4	Confident	114 Å²	114	105 Å²	105	60%	0.597	54%	0.538	S	S	*	.	H	α-helix	trans	-61.4	-44.1	174.7	-97.7	163.9	0	0	0	111.5	K13 L14 V20 F21	K13-L17 VanDerWaalsContact O-CB 3.29Å; K13-L17 WeakPolarHBondContact O-CB 3.25Å; K13-L17 PolarHBondContact O-N 3.32Å; L14-L17 WeakPolarHBondContact O-CB 3.11Å; L14-L17 PolarHBondContact O-N 3.4Å; L17-V20 PolarHBondContact O-N 2.97Å; L17-F21 WeakPolarHBondContact O-CB 3.49Å; L17-F21 PolarHBondContact O-N 3.19Å
18	L	87.9	Confident	81.8	Confident	109 Å²	109	101.3 Å²	101.3	57%	0.571	53%	0.531	S	S	*	.	H	α-helix	trans	-66.8	-39.5	177.4	-78.6	160.5	0	0	0	111.8	L14 S15 G22	L14-L18 HydrophobicContact CG-CD1 4.06Å; L14-L18 WeakPolarHBondContact O-CB 3.23Å; L14-L18 WeakPolarHBondContact O-CD1 3.36Å; L14-L18 VanDerWaalsContact O-CG 3.27Å; L14-L18 WeakPolarHBondContact O-CG 3.4Å; L14-L18 PolarHBondContact O-N 2.81Å; S15-L18 PolarHBondContact O-N 2.83Å; L18-G22 PolarHBondContact O-N 3.05Å
19	L	90.5	Very high	83.1	Confident	114 Å²	114	100.2 Å²	100.2	60%	0.597	53%	0.531	S	S	*	.	H	α-helix	trans	-63.5	-46.9	175.8	-168.3	87.4	0	0	0	110.7	S15 L16 G22 L23	S15-L19 VanDerWaalsContact O-CB 3.31Å; S15-L19 WeakPolarHBondContact O-CB 3.17Å; S15-L19 PolarHBondContact O-N 2.92Å; L16-L19 PolarHBondContact O-N 2.82Å; L19-G22 PolarHBondContact O-N 2.8Å; L19-L23 WeakPolarHBondContact O-CB 3.04Å; L19-L23 PolarHBondContact O-N 2.82Å
20	V	89	Confident	83.6	Confident	70 Å²	70	100.5 Å²	100.5	42%	0.424	53%	0.532	S	S	.	.	H	α-helix	trans	-66.7	-45.3	178.2	171.3	0	0	0	0	110.6	L16 L17 G22 L23 I24	L16-V20 WeakPolarHBondContact O-CB 3.43Å; L16-V20 VanDerWaalsContact O-CG2 3.23Å; L16-V20 WeakPolarHBondContact O-CG2 3.27Å; L16-V20 PolarHBondContact O-N 2.81Å; L17-V20 PolarHBondContact O-N 2.97Å; V20-G22 PolarHBondContact O-N 3.28Å; V20-L23 CarbonylContact O-C 3.5Å; V20-L23 WeakPolarHBondContact O-CB 3.47Å; V20-L23 PolarHBondContact O-N 2.81Å; V20-L23 VanDerWaalsContact O-N 3.17Å; V20-I24 HydrophobicContact CG1-CD1 3.66Å; V20-I24 WeakPolarHBondContact O-CD1 3.18Å; V20-I24 PolarHBondContact O-N 3.17Å
21	F	91.6	Very high	83.9	Confident	122 Å²	122	98.6 Å²	98.6	54%	0.535	52%	0.521	S	S	.	.	H	α-helix	trans	-63.2	-42.5	177.6	-170.6	-99.6	0	0	0	111.3	L17 L23 I24 W25	L17-F21 WeakPolarHBondContact O-CB 3.49Å; L17-F21 PolarHBondContact O-N 3.19Å; F21-L23 VanDerWaalsContact C-N 3.32Å; F21-L23 PolarHBondContact O-N 3.29Å; F21-I24 PolarHBondContact O-N 3.46Å; F21-W25 AromaticContact CD1-CD1 3.48Å; F21-W25 VanDerWaalsContact CD1-CD1 3.48Å; F21-W25 HydrophobicContact CD1-CG 4.39Å; F21-W25 AromaticContact CD1-NE1 3.83Å; F21-W25 AromaticContact CD2-CD1 3.92Å; F21-W25 AromaticContact CD2-NE1 3.96Å; F21-W25 AromaticContact CE1-CD1 3.29Å; F21-W25 AromaticContact CE1-CE2 4Å; F21-W25 HydrophobicContact CE1-CG 4.19Å; F21-W25 AromaticContact CE1-NE1 3.15Å; F21-W25 AromaticContact CE2-CD1 3.75Å; F21-W25 AromaticContact CE2-NE1 3.31Å; F21-W25 VanDerWaalsContact CE2-NE1 3.31Å; F21-W25 AromaticContact CG-CD1 3.82Å; F21-W25 AromaticContact CZ-CD1 3.47Å; F21-W25 VanDerWaalsContact CZ-CD1 3.47Å; F21-W25 AromaticContact CZ-CE2 3.81Å; F21-W25 HydrophobicContact CZ-CZ2 4.39Å; F21-W25 AromaticContact CZ-NE1 2.88Å; F21-W25 WeakPolarHBondContact O-CB 3.33Å; F21-W25 VanDerWaalsContact O-CD1 3.24Å; F21-W25 PolarHBondContact O-N 3.48Å
22	G	89.3	Confident	83.4	Confident	42 Å²	42	103.3 Å²	103.3	43%	0.433	53%	0.529	S	S	.	.	H	α-helix	trans	-63.6	-35.8	173.5	0	0	0	0	0	112.7	L18 L19 V20 G26	L18-G22 PolarHBondContact O-N 3.05Å; L19-G22 PolarHBondContact O-N 2.8Å; V20-G22 PolarHBondContact O-N 3.28Å; G22-G26 WeakPolarHBondContact O-CA 3.41Å; G22-G26 PolarHBondContact O-N 2.93Å
23	L	89.3	Confident	82.9	Confident	98 Å²	98	102 Å²	102	51%	0.513	53%	0.528	S	S	.	.	H	α-helix	trans	-67.3	-44.7	172.1	-102.5	153.8	0	0	0	112.1	L19 V20 F21 G26 L27	L19-L23 WeakPolarHBondContact O-CB 3.04Å; L19-L23 PolarHBondContact O-N 2.82Å; V20-L23 CarbonylContact O-C 3.5Å; V20-L23 WeakPolarHBondContact O-CB 3.47Å; V20-L23 PolarHBondContact O-N 2.81Å; V20-L23 VanDerWaalsContact O-N 3.17Å; F21-L23 VanDerWaalsContact C-N 3.32Å; F21-L23 PolarHBondContact O-N 3.29Å; L23-G26 PolarHBondContact O-N 3.46Å; L23-L27 HydrophobicContact CD2-CD1 4.21Å; L23-L27 WeakPolarHBondContact O-CB 3.49Å; L23-L27 WeakPolarHBondContact O-CD1 3.35Å; L23-L27 WeakPolarHBondContact O-CG 3.34Å; L23-L27 PolarHBondContact O-N 2.77Å
24	I	88.6	Confident	81.7	Confident	90 Å²	90	102.8 Å²	102.8	46%	0.462	53%	0.532	S	S	.	.	H	α-helix	trans	-63.9	-45.3	176.3	-88.3	75.2	0	0	0	110.1	V20 F21 M28	V20-I24 HydrophobicContact CG1-CD1 3.66Å; V20-I24 WeakPolarHBondContact O-CD1 3.18Å; V20-I24 PolarHBondContact O-N 3.17Å; F21-I24 PolarHBondContact O-N 3.46Å; I24-M28 WeakPolarHBondContact O-CA 3.36Å; I24-M28 WeakPolarHBondContact O-CB 3.12Å; I24-M28 PolarHBondContact O-N 2.89Å
25	W	85.6	Confident	80	Confident	146 Å²	146	102.1 Å²	102.1	55%	0.553	53%	0.526	S	S	*	.	H	α-helix	trans	-68	-40.4	177.9	-88.2	83.3	0	0	0	112.2	F21 M28 L29	F21-W25 AromaticContact CD1-CD1 3.48Å; F21-W25 VanDerWaalsContact CD1-CD1 3.48Å; F21-W25 HydrophobicContact CD1-CG 4.39Å; F21-W25 AromaticContact CD1-NE1 3.83Å; F21-W25 AromaticContact CD2-CD1 3.92Å; F21-W25 AromaticContact CD2-NE1 3.96Å; F21-W25 AromaticContact CE1-CD1 3.29Å; F21-W25 AromaticContact CE1-CE2 4Å; F21-W25 HydrophobicContact CE1-CG 4.19Å; F21-W25 AromaticContact CE1-NE1 3.15Å; F21-W25 AromaticContact CE2-CD1 3.75Å; F21-W25 AromaticContact CE2-NE1 3.31Å; F21-W25 VanDerWaalsContact CE2-NE1 3.31Å; F21-W25 AromaticContact CG-CD1 3.82Å; F21-W25 AromaticContact CZ-CD1 3.47Å; F21-W25 VanDerWaalsContact CZ-CD1 3.47Å; F21-W25 AromaticContact CZ-CE2 3.81Å; F21-W25 HydrophobicContact CZ-CZ2 4.39Å; F21-W25 AromaticContact CZ-NE1 2.88Å; F21-W25 WeakPolarHBondContact O-CB 3.33Å; F21-W25 VanDerWaalsContact O-CD1 3.24Å; F21-W25 PolarHBondContact O-N 3.48Å; W25-M28 PolarHBondContact O-N 3.49Å; W25-L29 WeakPolarHBondContact O-CB 2.9Å; W25-L29 PolarHBondContact O-N 2.96Å
