A0A096MVZ4_PAPAN Loading...

Coiled-coil domain containing 179

AlphaFold DB (A0A2K6QZJ5), UniProt , Accession A0A096MVZ4, Species PAPAN (Papio anubis, Olive baboon), Gene CCDC179, Length 68 aa.

						>A0A096MVZ4_PAPAN|A0A096MVZ4|CCDC179
MCLYCWDIEPSQVSPEGPRQHHPSEVTERQLANKRIQNMQNLKKEKRRLNKRFARPSPIPEPGLLWSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.8	Very low	55.5	Low	238 Å²	238	152.2 Å²	152.2	100%	1.172	80%	0.796	S	S	*	*				0	92.9	0	-71.3	-80.9	118.7	0	0	107
2	C	51.6	Low	56.3	Low	131 Å²	131	155.7 Å²	155.7	89%	0.885	81%	0.806	S	S	*	*			trans	-88.2	118.2	174.1	-82.7	0	0	0	0	107.9	Y4	C2-Y4 PolarHBondContact O-N 2.81Å
3	L	56.7	Low	57.1	Low	163 Å²	163	152.8 Å²	152.8	85%	0.853	80%	0.799	S	S	*	*			trans	-79	118.3	172.5	-70.4	168.1	0	0	0	108.1	C5	L3-C5 PolarHBondContact O-N 3.18Å
4	Y	51.8	Low	57.6	Low	193 Å²	193	148.8 Å²	148.8	76%	0.757	79%	0.79	S	S	*	*			trans	-58.8	112.7	172.9	-123.9	-118.5	0	0	0	108.8	C2 W6	C2-Y4 PolarHBondContact O-N 2.81Å; Y4-W6 HydrophobicContact CD1-CB 4.38Å; Y4-W6 HydrophobicContact CD1-CD2 4.47Å; Y4-W6 AromaticContact CD1-CE3 3.57Å; Y4-W6 HydrophobicContact CD1-CE3 3.57Å; Y4-W6 HydrophobicContact CD1-CZ3 4.27Å; Y4-W6 HydrophobicContact CE1-CD2 4.39Å; Y4-W6 AromaticContact CE1-CE3 3.24Å; Y4-W6 HydrophobicContact CE1-CE3 3.24Å; Y4-W6 AromaticContact CE1-CZ3 3.47Å; Y4-W6 HydrophobicContact CE1-CZ3 3.47Å; Y4-W6 VanDerWaalsContact CE1-CZ3 3.47Å; Y4-W6 PolarHBondContact O-N 3.19Å
5	C	60	Low	58.2	Low	117 Å²	117	147.2 Å²	147.2	79%	0.791	79%	0.792	S	S	*	*			trans	-84.7	81.6	169.6	-65.1	0	0	0	0	108.4	L3	L3-C5 PolarHBondContact O-N 3.18Å
6	W	51.6	Low	58.9	Low	188 Å²	188	146.9 Å²	146.9	71%	0.712	78%	0.784	S	S	*	*			trans	-112.3	125.2	169.5	-142	-67.7	0	0	0	107.9	Y4	Y4-W6 HydrophobicContact CD1-CB 4.38Å; Y4-W6 HydrophobicContact CD1-CD2 4.47Å; Y4-W6 AromaticContact CD1-CE3 3.57Å; Y4-W6 HydrophobicContact CD1-CE3 3.57Å; Y4-W6 HydrophobicContact CD1-CZ3 4.27Å; Y4-W6 HydrophobicContact CE1-CD2 4.39Å; Y4-W6 AromaticContact CE1-CE3 3.24Å; Y4-W6 HydrophobicContact CE1-CE3 3.24Å; Y4-W6 AromaticContact CE1-CZ3 3.47Å; Y4-W6 HydrophobicContact CE1-CZ3 3.47Å; Y4-W6 VanDerWaalsContact CE1-CZ3 3.47Å; Y4-W6 PolarHBondContact O-N 3.19Å
7	D	52.3	Low	59.6	Low	133 Å²	133	141.1 Å²	141.1	71%	0.711	77%	0.766	S	S	*	*			trans	78.5	57.4	176.5	-55.6	-33	0	0	0	118.3	E9	D7-E9 VanDerWaalsContact C-N 3.34Å; D7-E9 PolarHBondContact O-N 3.06Å
8	I	54.6	Low	60	Low	146 Å²	146	140.7 Å²	140.7	75%	0.749	77%	0.772	S	S	*	*			trans	-84.4	88.1	151.4	-55.3	173	0	0	0	106.7
9	E	62.5	Low	60.4	Low	159 Å²	159	142.8 Å²	142.8	74%	0.743	77%	0.767	S	S	*	*			trans	-52.3	123.2	158.2	-83.3	-67.4	115.7	0	0	107.4	D7 S11	D7-E9 VanDerWaalsContact C-N 3.34Å; D7-E9 PolarHBondContact O-N 3.06Å; E9-S11 PolarHBondContact O-N 3.19Å
10	P	62.4	Low	61	Low	106 Å²	106	145.3 Å²	145.3	69%	0.688	77%	0.774	S	S	*	*			trans	-63	111.9	174	25.5	-30.2	0	0	0	106.7	Q12	P10-Q12 PolarHBondContact O-N 3.26Å
11	S	65.6	Low	61.5	Low	100 Å²	100	142.8 Å²	142.8	70%	0.699	76%	0.758	S	S	*	*			trans	-53.5	116.4	172.3	52.4	0	0	0	0	107.4	E9 V13	E9-S11 PolarHBondContact O-N 3.19Å; S11-V13 VanDerWaalsContact C-N 3.29Å; S11-V13 VanDerWaalsContact O-CG2 3.27Å; S11-V13 WeakPolarHBondContact O-CG2 3.21Å; S11-V13 PolarHBondContact O-N 3.1Å
12	Q	64.8	Low	63.1	Low	194 Å²	194	137 Å²	137	91%	0.907	73%	0.727	S	S	*	*			trans	-68.1	93.6	180	-164.3	-178.4	19.4	0	0	107.4	P10 S14	P10-Q12 PolarHBondContact O-N 3.26Å; Q12-S14 PolarHBondContact O-N 3.43Å
13	V	66.5	Low	64.3	Low	118 Å²	118	135 Å²	135	72%	0.715	71%	0.713	S	S	*	*			trans	-79.1	111.7	175.8	-145.9	0	0	0	0	106.7	S11	S11-V13 VanDerWaalsContact C-N 3.29Å; S11-V13 VanDerWaalsContact O-CG2 3.27Å; S11-V13 WeakPolarHBondContact O-CG2 3.21Å; S11-V13 PolarHBondContact O-N 3.1Å
14	S	64.3	Low	65.2	Low	97 Å²	97	129.9 Å²	129.9	68%	0.678	69%	0.691	S	S	*	*			trans	-53.2	133.1	175	-68	0	0	0	0	109.8	Q12 E16	Q12-S14 PolarHBondContact O-N 3.43Å; S14-E16 PolarHBondContact O-N 2.82Å; S14-E16 VanDerWaalsContact O-N 3.09Å
15	P	66.4	Low	66.3	Low	125 Å²	125	124.5 Å²	124.5	81%	0.812	67%	0.673	S	S	*	*			trans	-60.7	120.6	171.6	25	-31.1	0	0	0	107.7	G17	P15-G17 PolarHBondContact O-N 3.43Å
16	E	69.7	Low	67.1	Low	143 Å²	143	121.8 Å²	121.8	67%	0.668	65%	0.652	S	S	*	*			trans	-63.1	102	175.7	-72.8	153.3	173.6	0	0	107.7	S14 R19	S14-E16 PolarHBondContact O-N 2.82Å; S14-E16 VanDerWaalsContact O-N 3.09Å; E16-R19 IonicContact OE2-CZ 2.64Å; E16-R19 IonicContact OE2-NE 3.74Å; E16-R19 IonicContact OE2-NH2 3.94Å; E16-R19 PolarHBondContact OE2-NH2 3.05Å
17	G	70.3	Confident	68.7	Low	47 Å²	47	117 Å²	117	49%	0.485	64%	0.644	S	S	.	*			trans	-59.5	177.6	176.3	0	0	0	0	0	111.7	P15 R19	P15-G17 PolarHBondContact O-N 3.43Å; G17-R19 PolarHBondContact O-N 3.43Å
18	P	66.7	Low	70.4	Confident	134 Å²	134	117 Å²	117	87%	0.87	64%	0.64	S	S	*	*			trans	-54.9	102.4	-179.9	-20.1	30.6	0	0	0	110	Q20	P18-Q20 PolarHBondContact O-N 3.43Å
19	R	69.1	Low	72	Confident	181 Å²	181	116.3 Å²	116.3	68%	0.683	63%	0.627	S	S	*	*			trans	-66.2	111.2	-178.6	-62.3	-173.8	-150.2	156.3	3.1	107	E16 G17 H21	E16-R19 IonicContact OE2-CZ 2.64Å; E16-R19 IonicContact OE2-NE 3.74Å; E16-R19 IonicContact OE2-NH2 3.94Å; E16-R19 PolarHBondContact OE2-NH2 3.05Å; G17-R19 PolarHBondContact O-N 3.43Å; R19-H21 PolarHBondContact O-N 3.46Å
20	Q	71.6	Confident	73.3	Confident	192 Å²	192	114 Å²	114	90%	0.897	62%	0.617	S	S	*	*	P	Polyproline II helix	trans	-62.4	119.2	170.5	-66.9	-177.9	-0.9	0	0	107.2	P18 H22	P18-Q20 PolarHBondContact O-N 3.43Å; Q20-H22 PolarHBondContact O-N 3.13Å
21	H	71.9	Confident	74.9	Confident	94 Å²	94	113.2 Å²	113.2	44%	0.435	61%	0.606	S	S	.	*	P	Polyproline II helix	trans	-60.8	124.6	179.2	-78	-58.4	0	0	0	109.6	R19 E25 V26 R29	R19-H21 PolarHBondContact O-N 3.46Å; H21-E25 IonicContact CE1-OE2 2.74Å; H21-E25 IonicContact CG-OE2 3.82Å; H21-E25 IonicContact ND1-OE2 4Å; H21-E25 PolarHBondContact ND1-OE2 3.5Å; H21-V26 HydrophobicContact CB-CG2 4.1Å; H21-R29 PolarHBondContact CD2-NH1 2.9Å; H21-R29 PolarHBondContact CE1-NH1 3.33Å; H21-R29 PolarHBondContact CE1-NH2 3.06Å; H21-R29 PolarHBondContact NE2-NH1 3.2Å; H21-R29 PolarHBondContact NE2-NH2 3.5Å
22	H	74.6	Confident	76.2	Confident	115 Å²	115	110.6 Å²	110.6	53%	0.532	59%	0.591	S	S	.	*	P	Polyproline II helix	trans	-61	140	175	-169.3	-91.9	0	0	0	108.8	Q20 S24 E25 V26	Q20-H22 PolarHBondContact O-N 3.13Å; H22-S24 PolarHBondContact ND1-N 2.93Å; H22-S24 PolarHBondContact ND1-OG 2.95Å; H22-S24 PolarHBondContact O-N 3.36Å; H22-E25 HydrophobicContact CB-CG 4.34Å; H22-E25 WeakPolarHBondContact O-CB 3.47Å; H22-E25 PolarHBondContact O-N 3.08Å; H22-V26 PolarHBondContact O-N 3.24Å