26	G	89.6	Confident	78.1	Confident	37 Å²	37	105.3 Å²	105.3	38%	0.381	53%	0.533	S	S	.	.	H	α-helix	trans	-64.6	-45.5	175.4	0	0	0	0	0	111.6	G22 L23 L30	G22-G26 WeakPolarHBondContact O-CA 3.41Å; G22-G26 PolarHBondContact O-N 2.93Å; L23-G26 PolarHBondContact O-N 3.46Å; G26-L30 WeakPolarHBondContact O-CA 3.37Å; G26-L30 WeakPolarHBondContact O-CB 3.06Å; G26-L30 PolarHBondContact O-N 2.8Å
27	L	84.5	Confident	76.3	Confident	102 Å²	102	105.5 Å²	105.5	53%	0.534	54%	0.54	S	S	.	.	H	α-helix	trans	-65.5	-39.7	173	-81.6	159.2	0	0	0	111.3	L23 L30 H31	L23-L27 HydrophobicContact CD2-CD1 4.21Å; L23-L27 WeakPolarHBondContact O-CB 3.49Å; L23-L27 WeakPolarHBondContact O-CD1 3.35Å; L23-L27 WeakPolarHBondContact O-CG 3.34Å; L23-L27 PolarHBondContact O-N 2.77Å; L27-L30 PolarHBondContact O-N 3.47Å; L27-H31 WeakPolarHBondContact O-CA 3Å; L27-H31 WeakPolarHBondContact O-CB 3.21Å; L27-H31 PolarHBondContact O-N 2.8Å
28	M	81	Confident	74	Confident	119 Å²	119	110.5 Å²	110.5	59%	0.586	55%	0.551	S	S	*	*	H	α-helix	trans	-68.9	-38.8	179.4	-172	152.7	132	0	0	111.3	I24 W25 Y32	I24-M28 WeakPolarHBondContact O-CA 3.36Å; I24-M28 WeakPolarHBondContact O-CB 3.12Å; I24-M28 PolarHBondContact O-N 2.89Å; W25-M28 PolarHBondContact O-N 3.49Å; M28-Y32 WeakPolarHBondContact O-CB 3.45Å; M28-Y32 PolarHBondContact O-N 3.34Å
29	L	82.4	Confident	71.9	Confident	115 Å²	115	112 Å²	112	60%	0.602	56%	0.555	S	S	*	*	H	α-helix	trans	-73	-38.4	174.1	-168.7	69.4	0	0	0	112	W25 Y32 T33	W25-L29 WeakPolarHBondContact O-CB 2.9Å; W25-L29 PolarHBondContact O-N 2.96Å; L29-Y32 PolarHBondContact O-N 3.35Å; L29-T33 WeakPolarHBondContact O-CB 3.42Å; L29-T33 PolarHBondContact O-N 3.34Å; L29-T33 PolarHBondContact O-OG1 2.97Å; L29-T33 VanDerWaalsContact O-OG1 3.13Å
30	L	79.4	Confident	69.4	Low	89 Å²	89	114.7 Å²	114.7	47%	0.466	56%	0.564	S	S	.	*	H	α-helix	trans	-67.5	-42.9	174.3	-176	66.3	0	0	0	110.7	G26 L27 Y32 T33 F34	G26-L30 WeakPolarHBondContact O-CA 3.37Å; G26-L30 WeakPolarHBondContact O-CB 3.06Å; G26-L30 PolarHBondContact O-N 2.8Å; L27-L30 PolarHBondContact O-N 3.47Å; L30-Y32 VanDerWaalsContact C-N 3.3Å; L30-Y32 PolarHBondContact O-N 2.75Å; L30-T33 PolarHBondContact O-N 2.8Å; L30-F34 HydrophobicContact CD1-CD2 3.81Å; L30-F34 HydrophobicContact CD1-CE2 3.8Å; L30-F34 HydrophobicContact CG-CD2 3.99Å; L30-F34 HydrophobicContact CG-CE2 4.28Å; L30-F34 WeakPolarHBondContact O-CB 2.86Å; L30-F34 WeakPolarHBondContact O-CD2 3.37Å; L30-F34 PolarHBondContact O-N 3.47Å
31	H	67	Low	67.2	Low	104 Å²	104	114.9 Å²	114.9	48%	0.481	57%	0.569	S	S	.	*	H	α-helix	trans	-62.2	-40.2	173.6	-178.8	-98.3	0	0	0	110	L27 F34 Q35	L27-H31 WeakPolarHBondContact O-CA 3Å; L27-H31 WeakPolarHBondContact O-CB 3.21Å; L27-H31 PolarHBondContact O-N 2.8Å; H31-F34 CarbonylContact O-C 3.24Å; H31-F34 PolarHBondContact O-N 2.97Å; H31-Q35 PolarHBondContact CD2-NE2 3.25Å; H31-Q35 PolarHBondContact CE1-NE2 2.87Å; H31-Q35 PolarHBondContact CE1-OE1 3.35Å; H31-Q35 VanDerWaalsContact ND1-CD 3.29Å; H31-Q35 PolarHBondContact ND1-NE2 3.05Å; H31-Q35 PolarHBondContact ND1-OE1 3.03Å; H31-Q35 PolarHBondContact NE2-NE2 3.39Å; H31-Q35 WeakPolarHBondContact O-CA 3.2Å; H31-Q35 WeakPolarHBondContact O-CB 3.5Å; H31-Q35 WeakPolarHBondContact O-CG 3.39Å; H31-Q35 PolarHBondContact O-N 3.42Å; H31-Q35 PolarHBondContact O-NE2 3.14Å
32	Y	58.5	Low	64.9	Low	171 Å²	171	111.2 Å²	111.2	67%	0.671	56%	0.559	S	S	*	*	H	α-helix	trans	-67.6	-40.1	174.2	-173.3	-101.3	0	0	0	112.7	M28 L29 L30 Q35 Q36	M28-Y32 WeakPolarHBondContact O-CB 3.45Å; M28-Y32 PolarHBondContact O-N 3.34Å; L29-Y32 PolarHBondContact O-N 3.35Å; L30-Y32 VanDerWaalsContact C-N 3.3Å; L30-Y32 PolarHBondContact O-N 2.75Å; Y32-Q35 CarbonylContact O-C 3.6Å; Y32-Q35 VanDerWaalsContact O-C 3.24Å; Y32-Q35 WeakPolarHBondContact O-CA 3.03Å; Y32-Q35 PolarHBondContact O-N 3.48Å; Y32-Q35 VanDerWaalsContact O-N 3.16Å; Y32-Q36 PolarHBondContact O-N 3.43Å; Y32-Q36 VanDerWaalsContact O-N 3.09Å
33	T	64.9	Low	62.8	Low	76 Å²	76	114.5 Å²	114.5	47%	0.466	57%	0.57	S	S	.	*	H	α-helix	trans	-66.2	-42.6	173.1	-71.4	0	0	0	0	111.6	L29 L30 Q35 Q36	L29-T33 WeakPolarHBondContact O-CB 3.42Å; L29-T33 PolarHBondContact O-N 3.34Å; L29-T33 PolarHBondContact O-OG1 2.97Å; L29-T33 VanDerWaalsContact O-OG1 3.13Å; L30-T33 PolarHBondContact O-N 2.8Å; T33-Q35 PolarHBondContact O-N 2.91Å; T33-Q36 PolarHBondContact O-N 2.99Å
34	F	54.6	Low	60.4	Low	161 Å²	161	118.5 Å²	118.5	71%	0.706	58%	0.583	S	S	*	*	H	α-helix	trans	-72.1	-15.7	171.9	-91.1	-89.2	0	0	0	112.9	L30 H31	L30-F34 HydrophobicContact CD1-CD2 3.81Å; L30-F34 HydrophobicContact CD1-CE2 3.8Å; L30-F34 HydrophobicContact CG-CD2 3.99Å; L30-F34 HydrophobicContact CG-CE2 4.28Å; L30-F34 WeakPolarHBondContact O-CB 2.86Å; L30-F34 WeakPolarHBondContact O-CD2 3.37Å; L30-F34 PolarHBondContact O-N 3.47Å; H31-F34 CarbonylContact O-C 3.24Å; H31-F34 PolarHBondContact O-N 2.97Å
35	Q	49.4	Very low	58.3	Low	90 Å²	90	118.5 Å²	118.5	42%	0.421	58%	0.584	S	S	.	*	T	Hydrogen-bonded Turn	trans	-100.9	18.1	173	-83.6	154.4	50.2	0	0	114.5	H31 Y32 T33	H31-Q35 PolarHBondContact CD2-NE2 3.25Å; H31-Q35 PolarHBondContact CE1-NE2 2.87Å; H31-Q35 PolarHBondContact CE1-OE1 3.35Å; H31-Q35 VanDerWaalsContact ND1-CD 3.29Å; H31-Q35 PolarHBondContact ND1-NE2 3.05Å; H31-Q35 PolarHBondContact ND1-OE1 3.03Å; H31-Q35 PolarHBondContact NE2-NE2 3.39Å; H31-Q35 WeakPolarHBondContact O-CA 3.2Å; H31-Q35 WeakPolarHBondContact O-CB 3.5Å; H31-Q35 WeakPolarHBondContact O-CG 3.39Å; H31-Q35 PolarHBondContact O-N 3.42Å; H31-Q35 PolarHBondContact O-NE2 3.14Å; Y32-Q35 CarbonylContact O-C 3.6Å; Y32-Q35 VanDerWaalsContact O-C 3.24Å; Y32-Q35 WeakPolarHBondContact O-CA 3.03Å; Y32-Q35 PolarHBondContact O-N 3.48Å; Y32-Q35 VanDerWaalsContact O-N 3.16Å; T33-Q35 PolarHBondContact O-N 2.91Å