23	P	77.2	Confident	77.7	Confident	89 Å²	89	105.8 Å²	105.8	58%	0.578	57%	0.572	S	S	*	*	H	α-helix	trans	-56	-25.7	-176.5	19.1	-33.5	0	0	0	114.2	V26 T27	P23-V26 PolarHBondContact O-N 2.91Å; P23-T27 PolarHBondContact O-N 3.47Å; P23-T27 VanDerWaalsContact O-N 3.13Å; P23-T27 PolarHBondContact O-OG1 3.43Å
24	S	76.3	Confident	79.2	Confident	56 Å²	56	107.1 Å²	107.1	39%	0.392	57%	0.568	S	S	.	*	H	α-helix	trans	-63.5	-43.3	171.9	60.4	0	0	0	0	112.3	H22 V26 T27 E28	H22-S24 PolarHBondContact ND1-N 2.93Å; H22-S24 PolarHBondContact ND1-OG 2.95Å; H22-S24 PolarHBondContact O-N 3.36Å; S24-V26 VanDerWaalsContact C-N 3.31Å; S24-V26 PolarHBondContact O-N 2.96Å; S24-T27 WeakPolarHBondContact O-CB 3.42Å; S24-T27 PolarHBondContact O-N 3.27Å; S24-T27 VanDerWaalsContact O-N 3.14Å; S24-E28 WeakPolarHBondContact O-CG 3.08Å; S24-E28 PolarHBondContact O-N 3.23Å
25	E	74.3	Confident	80.7	Confident	81 Å²	81	110.6 Å²	110.6	38%	0.379	57%	0.566	S	S	.	*	H	α-helix	trans	-63.8	-37.7	178.6	-61.3	178.1	-176.8	0	0	111.5	H21 H22 T27 E28 R29	H21-E25 IonicContact CE1-OE2 2.74Å; H21-E25 IonicContact CG-OE2 3.82Å; H21-E25 IonicContact ND1-OE2 4Å; H21-E25 PolarHBondContact ND1-OE2 3.5Å; H22-E25 HydrophobicContact CB-CG 4.34Å; H22-E25 WeakPolarHBondContact O-CB 3.47Å; H22-E25 PolarHBondContact O-N 3.08Å; E25-T27 VanDerWaalsContact C-N 3.33Å; E25-E28 PolarHBondContact O-N 3.24Å; E25-R29 WeakPolarHBondContact O-CG 3.49Å; E25-R29 PolarHBondContact O-N 3.33Å
26	V	77.7	Confident	82.2	Confident	59 Å²	59	109 Å²	109	36%	0.358	55%	0.549	S	S	.	.	H	α-helix	trans	-62.9	-43.4	175.1	179.3	0	0	0	0	110.4	H21 H22 P23 S24 R29 Q30	H21-V26 HydrophobicContact CB-CG2 4.1Å; H22-V26 PolarHBondContact O-N 3.24Å; P23-V26 PolarHBondContact O-N 2.91Å; S24-V26 VanDerWaalsContact C-N 3.31Å; S24-V26 PolarHBondContact O-N 2.96Å; V26-R29 PolarHBondContact O-N 3.1Å; V26-Q30 WeakPolarHBondContact O-CG 3.48Å; V26-Q30 PolarHBondContact O-N 3.34Å
27	T	84	Confident	83.5	Confident	89 Å²	89	107.8 Å²	107.8	55%	0.546	54%	0.544	S	S	.	.	H	α-helix	trans	-63.8	-42.8	178.5	-55	0	0	0	0	111.4	P23 S24 E25 Q30 L31	P23-T27 PolarHBondContact O-N 3.47Å; P23-T27 VanDerWaalsContact O-N 3.13Å; P23-T27 PolarHBondContact O-OG1 3.43Å; S24-T27 WeakPolarHBondContact O-CB 3.42Å; S24-T27 PolarHBondContact O-N 3.27Å; S24-T27 VanDerWaalsContact O-N 3.14Å; E25-T27 VanDerWaalsContact C-N 3.33Å; T27-Q30 PolarHBondContact O-N 3.33Å; T27-L31 PolarHBondContact O-N 2.96Å
28	E	88.3	Confident	84.8	Confident	133 Å²	133	110 Å²	110	62%	0.621	54%	0.544	S	S	*	.	H	α-helix	trans	-63.5	-43.7	176.3	-72.6	178.1	-177.2	0	0	112.3	S24 E25 Q30 L31 A32	S24-E28 WeakPolarHBondContact O-CG 3.08Å; S24-E28 PolarHBondContact O-N 3.23Å; E25-E28 PolarHBondContact O-N 3.24Å; E28-Q30 VanDerWaalsContact C-N 3.34Å; E28-Q30 PolarHBondContact O-N 2.93Å; E28-L31 PolarHBondContact O-N 2.97Å; E28-A32 WeakPolarHBondContact O-CB 3.47Å; E28-A32 PolarHBondContact O-N 3.4Å
29	R	87.6	Confident	86.3	Confident	130 Å²	130	108.7 Å²	108.7	49%	0.491	53%	0.528	S	S	.	.	H	α-helix	trans	-60.5	-43	175.3	-75.4	175.6	179.3	-178.3	0.8	111.9	H21 E25 V26 A32 N33	H21-R29 PolarHBondContact CD2-NH1 2.9Å; H21-R29 PolarHBondContact CE1-NH1 3.33Å; H21-R29 PolarHBondContact CE1-NH2 3.06Å; H21-R29 PolarHBondContact NE2-NH1 3.2Å; H21-R29 PolarHBondContact NE2-NH2 3.5Å; E25-R29 WeakPolarHBondContact O-CG 3.49Å; E25-R29 PolarHBondContact O-N 3.33Å; V26-R29 PolarHBondContact O-N 3.1Å; R29-A32 PolarHBondContact O-N 3.07Å; R29-N33 WeakPolarHBondContact O-CB 3.44Å; R29-N33 VanDerWaalsContact O-CG 3.26Å; R29-N33 PolarHBondContact O-N 3.09Å; R29-N33 PolarHBondContact O-ND2 2.95Å
30	Q	91.1	Very high	87.7	Confident	110 Å²	110	105 Å²	105	51%	0.514	52%	0.519	S	S	.	.	H	α-helix	trans	-62.8	-42.5	176.1	-72.9	177.1	1	0	0	111.9	V26 T27 E28 N33 K34	V26-Q30 WeakPolarHBondContact O-CG 3.48Å; V26-Q30 PolarHBondContact O-N 3.34Å; T27-Q30 PolarHBondContact O-N 3.33Å; E28-Q30 VanDerWaalsContact C-N 3.34Å; E28-Q30 PolarHBondContact O-N 2.93Å; Q30-N33 PolarHBondContact O-N 2.96Å; Q30-K34 WeakPolarHBondContact O-CG 3.42Å; Q30-K34 PolarHBondContact O-N 2.93Å
31	L	94.4	Very high	89	Confident	90 Å²	90	100 Å²	100	47%	0.471	50%	0.498	S	S	.	.	H	α-helix	trans	-62.3	-44.5	175.9	-179.2	63	0	0	0	111.6	T27 E28 N33 K34 R35	T27-L31 PolarHBondContact O-N 2.96Å; E28-L31 PolarHBondContact O-N 2.97Å; L31-N33 VanDerWaalsContact C-N 3.35Å; L31-N33 PolarHBondContact O-N 3.3Å; L31-K34 PolarHBondContact O-N 3.26Å; L31-R35 WeakPolarHBondContact O-CG 3.39Å; L31-R35 PolarHBondContact O-N 3.16Å
32	A	93.9	Very high	90.2	Very high	46 Å²	46	100.1 Å²	100.1	38%	0.38	50%	0.501	S	S	.	.	H	α-helix	trans	-60.1	-45.1	176.7	0	0	0	0	0	111.3	E28 R29 K34 R35 I36	E28-A32 WeakPolarHBondContact O-CB 3.47Å; E28-A32 PolarHBondContact O-N 3.4Å; R29-A32 PolarHBondContact O-N 3.07Å; A32-K34 PolarHBondContact O-N 3.22Å; A32-R35 WeakPolarHBondContact O-CB 3.1Å; A32-R35 PolarHBondContact O-N 2.82Å; A32-R35 VanDerWaalsContact O-N 3.16Å; A32-I36 WeakPolarHBondContact O-CG1 3.38Å; A32-I36 PolarHBondContact O-N 3.47Å
33	N	96.3	Very high	91.3	Very high	93 Å²	93	102 Å²	102	50%	0.497	51%	0.508	S	S	.	.	H	α-helix	trans	-60.7	-43.3	177.1	-73.6	-20.3	0	0	0	112.3	R29 Q30 L31 R35 I36 Q37	R29-N33 WeakPolarHBondContact O-CB 3.44Å; R29-N33 VanDerWaalsContact O-CG 3.26Å; R29-N33 PolarHBondContact O-N 3.09Å; R29-N33 PolarHBondContact O-ND2 2.95Å; Q30-N33 PolarHBondContact O-N 2.96Å; L31-N33 VanDerWaalsContact C-N 3.35Å; L31-N33 PolarHBondContact O-N 3.3Å; N33-R35 VanDerWaalsContact C-N 3.33Å; N33-R35 PolarHBondContact O-N 3.44Å; N33-I36 PolarHBondContact O-N 3.26Å; N33-Q37 WeakPolarHBondContact O-CG 3.45Å; N33-Q37 PolarHBondContact O-N 2.98Å
34	K	97	Very high	92.3	Very high	146 Å²	146	104 Å²	104	64%	0.635	51%	0.508	S	S	*	.	H	α-helix	trans	-59.9	-42.4	174.6	-74.9	-179.8	179	178.8	0	111.8	Q30 L31 A32 Q37 N38	Q30-K34 WeakPolarHBondContact O-CG 3.42Å; Q30-K34 PolarHBondContact O-N 2.93Å; L31-K34 PolarHBondContact O-N 3.26Å; A32-K34 PolarHBondContact O-N 3.22Å; K34-Q37 PolarHBondContact O-N 3.43Å; K34-N38 WeakPolarHBondContact O-CB 3.43Å; K34-N38 PolarHBondContact O-N 2.99Å
35	R	97	Very high	93.3	Very high	170 Å²	170	105.1 Å²	105.1	64%	0.642	51%	0.507	S	S	*	.	H	α-helix	trans	-62.4	-44.8	175.9	-71.5	177.1	176.2	-174.3	0.2	111.6	L31 A32 N33 N38 M39	L31-R35 WeakPolarHBondContact O-CG 3.39Å; L31-R35 PolarHBondContact O-N 3.16Å; A32-R35 WeakPolarHBondContact O-CB 3.1Å; A32-R35 PolarHBondContact O-N 2.82Å; A32-R35 VanDerWaalsContact O-N 3.16Å; N33-R35 VanDerWaalsContact C-N 3.33Å; N33-R35 PolarHBondContact O-N 3.44Å; R35-N38 PolarHBondContact O-N 3.01Å; R35-M39 WeakPolarHBondContact O-CG 3.44Å; R35-M39 PolarHBondContact O-N 2.94Å