36	Q	42.4	Very low	56.4	Low	139 Å²	139	119.1 Å²	119.1	65%	0.65	59%	0.586	S	S	*	*	S	Bend	trans	-54	135.9	144.6	-74.2	174.4	-8.2	0	0	108.2	Y32 T33 R38	Y32-Q36 PolarHBondContact O-N 3.43Å; Y32-Q36 VanDerWaalsContact O-N 3.09Å; T33-Q36 PolarHBondContact O-N 2.99Å; Q36-R38 PolarHBondContact O-N 2.69Å
37	P	47.1	Very low	54.2	Low	107 Å²	107	124.8 Å²	124.8	70%	0.695	60%	0.602	S	S	*	*	S	Bend		-71.3	82.7	-126.9	31.4	-37.9	0	0	0	113.4	H39	P37-H39 VanDerWaalsContact C-N 3.32Å; P37-H39 PolarHBondContact O-N 2.78Å
38	R	41.4	Very low	52.2	Low	220 Å²	220	126.8 Å²	126.8	83%	0.83	61%	0.609	S	S	*	*			trans	-95.6	71.9	158.6	-88.2	-74.2	178.3	102.5	-3.5	108.8	Q36 Q40	Q36-R38 PolarHBondContact O-N 2.69Å; R38-Q40 PolarHBondContact O-N 3.46Å
39	H	43.6	Very low	50.8	Low	140 Å²	140	126.1 Å²	126.1	65%	0.648	61%	0.607	S	S	*	*			trans	-27.9	115.7	176.2	-75.2	-25.6	0	0	0	114.9	P37 S41 S42	P37-H39 VanDerWaalsContact C-N 3.32Å; P37-H39 PolarHBondContact O-N 2.78Å; H39-S41 PolarHBondContact O-N 2.75Å; H39-S42 WeakPolarHBondContact O-CB 3.25Å; H39-S42 PolarHBondContact O-N 3.05Å; H39-S42 VanDerWaalsContact O-N 3.14Å
40	Q	38.8	Very low	49.4	Very low	170 Å²	170	126.3 Å²	126.3	79%	0.794	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.2	0.2	161.5	-68.7	-156.1	-17.1	0	0	114.1	R38 S42	R38-Q40 PolarHBondContact O-N 3.46Å; Q40-S42 PolarHBondContact O-N 2.84Å
41	S	42.2	Very low	47.9	Very low	74 Å²	74	126.9 Å²	126.9	52%	0.517	61%	0.611	S	S	.	*	T	Hydrogen-bonded Turn	trans	-64.2	-15.2	164.7	-173.6	0	0	0	0	112.7	H39 L45	H39-S41 PolarHBondContact O-N 2.75Å; S41-L45 VanDerWaalsContact O-CD1 3.25Å; S41-L45 WeakPolarHBondContact O-CD1 3.12Å
42	S	43.6	Very low	47	Very low	46 Å²	46	127.6 Å²	127.6	32%	0.322	62%	0.618	S	S	.	*	H	α-helix	trans	-78	-21.6	-169.6	-148.6	0	0	0	0	115.2	H39 Q40 R46	H39-S42 WeakPolarHBondContact O-CB 3.25Å; H39-S42 PolarHBondContact O-N 3.05Å; H39-S42 VanDerWaalsContact O-N 3.14Å; Q40-S42 PolarHBondContact O-N 2.84Å; S42-R46 WeakPolarHBondContact O-CB 3.46Å; S42-R46 WeakPolarHBondContact O-CD 3.27Å; S42-R46 WeakPolarHBondContact O-CG 3.22Å; S42-R46 PolarHBondContact O-N 3.37Å; S42-R46 PolarHBondContact OG-NE 2.8Å
43	V	45.4	Very low	46.7	Very low	111 Å²	111	122 Å²	122	67%	0.673	60%	0.604	S	S	*	*	H	α-helix	trans	-77.3	-39.7	-174.9	-174	0	0	0	0	112.4
44	K	37.8	Very low	46	Very low	182 Å²	182	126 Å²	126	79%	0.791	62%	0.615	S	S	*	*	H	α-helix	trans	-78.5	-29.2	176.2	-83.3	-178.5	174.6	175.8	0	113.6
45	L	45.4	Very low	45.9	Very low	90 Å²	90	127 Å²	127	47%	0.471	61%	0.614	S	S	.	*	H	α-helix	trans	-80.2	-22.9	171.5	-81.8	90.5	0	0	0	113.2	S41 Q48 I49	S41-L45 VanDerWaalsContact O-CD1 3.25Å; S41-L45 WeakPolarHBondContact O-CD1 3.12Å; L45-Q48 PolarHBondContact O-N 3.36Å; L45-I49 WeakPolarHBondContact O-CB 3.33Å; L45-I49 WeakPolarHBondContact O-CD1 3.06Å; L45-I49 PolarHBondContact O-N 3.31Å
46	R	45.1	Very low	45.7	Very low	159 Å²	159	130.2 Å²	130.2	60%	0.6	62%	0.624	S	S	*	*	H	α-helix	trans	-69.6	-35.3	176.4	-86	167.1	-175.8	-107.9	-4.2	113.5	S42 I49 L50	S42-R46 WeakPolarHBondContact O-CB 3.46Å; S42-R46 WeakPolarHBondContact O-CD 3.27Å; S42-R46 WeakPolarHBondContact O-CG 3.22Å; S42-R46 PolarHBondContact O-N 3.37Å; S42-R46 PolarHBondContact OG-NE 2.8Å; R46-I49 PolarHBondContact O-N 2.76Å; R46-L50 WeakPolarHBondContact O-CB 3.45Å; R46-L50 PolarHBondContact O-N 3.03Å
47	E	43.8	Very low	46.1	Very low	155 Å²	155	127.9 Å²	127.9	72%	0.724	62%	0.619	S	S	*	*	H	α-helix	trans	-69.6	-36.3	174.9	-76.1	-162.9	163	0	0	112.1	L50 D51	E47-L50 PolarHBondContact O-N 3.29Å; E47-D51 PolarHBondContact O-N 3.48Å
48	Q	42.9	Very low	46.3	Very low	145 Å²	145	130.4 Å²	130.4	68%	0.678	62%	0.618	S	S	*	*	H	α-helix	trans	-72.2	-31	174.4	-70.8	-173.2	-31.8	0	0	112.9	L45 L52	L45-Q48 PolarHBondContact O-N 3.36Å; Q48-L52 WeakPolarHBondContact O-CB 3.35Å; Q48-L52 PolarHBondContact O-N 3.25Å
49	I	51.7	Low	46.8	Very low	105 Å²	105	122.8 Å²	122.8	54%	0.538	60%	0.603	S	S	.	*	H	α-helix	trans	-73.1	-29.7	171.4	-94.5	76.5	0	0	0	112	L45 R46 S53	L45-I49 WeakPolarHBondContact O-CB 3.33Å; L45-I49 WeakPolarHBondContact O-CD1 3.06Å; L45-I49 PolarHBondContact O-N 3.31Å; R46-I49 PolarHBondContact O-N 2.76Å; I49-S53 WeakPolarHBondContact O-CA 2.94Å; I49-S53 WeakPolarHBondContact O-CB 3.46Å; I49-S53 PolarHBondContact O-N 2.84Å
50	L	52.5	Low	47	Very low	118 Å²	118	120.4 Å²	120.4	62%	0.618	59%	0.594	S	S	*	*	H	α-helix	trans	-76.2	-38.7	-176.3	-169.1	67.7	0	0	0	112.9	R46 E47 K54	R46-L50 WeakPolarHBondContact O-CB 3.45Å; R46-L50 PolarHBondContact O-N 3.03Å; E47-L50 PolarHBondContact O-N 3.29Å; L50-K54 PolarHBondContact O-N 3.29Å
51	D	46.8	Very low	47.6	Very low	101 Å²	101	116 Å²	116	54%	0.54	59%	0.587	S	S	.	*	H	α-helix	trans	-74.5	-37	174.1	-171	41.1	0	0	0	111.7	E47 K54 R55	E47-D51 PolarHBondContact O-N 3.48Å; D51-K54 PolarHBondContact O-N 2.91Å; D51-R55 PolarHBondContact O-N 2.83Å
52	L	49.7	Very low	48	Very low	119 Å²	119	120.4 Å²	120.4	62%	0.623	60%	0.599	S	S	*	*	H	α-helix	trans	-69.8	-37.2	175.4	-160.7	64.4	0	0	0	111.9	Q48 R55 Y56	Q48-L52 WeakPolarHBondContact O-CB 3.35Å; Q48-L52 PolarHBondContact O-N 3.25Å; L52-R55 PolarHBondContact O-N 2.85Å; L52-Y56 WeakPolarHBondContact O-CB 3.41Å; L52-Y56 PolarHBondContact O-N 2.76Å