36	I	97.4	Very high	94.4	Very high	90 Å²	90	108 Å²	108	46%	0.462	52%	0.518	S	S	.	.	H	α-helix	trans	-60.4	-48.9	177.8	-68.3	165.7	0	0	0	110.7	A32 N33 N38 M39 Q40	A32-I36 WeakPolarHBondContact O-CG1 3.38Å; A32-I36 PolarHBondContact O-N 3.47Å; N33-I36 PolarHBondContact O-N 3.26Å; I36-N38 VanDerWaalsContact C-N 3.34Å; I36-N38 PolarHBondContact O-N 3.46Å; I36-M39 PolarHBondContact O-N 2.96Å; I36-Q40 WeakPolarHBondContact O-CG 3.41Å; I36-Q40 PolarHBondContact O-N 2.87Å
37	Q	97.8	Very high	95.3	Very high	119 Å²	119	113.6 Å²	113.6	56%	0.556	53%	0.532	S	S	*	.	H	α-helix	trans	-59.7	-44	178.2	-73.7	179.7	-12.1	0	0	111.9	N33 K34 M39 Q40 N41	N33-Q37 WeakPolarHBondContact O-CG 3.45Å; N33-Q37 PolarHBondContact O-N 2.98Å; K34-Q37 PolarHBondContact O-N 3.43Å; Q37-M39 PolarHBondContact O-N 3.09Å; Q37-Q40 PolarHBondContact O-N 2.77Å; Q37-N41 PolarHBondContact O-N 3.35Å
38	N	97.8	Very high	95.9	Very high	92 Å²	92	114.8 Å²	114.8	49%	0.492	53%	0.527	S	S	.	.	H	α-helix	trans	-59.1	-48.3	176.3	-174.2	27.1	0	0	0	111.6	K34 R35 I36 Q40 N41 L42	K34-N38 WeakPolarHBondContact O-CB 3.43Å; K34-N38 PolarHBondContact O-N 2.99Å; R35-N38 PolarHBondContact O-N 3.01Å; I36-N38 VanDerWaalsContact C-N 3.34Å; I36-N38 PolarHBondContact O-N 3.46Å; N38-Q40 VanDerWaalsContact C-N 3.3Å; N38-Q40 PolarHBondContact O-N 3.34Å; N38-N41 WeakPolarHBondContact O-CB 3.34Å; N38-N41 PolarHBondContact O-N 3.09Å; N38-N41 VanDerWaalsContact O-N 3.09Å; N38-L42 WeakPolarHBondContact O-CG 3.43Å; N38-L42 PolarHBondContact O-N 3.45Å
39	M	98.1	Very high	96.1	Very high	107 Å²	107	111.7 Å²	111.7	53%	0.527	51%	0.514	S	S	.	.	H	α-helix	trans	-61.4	-37.1	178.4	-71.7	-58.3	-64.1	0	0	112.8	R35 I36 Q37 L42 K43	R35-M39 WeakPolarHBondContact O-CG 3.44Å; R35-M39 PolarHBondContact O-N 2.94Å; I36-M39 PolarHBondContact O-N 2.96Å; Q37-M39 PolarHBondContact O-N 3.09Å; M39-L42 HydrophobicContact SD-CD1 4.15Å; M39-K43 WeakPolarHBondContact O-CG 3.27Å; M39-K43 PolarHBondContact O-N 2.64Å; M39-K43 VanDerWaalsContact O-N 3.1Å
40	Q	98	Very high	96.4	Very high	105 Å²	105	109.9 Å²	109.9	49%	0.491	51%	0.514	S	S	.	.	H	α-helix	trans	-64.6	-41.3	173.9	-71.7	177.9	2.3	0	0	112	I36 Q37 N38 K43 K44	I36-Q40 WeakPolarHBondContact O-CG 3.41Å; I36-Q40 PolarHBondContact O-N 2.87Å; Q37-Q40 PolarHBondContact O-N 2.77Å; N38-Q40 VanDerWaalsContact C-N 3.3Å; N38-Q40 PolarHBondContact O-N 3.34Å; Q40-K43 PolarHBondContact O-N 3.09Å; Q40-K44 WeakPolarHBondContact O-CG 3.36Å; Q40-K44 PolarHBondContact O-N 2.8Å
41	N	98.2	Very high	96.4	Very high	86 Å²	86	111.1 Å²	111.1	46%	0.46	52%	0.518	S	S	.	.	H	α-helix	trans	-64	-44.6	176.9	-71.9	-17.4	0	0	0	111.6	Q37 N38 K43 K44 E45	Q37-N41 PolarHBondContact O-N 3.35Å; N38-N41 WeakPolarHBondContact O-CB 3.34Å; N38-N41 PolarHBondContact O-N 3.09Å; N38-N41 VanDerWaalsContact O-N 3.09Å; N41-K43 VanDerWaalsContact C-N 3.3Å; N41-K43 PolarHBondContact O-N 3.06Å; N41-K44 WeakPolarHBondContact O-CB 3.45Å; N41-K44 PolarHBondContact O-N 3.43Å; N41-K44 VanDerWaalsContact O-N 3.09Å; N41-E45 PolarHBondContact O-N 2.74Å
42	L	98.1	Very high	96.1	Very high	97 Å²	97	114.2 Å²	114.2	51%	0.508	52%	0.523	S	S	.	.	H	α-helix	trans	-58.7	-40.8	175.2	-68.6	174.6	0	0	0	112.2	N38 M39 K44 E45 K46	N38-L42 WeakPolarHBondContact O-CG 3.43Å; N38-L42 PolarHBondContact O-N 3.45Å; M39-L42 HydrophobicContact SD-CD1 4.15Å; L42-K44 PolarHBondContact O-N 3.38Å; L42-E45 PolarHBondContact O-N 3.36Å; L42-K46 WeakPolarHBondContact O-CB 3.47Å; L42-K46 PolarHBondContact O-N 2.89Å