53	S	51.9	Low	48.2	Very low	55 Å²	55	124 Å²	124	39%	0.385	61%	0.611	S	S	.	*	H	α-helix	trans	-62.4	-40.7	173.9	168.8	0	0	0	0	112.8	I49 R55 Y56 V57	I49-S53 WeakPolarHBondContact O-CA 2.94Å; I49-S53 WeakPolarHBondContact O-CB 3.46Å; I49-S53 PolarHBondContact O-N 2.84Å; S53-R55 VanDerWaalsContact C-N 3.33Å; S53-R55 PolarHBondContact O-N 3.24Å; S53-Y56 PolarHBondContact O-N 3.48Å; S53-V57 WeakPolarHBondContact O-CB 3.35Å; S53-V57 VanDerWaalsContact O-CG2 3.31Å; S53-V57 WeakPolarHBondContact O-CG2 3.47Å; S53-V57 PolarHBondContact O-N 3.28Å
54	K	49.4	Very low	48.2	Very low	160 Å²	160	123.9 Å²	123.9	70%	0.696	61%	0.606	S	S	*	*	H	α-helix	trans	-65.7	-34.8	177.5	-104.7	-176.7	179.2	-179.5	0	112.8	L50 D51 K58	L50-K54 PolarHBondContact O-N 3.29Å; D51-K54 PolarHBondContact O-N 2.91Å; K54-K58 VanDerWaalsContact O-CB 3.27Å; K54-K58 WeakPolarHBondContact O-CB 3.38Å; K54-K58 PolarHBondContact O-N 3.41Å
55	R	52.6	Low	48.6	Very low	180 Å²	180	124.7 Å²	124.7	68%	0.679	61%	0.61	S	S	*	*	H	α-helix	trans	-77.5	-33.2	174.6	-67.8	-173.7	-172.6	-158.6	1.6	112.3	D51 L52 S53 A59	D51-R55 PolarHBondContact O-N 2.83Å; L52-R55 PolarHBondContact O-N 2.85Å; S53-R55 VanDerWaalsContact C-N 3.33Å; S53-R55 PolarHBondContact O-N 3.24Å; R55-A59 WeakPolarHBondContact O-CB 3.37Å; R55-A59 PolarHBondContact O-N 2.84Å
56	Y	45.8	Very low	48.5	Very low	159 Å²	159	127.5 Å²	127.5	62%	0.624	63%	0.626	S	S	*	*	H	α-helix	trans	-73.4	-39.8	177.8	-145.1	-100.1	0	0	0	112.5	L52 S53 K58 A59 L60	L52-Y56 WeakPolarHBondContact O-CB 3.41Å; L52-Y56 PolarHBondContact O-N 2.76Å; S53-Y56 PolarHBondContact O-N 3.48Å; Y56-K58 VanDerWaalsContact C-N 3.34Å; Y56-A59 PolarHBondContact O-N 3.34Å; Y56-L60 HydrophobicContact CD1-CD1 3.37Å; Y56-L60 HydrophobicContact CE1-CD1 3.31Å; Y56-L60 HydrophobicContact CG-CD1 4.26Å; Y56-L60 WeakPolarHBondContact O-CB 3.31Å; Y56-L60 WeakPolarHBondContact O-CD1 3.4Å; Y56-L60 PolarHBondContact O-N 3.09Å
57	V	51	Low	48.5	Very low	90 Å²	90	123.9 Å²	123.9	55%	0.545	62%	0.621	S	S	.	*	H	α-helix	trans	-69	-34	174.1	172.6	0	0	0	0	111.5	S53 L60 A61	S53-V57 WeakPolarHBondContact O-CB 3.35Å; S53-V57 VanDerWaalsContact O-CG2 3.31Å; S53-V57 WeakPolarHBondContact O-CG2 3.47Å; S53-V57 PolarHBondContact O-N 3.28Å; V57-L60 PolarHBondContact O-N 3.5Å; V57-A61 WeakPolarHBondContact O-CB 3.38Å; V57-A61 PolarHBondContact O-N 3.4Å
58	K	50.9	Low	48.7	Very low	159 Å²	159	122 Å²	122	69%	0.691	62%	0.62	S	S	*	*	H	α-helix	trans	-69.9	-32.1	174.2	-165.2	174.5	-173.8	-175.7	0	112.2	K54 Y56	K54-K58 VanDerWaalsContact O-CB 3.27Å; K54-K58 WeakPolarHBondContact O-CB 3.38Å; K54-K58 PolarHBondContact O-N 3.41Å; Y56-K58 VanDerWaalsContact C-N 3.34Å
59	A	50.9	Low	48.9	Very low	60 Å²	60	122.4 Å²	122.4	50%	0.496	63%	0.627	S	S	.	*	H	α-helix	trans	-76.6	-36.5	171.3	0	0	0	0	0	112.8	R55 Y56 E63	R55-A59 WeakPolarHBondContact O-CB 3.37Å; R55-A59 PolarHBondContact O-N 2.84Å; Y56-A59 PolarHBondContact O-N 3.34Å; A59-E63 PolarHBondContact O-N 3.13Å
60	L	49.4	Very low	48.6	Very low	90 Å²	90	124 Å²	124	47%	0.471	64%	0.641	S	S	.	*	H	α-helix	trans	-73.4	-34.9	-179.7	-108.2	85.1	0	0	0	114	Y56 V57 E62 E63 N64	Y56-L60 HydrophobicContact CD1-CD1 3.37Å; Y56-L60 HydrophobicContact CE1-CD1 3.31Å; Y56-L60 HydrophobicContact CG-CD1 4.26Å; Y56-L60 WeakPolarHBondContact O-CB 3.31Å; Y56-L60 WeakPolarHBondContact O-CD1 3.4Å; Y56-L60 PolarHBondContact O-N 3.09Å; V57-L60 PolarHBondContact O-N 3.5Å; L60-E62 VanDerWaalsContact C-N 3.25Å; L60-E62 PolarHBondContact O-N 3.16Å; L60-E63 PolarHBondContact O-N 2.8Å; L60-N64 PolarHBondContact O-N 3.45Å
61	A	50.5	Low	48.3	Very low	77 Å²	77	125.9 Å²	125.9	64%	0.636	65%	0.647	S	S	*	*	H	α-helix	trans	-72.3	-22.6	179.5	0	0	0	0	0	112.6	V57	V57-A61 WeakPolarHBondContact O-CB 3.38Å; V57-A61 PolarHBondContact O-N 3.4Å
62	E	50.3	Low	48.3	Very low	168 Å²	168	129.4 Å²	129.4	79%	0.785	67%	0.666	S	S	*	*	H	α-helix	trans	-85.2	-20	176.9	-159.3	149.7	179.9	0	0	112.2	L60	L60-E62 VanDerWaalsContact C-N 3.25Å; L60-E62 PolarHBondContact O-N 3.16Å
63	E	48.1	Very low	48.1	Very low	120 Å²	120	127.3 Å²	127.3	56%	0.561	67%	0.673	S	S	*	*	H	α-helix	trans	-87.5	-34.7	174.7	-173.8	-168.4	152.4	0	0	113.9	A59 L60 K65 N66	A59-E63 PolarHBondContact O-N 3.13Å; L60-E63 PolarHBondContact O-N 2.8Å; E63-K65 PolarHBondContact O-N 3.45Å; E63-N66 PolarHBondContact O-N 3.41Å
64	N	45.1	Very low	48	Very low	109 Å²	109	128.1 Å²	128.1	58%	0.583	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.6	-3.2	-170.4	-166.8	-96	0	0	0	115.4	L60 N66 V68	L60-N64 PolarHBondContact O-N 3.45Å; N64-N66 VanDerWaalsContact C-N 3.34Å; N64-V68 WeakPolarHBondContact O-CG2 3.38Å
65	K	46	Very low	48	Very low	199 Å²	199	124.6 Å²	124.6	87%	0.865	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.4	-9.3	176.3	-164.8	170.2	159.2	72.6	0	113.7	E63	E63-K65 PolarHBondContact O-N 3.45Å
66	N	43.9	Very low	47.9	Very low	150 Å²	150	124 Å²	124	80%	0.802	69%	0.685	S	S	*	*	S	Bend	trans	-124	-7.3	-170.6	-160.7	39.3	0	0	0	116.7	E63 N64	E63-N66 PolarHBondContact O-N 3.41Å; N64-N66 VanDerWaalsContact C-N 3.34Å
67	T	44.9	Very low	48.2	Very low	83 Å²	83	120 Å²	120	51%	0.509	69%	0.685	S	S	.	*			trans	-133	19.1	-167.2	56.3	0	0	0	0	116.2	D69	T67-D69 PolarHBondContact O-N 3Å
68	V	48.9	Very low	48.3	Very low	116 Å²	116	118 Å²	118	70%	0.703	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.6	28.2	-177.4	170	0	0	0	0	115	N64	N64-V68 WeakPolarHBondContact O-CG2 3.38Å
69	D	45.7	Very low	48.2	Very low	152 Å²	152	119.2 Å²	119.2	81%	0.813	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	-125.4	-2.2	-167.9	-119.5	-46.4	0	0	0	118.4	T67	T67-D69 PolarHBondContact O-N 3Å
70	V	47.3	Very low	48.3	Very low	139 Å²	139	119.3 Å²	119.3	84%	0.842	69%	0.685	S	S	*	*	S	Bend	trans	-124.5	-24.3	-163.8	-173.8	0	0	0	0	119.3
71	E	45.9	Very low	48.3	Very low	158 Å²	158	119.7 Å²	119.7	74%	0.738	69%	0.688	S	S	*	*			trans	-131.8	35.4	-159	-149.1	-171.2	137.4	0	0	117.8