43	K	97.9	Very high	95.8	Very high	154 Å²	154	119.9 Å²	119.9	67%	0.67	54%	0.54	S	S	*	.	H	α-helix	trans	-62.3	-41.4	174.5	-76.1	-179	178.7	-177.5	0	112.3	M39 Q40 N41 R47	M39-K43 WeakPolarHBondContact O-CG 3.27Å; M39-K43 PolarHBondContact O-N 2.64Å; M39-K43 VanDerWaalsContact O-N 3.1Å; Q40-K43 PolarHBondContact O-N 3.09Å; N41-K43 VanDerWaalsContact C-N 3.3Å; N41-K43 PolarHBondContact O-N 3.06Å; K43-R47 PolarHBondContact O-N 3.45Å
44	K	98	Very high	95.3	Very high	132 Å²	132	119.2 Å²	119.2	57%	0.574	55%	0.547	S	S	*	.	H	α-helix	trans	-63.5	-45.6	176.6	-71.3	174	-177.1	174.2	0	111.3	Q40 N41 L42 R47 R48	Q40-K44 WeakPolarHBondContact O-CG 3.36Å; Q40-K44 PolarHBondContact O-N 2.8Å; N41-K44 WeakPolarHBondContact O-CB 3.45Å; N41-K44 PolarHBondContact O-N 3.43Å; N41-K44 VanDerWaalsContact O-N 3.09Å; L42-K44 PolarHBondContact O-N 3.38Å; K44-R47 WeakPolarHBondContact O-CB 3.48Å; K44-R47 PolarHBondContact O-N 3.34Å; K44-R48 PolarHBondContact O-N 2.95Å
45	E	97.3	Very high	94.5	Very high	79 Å²	79	122 Å²	122	37%	0.369	55%	0.554	S	S	.	*	H	α-helix	trans	-62	-46.3	178.3	-76.1	-56.7	127.5	0	0	112.1	N41 L42 R47 R48 L49	N41-E45 PolarHBondContact O-N 2.74Å; L42-E45 PolarHBondContact O-N 3.36Å; E45-R47 VanDerWaalsContact C-N 3.3Å; E45-R47 PolarHBondContact O-N 3Å; E45-R48 WeakPolarHBondContact O-CB 3.48Å; E45-R48 PolarHBondContact O-N 3.38Å; E45-R48 VanDerWaalsContact O-N 3.13Å; E45-R48 IonicContact OE1-CZ 3.54Å; E45-R48 IonicContact OE1-NE 3.64Å; E45-R48 IonicContact OE1-NH1 3.69Å; E45-R48 IonicContact OE1-NH2 2.8Å; E45-R48 IonicContact OE2-CZ 2.99Å; E45-R48 IonicContact OE2-NE 3.07Å; E45-R48 PolarHBondContact OE2-NE 3.44Å; E45-R48 VanDerWaalsContact OE2-NE 3.07Å; E45-R48 IonicContact OE2-NH1 3.87Å; E45-R48 IonicContact OE2-NH2 3.79Å; E45-R48 PolarHBondContact OE2-NH2 3.03Å; E45-L49 WeakPolarHBondContact O-CG 3.47Å; E45-L49 PolarHBondContact O-N 3.31Å
46	K	97.4	Very high	93.6	Very high	141 Å²	141	119.1 Å²	119.1	61%	0.613	56%	0.557	S	S	*	*	H	α-helix	trans	-55.9	-44.7	173.2	-175.1	178.4	-179.9	174.8	0	111.6	L42 R48 L49 N50	L42-K46 WeakPolarHBondContact O-CB 3.47Å; L42-K46 PolarHBondContact O-N 2.89Å; K46-R48 PolarHBondContact O-N 2.99Å; K46-L49 PolarHBondContact O-N 3.01Å; K46-N50 WeakPolarHBondContact O-CB 3.33Å; K46-N50 VanDerWaalsContact O-CG 3.29Å; K46-N50 PolarHBondContact O-N 3.45Å
47	R	96.1	Very high	92.4	Very high	176 Å²	176	119.7 Å²	119.7	66%	0.664	57%	0.569	S	S	*	*	H	α-helix	trans	-63.6	-41.3	177.6	-170.2	179.5	-172	-174.9	3.3	111.9	K43 K44 E45 K51	K43-R47 PolarHBondContact O-N 3.45Å; K44-R47 WeakPolarHBondContact O-CB 3.48Å; K44-R47 PolarHBondContact O-N 3.34Å; E45-R47 VanDerWaalsContact C-N 3.3Å; E45-R47 PolarHBondContact O-N 3Å; R47-K51 WeakPolarHBondContact O-CG 3.43Å; R47-K51 PolarHBondContact O-N 3.17Å; R47-K51 VanDerWaalsContact O-N 3.08Å