72	N	46.8	Very low	48.6	Very low	175 Å²	175	120.6 Å²	120.6	94%	0.936	68%	0.682	S	S	*	*	S	Bend	trans	-92.5	11.6	178.6	-87.7	-9.5	0	0	0	115.6
73	G	45.9	Very low	48.8	Very low	74 Å²	74	120.3 Å²	120.3	76%	0.763	68%	0.678	S	S	*	*	S	Bend	trans	-94.6	-22.8	-176.8	0	0	0	0	0	116.8
74	A	48.2	Very low	49.3	Very low	73 Å²	73	123.1 Å²	123.1	60%	0.603	68%	0.683	S	S	*	*	S	Bend	trans	-99.5	-21.9	-164.8	0	0	0	0	0	115.3	M76	A74-M76 PolarHBondContact O-N 3.45Å
75	S	49.4	Very low	50	Low	86 Å²	86	121.3 Å²	121.3	60%	0.601	68%	0.676	S	S	*	*	H	α-helix	trans	-79.7	-11.6	-174.3	-56.3	0	0	0	0	115.1
76	M	51.7	Low	50.8	Low	167 Å²	167	116.6 Å²	116.6	82%	0.823	66%	0.659	S	S	*	*	H	α-helix	trans	-83.2	-22.4	-177.1	-158.1	140.8	157.8	0	0	113.1	A74	A74-M76 PolarHBondContact O-N 3.45Å
77	A	51.2	Low	52	Low	74 Å²	74	112.2 Å²	112.2	61%	0.612	64%	0.644	S	S	*	*	H	α-helix	trans	-79.5	-36.8	179.9	0	0	0	0	0	113.3	Y79 A80 D81	A77-Y79 VanDerWaalsContact C-N 3.32Å; A77-Y79 PolarHBondContact O-N 2.98Å; A77-A80 PolarHBondContact O-N 3.33Å; A77-D81 PolarHBondContact O-N 3.08Å
78	G	52.7	Low	53	Low	49 Å²	49	112.7 Å²	112.7	51%	0.505	65%	0.647	S	S	.	*	H	α-helix	trans	-69.5	-27	-179.5	0	0	0	0	0	114.1	L82	G78-L82 WeakPolarHBondContact O-CB 3.49Å; G78-L82 PolarHBondContact O-N 2.82Å; G78-L82 VanDerWaalsContact O-N 3.11Å
79	Y	48.5	Very low	54.2	Low	184 Å²	184	112.1 Å²	112.1	72%	0.722	64%	0.639	S	S	*	*	H	α-helix	trans	-71.6	-32	174.8	-102	-89.3	0	0	0	112.9	A77 K83	A77-Y79 VanDerWaalsContact C-N 3.32Å; A77-Y79 PolarHBondContact O-N 2.98Å; Y79-K83 VanDerWaalsContact O-CB 3.31Å; Y79-K83 WeakPolarHBondContact O-CB 3.46Å; Y79-K83 PolarHBondContact O-N 3.19Å
80	A	55	Low	55.3	Low	63 Å²	63	110 Å²	110	52%	0.521	63%	0.628	S	S	.	*	H	α-helix	trans	-71.3	-40.1	178.1	0	0	0	0	0	111.7	A77 K83 R84	A77-A80 PolarHBondContact O-N 3.33Å; A80-K83 PolarHBondContact O-N 3.09Å; A80-R84 WeakPolarHBondContact O-CB 3.37Å; A80-R84 PolarHBondContact O-N 3.29Å
81	D	48.8	Very low	56.1	Low	98 Å²	98	107.5 Å²	107.5	52%	0.524	61%	0.609	S	S	.	*	H	α-helix	trans	-72.2	-39.3	178.5	-149.2	27.8	0	0	0	111.3	A77 K83 R84 T85	A77-D81 PolarHBondContact O-N 3.08Å; D81-K83 VanDerWaalsContact C-N 3.32Å; D81-K83 PolarHBondContact O-N 2.96Å; D81-R84 CarbonylContact O-C 3.59Å; D81-R84 WeakPolarHBondContact O-CA 3.45Å; D81-R84 WeakPolarHBondContact O-CB 3.21Å; D81-R84 PolarHBondContact O-N 2.76Å; D81-R84 VanDerWaalsContact O-N 3.08Å; D81-T85 PolarHBondContact O-N 3.26Å; D81-T85 PolarHBondContact O-OG1 3.39Å
82	L	56.7	Low	56.9	Low	96 Å²	96	103.5 Å²	103.5	50%	0.503	59%	0.593	S	S	.	*	H	α-helix	trans	-59.4	-43.1	171	-177.9	62.1	0	0	0	111.8	G78 R84 T85 I86	G78-L82 WeakPolarHBondContact O-CB 3.49Å; G78-L82 PolarHBondContact O-N 2.82Å; G78-L82 VanDerWaalsContact O-N 3.11Å; L82-R84 VanDerWaalsContact C-N 3.28Å; L82-R84 PolarHBondContact O-N 3.41Å; L82-T85 PolarHBondContact O-N 2.86Å; L82-I86 HydrophobicContact CD1-CD1 4.15Å; L82-I86 HydrophobicContact CD1-CG1 4.45Å; L82-I86 HydrophobicContact CG-CD1 3.92Å; L82-I86 WeakPolarHBondContact O-CB 3.19Å; L82-I86 WeakPolarHBondContact O-CD1 3.47Å; L82-I86 WeakPolarHBondContact O-CG1 3.5Å; L82-I86 PolarHBondContact O-N 3.15Å
83	K	53.8	Low	57.8	Low	162 Å²	162	100.1 Å²	100.1	70%	0.704	57%	0.574	S	S	*	*	H	α-helix	trans	-63.6	-35.6	175.9	-166.8	179.6	-179.4	-169.3	0	111.6	Y79 A80 D81 A87	Y79-K83 VanDerWaalsContact O-CB 3.31Å; Y79-K83 WeakPolarHBondContact O-CB 3.46Å; Y79-K83 PolarHBondContact O-N 3.19Å; A80-K83 PolarHBondContact O-N 3.09Å; D81-K83 VanDerWaalsContact C-N 3.32Å; D81-K83 PolarHBondContact O-N 2.96Å; K83-A87 WeakPolarHBondContact O-CB 3.5Å; K83-A87 PolarHBondContact O-N 3.24Å; K83-A87 VanDerWaalsContact O-N 3.09Å
84	R	58.1	Low	58.6	Low	178 Å²	178	101 Å²	101	67%	0.672	56%	0.561	S	S	*	*	H	α-helix	trans	-69.5	-43.3	175.5	-167.1	176.4	-178.5	-148.7	0.9	111.8	A80 D81 L82 I86 A87 V88	A80-R84 WeakPolarHBondContact O-CB 3.37Å; A80-R84 PolarHBondContact O-N 3.29Å; D81-R84 CarbonylContact O-C 3.59Å; D81-R84 WeakPolarHBondContact O-CA 3.45Å; D81-R84 WeakPolarHBondContact O-CB 3.21Å; D81-R84 PolarHBondContact O-N 2.76Å; D81-R84 VanDerWaalsContact O-N 3.08Å; L82-R84 VanDerWaalsContact C-N 3.28Å; L82-R84 PolarHBondContact O-N 3.41Å; R84-I86 VanDerWaalsContact C-N 3.35Å; R84-I86 PolarHBondContact O-N 2.94Å; R84-A87 PolarHBondContact O-N 3.43Å; R84-V88 VanDerWaalsContact O-CG2 3.29Å; R84-V88 WeakPolarHBondContact O-CG2 3.31Å; R84-V88 PolarHBondContact O-N 3.16Å
85	T	61.2	Low	59	Low	72 Å²	72	102.9 Å²	102.9	44%	0.442	56%	0.557	S	S	.	*	H	α-helix	trans	-63.1	-40.3	175.8	-52.1	0	0	0	0	111.8	D81 L82 V88 L89	D81-T85 PolarHBondContact O-N 3.26Å; D81-T85 PolarHBondContact O-OG1 3.39Å; L82-T85 PolarHBondContact O-N 2.86Å; T85-V88 PolarHBondContact O-N 2.98Å; T85-L89 HydrophobicContact CG2-CD1 4.03Å; T85-L89 WeakPolarHBondContact O-CB 3.38Å; T85-L89 WeakPolarHBondContact O-CG 3.44Å; T85-L89 PolarHBondContact O-N 3.06Å
86	I	62.7	Low	59.5	Low	99 Å²	99	106.3 Å²	106.3	51%	0.508	56%	0.557	S	S	.	*	H	α-helix	trans	-65.4	-43.2	177	-68.7	165.6	0	0	0	111.2	L82 R84 V88 L89 L90	L82-I86 HydrophobicContact CD1-CD1 4.15Å; L82-I86 HydrophobicContact CD1-CG1 4.45Å; L82-I86 HydrophobicContact CG-CD1 3.92Å; L82-I86 WeakPolarHBondContact O-CB 3.19Å; L82-I86 WeakPolarHBondContact O-CD1 3.47Å; L82-I86 WeakPolarHBondContact O-CG1 3.5Å; L82-I86 PolarHBondContact O-N 3.15Å; R84-I86 VanDerWaalsContact C-N 3.35Å; R84-I86 PolarHBondContact O-N 2.94Å; I86-V88 VanDerWaalsContact C-N 3.34Å; I86-V88 PolarHBondContact O-N 3.26Å; I86-L89 PolarHBondContact O-N 2.91Å; I86-L90 WeakPolarHBondContact O-CB 3.35Å; I86-L90 PolarHBondContact O-N 3.37Å
87	A	68.4	Low	59.8	Low	59 Å²	59	103.3 Å²	103.3	49%	0.488	54%	0.543	S	S	.	.	H	α-helix	trans	-63.9	-39.8	178.2	0	0	0	0	0	112.2	K83 R84 L90 D91	K83-A87 WeakPolarHBondContact O-CB 3.5Å; K83-A87 PolarHBondContact O-N 3.24Å; K83-A87 VanDerWaalsContact O-N 3.09Å; R84-A87 PolarHBondContact O-N 3.43Å; A87-L90 PolarHBondContact O-N 3.13Å; A87-D91 PolarHBondContact O-N 3.35Å; A87-D91 VanDerWaalsContact O-N 3.08Å
88	V	66.5	Low	60.1	Low	93 Å²	93	103.8 Å²	103.8	56%	0.564	54%	0.539	S	S	*	.	H	α-helix	trans	-68.5	-39.5	178.2	171.8	0	0	0	0	111.8	R84 T85 I86 L90 D91 D92	R84-V88 VanDerWaalsContact O-CG2 3.29Å; R84-V88 WeakPolarHBondContact O-CG2 3.31Å; R84-V88 PolarHBondContact O-N 3.16Å; T85-V88 PolarHBondContact O-N 2.98Å; I86-V88 VanDerWaalsContact C-N 3.34Å; I86-V88 PolarHBondContact O-N 3.26Å; V88-L90 VanDerWaalsContact C-N 3.34Å; V88-D91 PolarHBondContact O-N 3.41Å; V88-D92 PolarHBondContact O-N 3.39Å; V88-D92 VanDerWaalsContact O-N 3.1Å
89	L	73.4	Confident	60.2	Low	103 Å²	103	109.3 Å²	109.3	54%	0.539	55%	0.549	S	S	.	.	H	α-helix	trans	-67.3	-34.9	175.5	-75.4	165.5	0	0	0	112.4	T85 I86 I93	T85-L89 HydrophobicContact CG2-CD1 4.03Å; T85-L89 WeakPolarHBondContact O-CB 3.38Å; T85-L89 WeakPolarHBondContact O-CG 3.44Å; T85-L89 PolarHBondContact O-N 3.06Å; I86-L89 PolarHBondContact O-N 2.91Å; L89-I93 VanDerWaalsContact O-CG1 3.31Å; L89-I93 WeakPolarHBondContact O-CG1 3.17Å; L89-I93 PolarHBondContact O-N 2.91Å
90	L	68.1	Low	60.6	Low	109 Å²	109	105.9 Å²	105.9	57%	0.571	54%	0.542	S	S	*	.	H	α-helix	trans	-67.7	-42.3	176.5	-158.3	88	0	0	0	111.4	I86 A87 V88 I93 L94	I86-L90 WeakPolarHBondContact O-CB 3.35Å; I86-L90 PolarHBondContact O-N 3.37Å; A87-L90 PolarHBondContact O-N 3.13Å; V88-L90 VanDerWaalsContact C-N 3.34Å; L90-I93 PolarHBondContact O-N 3.36Å; L90-L94 HydrophobicContact CD2-CD1 4.1Å; L90-L94 HydrophobicContact CG-CD1 4.16Å; L90-L94 WeakPolarHBondContact O-CB 3.42Å; L90-L94 VanDerWaalsContact O-CG 3.28Å; L90-L94 WeakPolarHBondContact O-CG 3.26Å; L90-L94 PolarHBondContact O-N 2.87Å
91	D	64.9	Low	60.6	Low	86 Å²	86	108.6 Å²	108.6	46%	0.46	54%	0.544	S	S	.	.	H	α-helix	trans	-66.4	-40.3	178.7	-172.6	47.4	0	0	0	112.2	A87 V88 I93 L94 Q95	A87-D91 PolarHBondContact O-N 3.35Å; A87-D91 VanDerWaalsContact O-N 3.08Å; V88-D91 PolarHBondContact O-N 3.41Å; D91-I93 VanDerWaalsContact C-N 3.31Å; D91-I93 PolarHBondContact O-N 2.76Å; D91-L94 PolarHBondContact O-N 3.43Å; D91-Q95 WeakPolarHBondContact O-CB 3.29Å; D91-Q95 WeakPolarHBondContact O-CG 3.48Å; D91-Q95 PolarHBondContact O-N 3.04Å; D91-Q95 PolarHBondContact OD1-NE2 2.94Å; D91-Q95 VanDerWaalsContact OD1-NE2 3.15Å; D91-Q95 PolarHBondContact OD2-NE2 3.04Å
92	D	63.3	Low	60.9	Low	74 Å²	74	109.7 Å²	109.7	40%	0.396	55%	0.55	S	S	.	.	H	α-helix	trans	-63.7	-35.6	174.8	-174.7	54.2	0	0	0	112.1	V88 R96	V88-D92 PolarHBondContact O-N 3.39Å; V88-D92 VanDerWaalsContact O-N 3.1Å; D92-R96 WeakPolarHBondContact O-CB 3.32Å; D92-R96 WeakPolarHBondContact O-CD 3.45Å; D92-R96 WeakPolarHBondContact O-CG 3.02Å; D92-R96 PolarHBondContact O-N 3.39Å; D92-R96 VanDerWaalsContact O-N 3.09Å; D92-R96 IonicContact OD1-NE 3.39Å; D92-R96 PolarHBondContact OD1-NE 3.09Å; D92-R96 IonicContact OD2-CZ 3.82Å; D92-R96 IonicContact OD2-NE 3.26Å; D92-R96 PolarHBondContact OD2-NE 3.39Å; D92-R96 IonicContact OD2-NH2 3.78Å
93	I	66.2	Low	60.9	Low	103 Å²	103	112 Å²	112	53%	0.528	56%	0.556	S	S	.	*	H	α-helix	trans	-73.8	-41.1	176.5	-67.1	169.8	0	0	0	111.3	L89 L90 D91 R96 L97	L89-I93 VanDerWaalsContact O-CG1 3.31Å; L89-I93 WeakPolarHBondContact O-CG1 3.17Å; L89-I93 PolarHBondContact O-N 2.91Å; L90-I93 PolarHBondContact O-N 3.36Å; D91-I93 VanDerWaalsContact C-N 3.31Å; D91-I93 PolarHBondContact O-N 2.76Å; I93-R96 PolarHBondContact O-N 3.21Å; I93-L97 HydrophobicContact CG2-CD1 4.21Å; I93-L97 WeakPolarHBondContact O-CB 3.37Å; I93-L97 PolarHBondContact O-N 3.39Å
94	L	62.4	Low	61	Low	94 Å²	94	108.1 Å²	108.1	49%	0.492	55%	0.546	S	S	.	.	H	α-helix	trans	-67.2	-40.5	177.5	-73.2	170.7	0	0	0	112	L90 D91 L97 V98	L90-L94 HydrophobicContact CD2-CD1 4.1Å; L90-L94 HydrophobicContact CG-CD1 4.16Å; L90-L94 WeakPolarHBondContact O-CB 3.42Å; L90-L94 VanDerWaalsContact O-CG 3.28Å; L90-L94 WeakPolarHBondContact O-CG 3.26Å; L90-L94 PolarHBondContact O-N 2.87Å; D91-L94 PolarHBondContact O-N 3.43Å; L94-L97 WeakPolarHBondContact O-CB 3.48Å; L94-L97 PolarHBondContact O-N 3.03Å; L94-V98 WeakPolarHBondContact O-CG2 3.31Å; L94-V98 PolarHBondContact O-N 3.41Å
95	Q	56.3	Low	60.7	Low	111 Å²	111	104.1 Å²	104.1	52%	0.519	54%	0.538	S	S	.	.	H	α-helix	trans	-66.8	-37.9	174.6	-75.5	-179.9	31.7	0	0	112.3	D91 L97 V98 K99	D91-Q95 WeakPolarHBondContact O-CB 3.29Å; D91-Q95 WeakPolarHBondContact O-CG 3.48Å; D91-Q95 PolarHBondContact O-N 3.04Å; D91-Q95 PolarHBondContact OD1-NE2 2.94Å; D91-Q95 VanDerWaalsContact OD1-NE2 3.15Å; D91-Q95 PolarHBondContact OD2-NE2 3.04Å; Q95-L97 VanDerWaalsContact C-N 3.31Å; Q95-V98 PolarHBondContact O-N 3.43Å; Q95-K99 VanDerWaalsContact O-CB 3.28Å; Q95-K99 WeakPolarHBondContact O-CB 3.47Å; Q95-K99 PolarHBondContact O-N 3.29Å
96	R	58.8	Low	60.4	Low	159 Å²	159	108.3 Å²	108.3	60%	0.6	55%	0.546	S	S	*	.	H	α-helix	trans	-65.6	-35.1	173	-76.4	171.9	-175.5	-124.5	2.9	112	D92 I93 L100	D92-R96 WeakPolarHBondContact O-CB 3.32Å; D92-R96 WeakPolarHBondContact O-CD 3.45Å; D92-R96 WeakPolarHBondContact O-CG 3.02Å; D92-R96 PolarHBondContact O-N 3.39Å; D92-R96 VanDerWaalsContact O-N 3.09Å; D92-R96 IonicContact OD1-NE 3.39Å; D92-R96 PolarHBondContact OD1-NE 3.09Å; D92-R96 IonicContact OD2-CZ 3.82Å; D92-R96 IonicContact OD2-NE 3.26Å; D92-R96 PolarHBondContact OD2-NE 3.39Å; D92-R96 IonicContact OD2-NH2 3.78Å; I93-R96 PolarHBondContact O-N 3.21Å; R96-L100 WeakPolarHBondContact O-CB 3.37Å; R96-L100 VanDerWaalsContact O-CD1 3.26Å; R96-L100 WeakPolarHBondContact O-CD1 3.39Å; R96-L100 PolarHBondContact O-N 3.11Å