48	R	95.4	Very high	91.4	Very high	115 Å²	115	119.8 Å²	119.8	43%	0.434	58%	0.58	S	S	.	*	H	α-helix	trans	-61.4	-47.6	177.4	-175.5	-178.3	73.6	160.5	3.3	111.1	K44 E45 K46 K51 R52	K44-R48 PolarHBondContact O-N 2.95Å; E45-R48 WeakPolarHBondContact O-CB 3.48Å; E45-R48 PolarHBondContact O-N 3.38Å; E45-R48 VanDerWaalsContact O-N 3.13Å; E45-R48 IonicContact OE1-CZ 3.54Å; E45-R48 IonicContact OE1-NE 3.64Å; E45-R48 IonicContact OE1-NH1 3.69Å; E45-R48 IonicContact OE1-NH2 2.8Å; E45-R48 IonicContact OE2-CZ 2.99Å; E45-R48 IonicContact OE2-NE 3.07Å; E45-R48 PolarHBondContact OE2-NE 3.44Å; E45-R48 VanDerWaalsContact OE2-NE 3.07Å; E45-R48 IonicContact OE2-NH1 3.87Å; E45-R48 IonicContact OE2-NH2 3.79Å; E45-R48 PolarHBondContact OE2-NH2 3.03Å; K46-R48 PolarHBondContact O-N 2.99Å; R48-K51 PolarHBondContact O-N 3.02Å; R48-R52 PolarHBondContact O-N 3.24Å
49	L	94.2	Very high	90.2	Very high	67 Å²	67	123.1 Å²	123.1	35%	0.351	60%	0.596	S	S	.	*	H	α-helix	trans	-64.3	-46.6	178.3	-69.7	176.1	0	0	0	111.5	E45 K46 K51 R52 F53	E45-L49 WeakPolarHBondContact O-CG 3.47Å; E45-L49 PolarHBondContact O-N 3.31Å; K46-L49 PolarHBondContact O-N 3.01Å; L49-K51 VanDerWaalsContact C-N 3.26Å; L49-K51 PolarHBondContact O-N 3.38Å; L49-R52 WeakPolarHBondContact O-CA 3.32Å; L49-R52 WeakPolarHBondContact O-CB 3.38Å; L49-R52 PolarHBondContact O-N 2.89Å; L49-F53 HydrophobicContact CB-CD2 4.23Å; L49-F53 HydrophobicContact CB-CE2 3.99Å; L49-F53 HydrophobicContact CD2-CE2 4.26Å; L49-F53 WeakPolarHBondContact O-CD2 3.44Å; L49-F53 PolarHBondContact O-N 3.48Å
50	N	93.6	Very high	89	Confident	92 Å²	92	120.7 Å²	120.7	49%	0.492	59%	0.588	S	S	.	*	H	α-helix	trans	-55.8	-40.9	176.2	-78	-1.5	0	0	0	112.1	K46 R52 F53 A54	K46-N50 WeakPolarHBondContact O-CB 3.33Å; K46-N50 VanDerWaalsContact O-CG 3.29Å; K46-N50 PolarHBondContact O-N 3.45Å; N50-R52 VanDerWaalsContact C-N 3.31Å; N50-R52 PolarHBondContact O-N 3.37Å; N50-F53 PolarHBondContact O-N 3.02Å; N50-A54 WeakPolarHBondContact O-CB 3.46Å; N50-A54 PolarHBondContact O-N 3.23Å
51	K	90.8	Very high	88.1	Confident	137 Å²	137	123 Å²	123	60%	0.596	60%	0.599	S	S	*	*	H	α-helix	trans	-63.8	-34.8	175.4	-74.3	-176.4	177.7	-168.4	0	113.2	R47 R48 L49 R55	R47-K51 WeakPolarHBondContact O-CG 3.43Å; R47-K51 PolarHBondContact O-N 3.17Å; R47-K51 VanDerWaalsContact O-N 3.08Å; R48-K51 PolarHBondContact O-N 3.02Å; L49-K51 VanDerWaalsContact C-N 3.26Å; L49-K51 PolarHBondContact O-N 3.38Å; K51-R55 PolarHBondContact O-N 3.14Å
52	R	87.6	Confident	87	Confident	154 Å²	154	125.5 Å²	125.5	58%	0.581	62%	0.62	S	S	*	*	H	α-helix	trans	-69.8	-45.9	177.5	-69.8	177.8	179.3	-175.9	-1.9	110.9	R48 L49 N50 R55	R48-R52 PolarHBondContact O-N 3.24Å; L49-R52 WeakPolarHBondContact O-CA 3.32Å; L49-R52 WeakPolarHBondContact O-CB 3.38Å; L49-R52 PolarHBondContact O-N 2.89Å; N50-R52 VanDerWaalsContact C-N 3.31Å; N50-R52 PolarHBondContact O-N 3.37Å; R52-R55 WeakPolarHBondContact O-CB 3.46Å; R52-R55 PolarHBondContact O-N 3.13Å
53	F	87.2	Confident	85.5	Confident	166 Å²	166	124.4 Å²	124.4	73%	0.728	63%	0.632	S	S	*	*	H	α-helix	trans	-76.5	-28.8	-178.6	-63.8	-59.7	0	0	0	113.7	L49 N50 R55	L49-F53 HydrophobicContact CB-CD2 4.23Å; L49-F53 HydrophobicContact CB-CE2 3.99Å; L49-F53 HydrophobicContact CD2-CE2 4.26Å; L49-F53 WeakPolarHBondContact O-CD2 3.44Å; L49-F53 PolarHBondContact O-N 3.48Å; N50-F53 PolarHBondContact O-N 3.02Å; F53-R55 PolarHBondContact O-N 3.4Å
54	A	86.3	Confident	84	Confident	78 Å²	78	122.3 Å²	122.3	65%	0.645	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.5	-7.4	174.9	0	0	0	0	0	113.1	N50 P56	N50-A54 WeakPolarHBondContact O-CB 3.46Å; N50-A54 PolarHBondContact O-N 3.23Å; A54-P56 WeakPolarHBondContact O-CD 3.4Å