97	L	57.8	Low	60.1	Low	104 Å²	104	108.8 Å²	108.8	55%	0.545	55%	0.549	S	S	.	.	H	α-helix	trans	-64.7	-48	173.3	-96.3	154.1	0	0	0	112.3	I93 L94 Q95 K99 L100 E101	I93-L97 HydrophobicContact CG2-CD1 4.21Å; I93-L97 WeakPolarHBondContact O-CB 3.37Å; I93-L97 PolarHBondContact O-N 3.39Å; L94-L97 WeakPolarHBondContact O-CB 3.48Å; L94-L97 PolarHBondContact O-N 3.03Å; Q95-L97 VanDerWaalsContact C-N 3.31Å; L97-K99 VanDerWaalsContact C-N 3.33Å; L97-K99 PolarHBondContact O-N 2.83Å; L97-L100 WeakPolarHBondContact O-CB 3.29Å; L97-L100 PolarHBondContact O-N 3.08Å; L97-L100 VanDerWaalsContact O-N 3.16Å; L97-E101 PolarHBondContact O-N 3.48Å
98	V	57.9	Low	59.6	Low	84 Å²	84	110.7 Å²	110.7	51%	0.509	55%	0.554	S	S	.	*	H	α-helix	trans	-65.1	-36.5	178.1	171.7	0	0	0	0	111.9	L94 Q95 L100 E101 N102	L94-V98 WeakPolarHBondContact O-CG2 3.31Å; L94-V98 PolarHBondContact O-N 3.41Å; Q95-V98 PolarHBondContact O-N 3.43Å; V98-L100 VanDerWaalsContact C-N 3.34Å; V98-E101 WeakPolarHBondContact O-CB 3.47Å; V98-E101 PolarHBondContact O-N 3.02Å; V98-N102 PolarHBondContact O-N 2.96Å; V98-N102 VanDerWaalsContact O-N 3.09Å
99	K	55.5	Low	59.1	Low	165 Å²	165	111.9 Å²	111.9	72%	0.717	56%	0.561	S	S	*	*	H	α-helix	trans	-72.9	-27.2	175.5	-160.1	173.5	-176.8	175.9	0	112.6	Q95 L97	Q95-K99 VanDerWaalsContact O-CB 3.28Å; Q95-K99 WeakPolarHBondContact O-CB 3.47Å; Q95-K99 PolarHBondContact O-N 3.29Å; L97-K99 VanDerWaalsContact C-N 3.33Å; L97-K99 PolarHBondContact O-N 2.83Å
100	L	56.8	Low	58	Low	112 Å²	112	110.4 Å²	110.4	59%	0.586	55%	0.554	S	S	*	*	H	α-helix	trans	-73.7	-39	169.5	-103.1	69.9	0	0	0	111.4	R96 L97 V98 K103 V104	R96-L100 WeakPolarHBondContact O-CB 3.37Å; R96-L100 VanDerWaalsContact O-CD1 3.26Å; R96-L100 WeakPolarHBondContact O-CD1 3.39Å; R96-L100 PolarHBondContact O-N 3.11Å; L97-L100 WeakPolarHBondContact O-CB 3.29Å; L97-L100 PolarHBondContact O-N 3.08Å; L97-L100 VanDerWaalsContact O-N 3.16Å; V98-L100 VanDerWaalsContact C-N 3.34Å; L100-K103 PolarHBondContact O-N 3.35Å; L100-K103 VanDerWaalsContact O-N 3.13Å; L100-V104 VanDerWaalsContact O-CG2 3.29Å; L100-V104 WeakPolarHBondContact O-CG2 3.43Å; L100-V104 PolarHBondContact O-N 3.4Å
101	E	54.4	Low	57.1	Low	119 Å²	119	107 Å²	107	56%	0.556	55%	0.546	S	S	*	.	H	α-helix	trans	-59.3	-49.6	176.3	-172.8	175.6	-173.5	0	0	111.6	L97 V98 K103 V104 D105	L97-E101 PolarHBondContact O-N 3.48Å; V98-E101 WeakPolarHBondContact O-CB 3.47Å; V98-E101 PolarHBondContact O-N 3.02Å; E101-K103 PolarHBondContact O-N 3.45Å; E101-K103 VanDerWaalsContact O-N 3.15Å; E101-V104 PolarHBondContact O-N 3.33Å; E101-D105 PolarHBondContact O-N 3.06Å
102	N	54.7	Low	56.6	Low	122 Å²	122	108.2 Å²	108.2	65%	0.652	56%	0.56	S	S	*	*	H	α-helix	trans	-61.3	-26.2	175.3	-107.9	53.8	0	0	0	113.8	V98	V98-N102 PolarHBondContact O-N 2.96Å; V98-N102 VanDerWaalsContact O-N 3.09Å
103	K	56.5	Low	56.1	Low	144 Å²	144	108.5 Å²	108.5	63%	0.626	57%	0.573	S	S	*	*	H	α-helix	trans	-84.1	-28.8	177.8	-139.6	174.1	-173.6	-69.3	0	111.7	L100 E101 I107	L100-K103 PolarHBondContact O-N 3.35Å; L100-K103 VanDerWaalsContact O-N 3.13Å; E101-K103 PolarHBondContact O-N 3.45Å; E101-K103 VanDerWaalsContact O-N 3.15Å; K103-I107 WeakPolarHBondContact O-CG1 3.28Å; K103-I107 PolarHBondContact O-N 3.41Å
104	V	56.7	Low	55.3	Low	81 Å²	81	108.2 Å²	108.2	49%	0.491	58%	0.576	S	S	.	*	H	α-helix	trans	-74.8	-42.3	174.7	169.2	0	0	0	0	110.8	L100 E101 Y106 I107 V108	L100-V104 VanDerWaalsContact O-CG2 3.29Å; L100-V104 WeakPolarHBondContact O-CG2 3.43Å; L100-V104 PolarHBondContact O-N 3.4Å; E101-V104 PolarHBondContact O-N 3.33Å; V104-Y106 VanDerWaalsContact C-N 3.3Å; V104-Y106 PolarHBondContact O-N 3.41Å; V104-I107 CarbonylContact O-C 3.58Å; V104-I107 PolarHBondContact O-N 3.08Å; V104-V108 HydrophobicContact CG1-CG2 4.44Å; V104-V108 PolarHBondContact O-N 2.92Å
105	D	52.9	Low	54.8	Low	94 Å²	94	111.1 Å²	111.1	50%	0.503	59%	0.592	S	S	.	*	H	α-helix	trans	-62.6	-36.8	175	-90.1	-19.6	0	0	0	112.4	E101 I107 V108 V109	E101-D105 PolarHBondContact O-N 3.06Å; D105-I107 VanDerWaalsContact C-N 3.3Å; D105-I107 PolarHBondContact O-N 3.45Å; D105-V108 PolarHBondContact O-N 3.33Å; D105-V109 WeakPolarHBondContact O-CB 3.35Å; D105-V109 WeakPolarHBondContact O-CG2 3.35Å; D105-V109 PolarHBondContact O-N 3.02Å
106	Y	53.2	Low	54.6	Low	159 Å²	159	111.6 Å²	111.6	62%	0.624	60%	0.603	S	S	*	*	H	α-helix	trans	-63.4	-34.8	172.6	-174.3	-99.5	0	0	0	112.5	V104 N110	V104-Y106 VanDerWaalsContact C-N 3.3Å; V104-Y106 PolarHBondContact O-N 3.41Å; Y106-N110 WeakPolarHBondContact O-CB 3.28Å; Y106-N110 PolarHBondContact O-N 3.48Å
107	I	57.2	Low	54.1	Low	109 Å²	109	109.3 Å²	109.3	56%	0.559	61%	0.607	S	S	*	*	H	α-helix	trans	-77.4	-35.3	177.1	-67	168.6	0	0	0	111.4	K103 V104 D105 G111	K103-I107 WeakPolarHBondContact O-CG1 3.28Å; K103-I107 PolarHBondContact O-N 3.41Å; V104-I107 CarbonylContact O-C 3.58Å; V104-I107 PolarHBondContact O-N 3.08Å; D105-I107 VanDerWaalsContact C-N 3.3Å; D105-I107 PolarHBondContact O-N 3.45Å; I107-G111 WeakPolarHBondContact O-CA 3.41Å; I107-G111 PolarHBondContact O-N 3.36Å
108	V	57.7	Low	53.6	Low	99 Å²	99	111.9 Å²	111.9	60%	0.6	62%	0.621	S	S	*	*	H	α-helix	trans	-69.1	-40.5	175.6	166.8	0	0	0	0	111.2	V104 D105	V104-V108 HydrophobicContact CG1-CG2 4.44Å; V104-V108 PolarHBondContact O-N 2.92Å; D105-V108 PolarHBondContact O-N 3.33Å
109	V	55.4	Low	53.2	Low	118 Å²	118	111.2 Å²	111.2	72%	0.715	63%	0.632	S	S	*	*	H	α-helix	trans	-76.2	-39.8	178.3	168.1	0	0	0	0	112.3	D105	D105-V109 WeakPolarHBondContact O-CB 3.35Å; D105-V109 WeakPolarHBondContact O-CG2 3.35Å; D105-V109 PolarHBondContact O-N 3.02Å
110	N	51.6	Low	52.5	Low	73 Å²	73	110.2 Å²	110.2	39%	0.39	64%	0.639	S	S	.	*	H	α-helix	trans	-88.2	-23.6	-179.1	-165.7	37.3	0	0	0	113.7	Y106 S112 A113	Y106-N110 WeakPolarHBondContact O-CB 3.28Å; Y106-N110 PolarHBondContact O-N 3.48Å; N110-S112 PolarHBondContact O-N 2.84Å; N110-A113 PolarHBondContact O-N 3.1Å