55	R	80.9	Confident	82.4	Confident	205 Å²	205	123.7 Å²	123.7	77%	0.774	64%	0.641	S	S	*	*	S	Bend	trans	-72.3	112.8	176.6	-163.5	174.3	-174.1	178	0.8	107.3	K51 R52 F53	K51-R55 PolarHBondContact O-N 3.14Å; R52-R55 WeakPolarHBondContact O-CB 3.46Å; R52-R55 PolarHBondContact O-N 3.13Å; F53-R55 PolarHBondContact O-N 3.4Å
56	P	77	Confident	80.8	Confident	109 Å²	109	129.6 Å²	129.6	71%	0.708	66%	0.66	S	S	*	*	P	Polyproline II helix	trans	-60.9	150.7	176.6	27.2	-33.6	0	0	0	109.1	A54	A54-P56 WeakPolarHBondContact O-CD 3.4Å
57	S	72.9	Confident	79.1	Confident	102 Å²	102	128.5 Å²	128.5	71%	0.713	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-50.2	137.8	170.6	-60.6	0	0	0	0	109.1	I59	S57-I59 PolarHBondContact O-N 3.48Å
58	P	76.6	Confident	77.1	Confident	121 Å²	121	129 Å²	129	79%	0.786	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-54.2	133.2	177.5	23.4	-31.9	0	0	0	108.8
59	I	72.3	Confident	76.2	Confident	162 Å²	162	129.8 Å²	129.8	83%	0.831	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-61.1	126	174.3	-57.6	174.9	0	0	0	106	S57	S57-I59 PolarHBondContact O-N 3.48Å
60	P	73.6	Confident	75.3	Confident	57 Å²	57	133.1 Å²	133.1	37%	0.37	73%	0.733	S	S	.	*	P	Polyproline II helix	trans	-58.1	147.5	178.9	22.6	-31.2	0	0	0	110	W66	P60-W66 HydrophobicContact CB-CZ2 4.45Å; P60-W66 HydrophobicContact CG-CZ2 4.34Å
61	E	79.3	Confident	74.3	Confident	152 Å²	152	135.3 Å²	135.3	71%	0.71	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-53.8	137	-179.3	-120.6	-171.4	178.9	0	0	110.6	G63 L64	E61-G63 PolarHBondContact O-N 3.42Å; E61-L64 HydrophobicContact CB-CD1 4.42Å; E61-L64 PolarHBondContact O-N 2.95Å
62	P	74.1	Confident	73.3	Confident	139 Å²	139	135.2 Å²	135.2	90%	0.903	76%	0.755	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.4	98.1	177	-18.4	30.2	0	0	0	110
63	G	67.5	Low	72.4	Confident	74 Å²	74	134.1 Å²	134.1	76%	0.763	77%	0.766	S	S	*	*	T	Hydrogen-bonded Turn	trans	139	-22	-176	0	0	0	0	0	114.6	E61 L65	E61-G63 PolarHBondContact O-N 3.42Å; G63-L65 PolarHBondContact O-N 2.8Å
64	L	66.1	Low	71.4	Confident	110 Å²	110	131.9 Å²	131.9	58%	0.576	77%	0.769	S	S	*	*			trans	-83.7	86.4	168.2	-98.3	93.7	0	0	0	109.5	E61 W66	E61-L64 HydrophobicContact CB-CD1 4.42Å; E61-L64 PolarHBondContact O-N 2.95Å; L64-W66 PolarHBondContact O-N 2.98Å
65	L	65.2	Low	70.3	Confident	162 Å²	162	135.8 Å²	135.8	85%	0.848	78%	0.778	S	S	*	*			trans	-60.3	116.7	162.9	-76.6	161	0	0	0	107.9	G63 S67	G63-L65 PolarHBondContact O-N 2.8Å; L65-S67 PolarHBondContact O-N 3.39Å; L65-S67 VanDerWaalsContact O-N 3.1Å
66	W	62.1	Low	69.5	Low	202 Å²	202	130.5 Å²	130.5	77%	0.765	78%	0.778	S	S	*	*			trans	-68.3	107.3	164.5	-71.4	5.4	0	0	0	106.7	P60 L64 S68	P60-W66 HydrophobicContact CB-CZ2 4.45Å; P60-W66 HydrophobicContact CG-CZ2 4.34Å; L64-W66 PolarHBondContact O-N 2.98Å; W66-S68 PolarHBondContact O-N 2.88Å
67	S	61.7	Low	68.9	Low	118 Å²	118	132.3 Å²	132.3	83%	0.825	78%	0.784	S	S	*	*			trans	-57.2	119.6	165.2	-34.5	0	0	0	0	107.2	L65	L65-S67 PolarHBondContact O-N 3.39Å; L65-S67 VanDerWaalsContact O-N 3.1Å
68	S	55.5	Low	68.5	Low	188 Å²	188	135 Å²	135	100%	1.315	79%	0.79	S	S	*	*			trans	-57	0	174.2	57.2	0	0	0	0	112.5	W66	W66-S68 PolarHBondContact O-N 2.88Å

Retrieved 68 of 68 residues in 40.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).