111	G	49.2	Very low	52.4	Low	38 Å²	38	110.8 Å²	110.8	39%	0.392	65%	0.653	S	S	.	*	T	Hydrogen-bonded Turn	trans	-70.1	-14.7	177.6	0	0	0	0	0	113.7	I107 A113	I107-G111 WeakPolarHBondContact O-CA 3.41Å; I107-G111 PolarHBondContact O-N 3.36Å; G111-A113 VanDerWaalsContact C-N 3.3Å
112	S	54.2	Low	52.1	Low	110 Å²	110	108.2 Å²	108.2	77%	0.769	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.6	-11.8	172.8	-166.7	0	0	0	0	113.6	N110	N110-S112 PolarHBondContact O-N 2.84Å
113	A	52.8	Low	51.4	Low	80 Å²	80	109.7 Å²	109.7	66%	0.661	67%	0.666	S	S	*	*	S	Bend	trans	-109.5	-8.8	-171.7	0	0	0	0	0	115.5	N110 G111	N110-A113 PolarHBondContact O-N 3.1Å; G111-A113 VanDerWaalsContact C-N 3.3Å
114	T	48.5	Very low	50.9	Low	97 Å²	97	111.4 Å²	111.4	60%	0.595	68%	0.681	S	S	*	*			trans	-109.8	9.5	-170.4	62.2	0	0	0	0	116	T116	T114-T116 PolarHBondContact O-N 2.96Å; T114-T116 VanDerWaalsContact O-N 3.08Å
115	N	52.6	Low	50.2	Low	155 Å²	155	112.6 Å²	112.6	83%	0.829	69%	0.688	S	S	*	*			trans	-85	62.9	168.2	-78.7	-21.6	0	0	0	111.4
116	T	52.8	Low	49.9	Very low	122 Å²	122	113.3 Å²	113.3	75%	0.748	70%	0.698	S	S	*	*			trans	-156	114.6	158.3	-71.2	0	0	0	0	105.8	T114	T114-T116 PolarHBondContact O-N 2.96Å; T114-T116 VanDerWaalsContact O-N 3.08Å
117	T	47.7	Very low	49.4	Very low	111 Å²	111	111.2 Å²	111.2	68%	0.681	70%	0.702	S	S	*	*			trans	164	104	145.3	-70.5	0	0	0	0	109.7
118	N	47.6	Very low	49.3	Very low	158 Å²	158	112.4 Å²	112.4	85%	0.845	71%	0.714	S	S	*	*			trans	69.6	136.9	146.2	-48.1	-13.5	0	0	0	118.2
119	G	48.9	Very low	48.8	Very low	70 Å²	70	112.9 Å²	112.9	72%	0.722	72%	0.717	S	S	*	*			cis	132.3	110.6	17.9	0	0	0	0	0	108.1
120	T	41.1	Very low	48.6	Very low	144 Å²	144	115 Å²	115	88%	0.883	73%	0.725	S	S	*	*			trans	-145.5	106.3	161.8	-66.7	0	0	0	0	109.3
121	S	54.2	Low	48.2	Very low	124 Å²	124	119.4 Å²	119.4	87%	0.867	74%	0.74	S	S	*	*			trans	-44.7	130.5	158.3	-179.3	0	0	0	0	111.3
122	G	49.5	Very low	48.3	Very low	65 Å²	65	128.7 Å²	128.7	67%	0.67	76%	0.763	S	S	*	*			trans	163.3	108	172.6	0	0	0	0	0	112.2
123	N	39.6	Very low	47.8	Very low	153 Å²	153	127.9 Å²	127.9	82%	0.818	75%	0.754	S	S	*	*			trans	84.9	77.4	173.6	-67.4	19.5	0	0	0	117.3	V125	N123-V125 VanDerWaalsContact C-N 3.26Å; N123-V125 PolarHBondContact O-N 3.46Å
124	L	46.6	Very low	47.7	Very low	180 Å²	180	131.5 Å²	131.5	94%	0.942	76%	0.762	S	S	*	*			trans	-62.9	92.4	140.1	-69.8	165.7	0	0	0	108.3
125	V	41.9	Very low	47.5	Very low	106 Å²	106	133.3 Å²	133.3	64%	0.642	77%	0.773	S	S	*	*			trans	-70.8	123.3	158.2	176.4	0	0	0	0	106.2	N123 V127	N123-V125 VanDerWaalsContact C-N 3.26Å; N123-V125 PolarHBondContact O-N 3.46Å; V125-V127 PolarHBondContact O-N 2.97Å
126	P	46.1	Very low	47.2	Very low	109 Å²	109	131.7 Å²	131.7	71%	0.708	77%	0.774	S	S	*	*			trans	-70.4	101.4	176.5	28.6	-29.5	0	0	0	107.6	T128	P126-T128 VanDerWaalsContact C-N 3.3Å; P126-T128 PolarHBondContact O-N 3.09Å
127	V	43.1	Very low	46.7	Very low	115 Å²	115	129 Å²	129	70%	0.697	77%	0.77	S	S	*	*			trans	-70	96.1	164	166.6	0	0	0	0	106.6	V125 T129	V125-V127 PolarHBondContact O-N 2.97Å; V127-T129 VanDerWaalsContact C-N 3.28Å; V127-T129 WeakPolarHBondContact CG1-OG1 3.49Å; V127-T129 PolarHBondContact O-N 2.98Å
128	T	55	Low	46.6	Very low	133 Å²	133	129.6 Å²	129.6	82%	0.816	78%	0.779	S	S	*	*			trans	-64.3	91.2	161.5	52	0	0	0	0	107.8	P126	P126-T128 VanDerWaalsContact C-N 3.3Å; P126-T128 PolarHBondContact O-N 3.09Å
129	T	45.8	Very low	46.7	Very low	109 Å²	109	129.4 Å²	129.4	67%	0.669	78%	0.776	S	S	*	*			trans	-112.7	104.6	168.8	-66.8	0	0	0	0	109	V127 K131	V127-T129 VanDerWaalsContact C-N 3.28Å; V127-T129 WeakPolarHBondContact CG1-OG1 3.49Å; V127-T129 PolarHBondContact O-N 2.98Å; T129-K131 PolarHBondContact O-N 3.15Å
130	N	52.7	Low	46.6	Very low	164 Å²	164	140.7 Å²	140.7	88%	0.877	80%	0.797	S	S	*	*			trans	-37.5	121.1	159.2	-81.6	-9.6	0	0	0	111.3
131	K	41.8	Very low	46.8	Very low	164 Å²	164	140.5 Å²	140.5	71%	0.713	79%	0.793	S	S	*	*			trans	-149	100	153.3	-170.3	166.1	174.5	-84.1	0	110.3	T129 T133	T129-K131 PolarHBondContact O-N 3.15Å; K131-T133 HydrophobicContact CG-CG2 4.31Å; K131-T133 VanDerWaalsContact NZ-CG2 3.28Å; K131-T133 PolarHBondContact O-N 2.83Å
132	R	51.6	Low	46.4	Very low	233 Å²	233	141.4 Å²	141.4	88%	0.879	79%	0.789	S	S	*	*			trans	-48.3	113.1	159	-178.9	179.6	-173	173.7	2.4	109.2
133	T	43.9	Very low	46.3	Very low	94 Å²	94	145.6 Å²	145.6	58%	0.577	80%	0.795	S	S	*	*			trans	-142.8	124.9	160.1	43	0	0	0	0	109	K131	K131-T133 HydrophobicContact CG-CG2 4.31Å; K131-T133 VanDerWaalsContact NZ-CG2 3.28Å; K131-T133 PolarHBondContact O-N 2.83Å
134	N	51.8	Low	46.7	Very low	155 Å²	155	145.2 Å²	145.2	83%	0.829	79%	0.794	S	S	*	*			trans	-56.6	138.7	-175.6	-58.6	-57.3	0	0	0	113
135	V	42.5	Very low	46.7	Very low	135 Å²	135	143 Å²	143	82%	0.818	79%	0.785	S	S	*	*			trans	-134.6	99.1	164.1	-166	0	0	0	0	104.6
136	S	46.4	Very low	47	Very low	121 Å²	121	145.5 Å²	145.5	85%	0.846	79%	0.794	S	S	*	*				58.9	122.4	96.9	-164.6	0	0	0	0	113.6
137	G	43.9	Very low	47	Very low	65 Å²	65	148.1 Å²	148.1	67%	0.67	80%	0.8	S	S	*	*			trans	157.3	100.8	165	0	0	0	0	0	115.4
138	S	45.4	Very low	47.4	Very low	124 Å²	124	150.6 Å²	150.6	87%	0.867	81%	0.808	S	S	*	*			trans	-41.1	133.1	156.8	177.7	0	0	0	0	112.6
139	I	49.4	Very low	46.7	Very low	154 Å²	154	152.1 Å²	152.1	79%	0.79	81%	0.808	S	S	*	*			trans	-135.5	107.2	162	-58.5	-178.8	0	0	0	107.7
140	R	45.4	Very low	46.8	Very low	307 Å²	307	156 Å²	156	100%	1.158	82%	0.82	S	S	*	*			trans	62.8	0	157.9	-73.1	-178.4	162.3	-162.6	-5	119.6

Retrieved 140 of 140 residues in 33.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).