A0A096MWN8_PAPAN Loading...

U6 snRNA-associated Sm-like protein LSm3

Binds specifically to the 3'-terminal U-tract of U6 snRNA. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB (P62310), UniProt , Accession A0A096MWN8, Species PAPAN (Papio anubis, Olive baboon), Gene LSM3, Length 102 aa.

						>A0A096MWN8_PAPAN|A0A096MWN8|LSM3
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.5	Low	55.5	Low	243 Å²	243	147.4 Å²	147.4	100%	1.197	79%	0.793	S	S	*	*				0	133.5	0	-75.6	-176.2	174	0	0	106.3
2	A	54.5	Low	56.8	Low	98 Å²	98	147 Å²	147	81%	0.81	79%	0.79	S	S	*	*			trans	83.2	83	-155.9	0	0	0	0	0	111.3	D4	A2-D4 PolarHBondContact O-N 3.29Å
3	D	55.8	Low	58.7	Low	157 Å²	157	141 Å²	141	84%	0.84	76%	0.762	S	S	*	*			trans	-55.8	125.3	155.3	-62.2	-45.4	0	0	0	106.5	V5	D3-V5 VanDerWaalsContact C-N 3.35Å; D3-V5 PolarHBondContact O-N 2.91Å
4	D	52.3	Low	60.7	Low	155 Å²	155	136.6 Å²	136.6	83%	0.829	74%	0.742	S	S	*	*			trans	-54.2	103.8	171.3	-77.2	-52.3	0	0	0	107	A2 D6	A2-D4 PolarHBondContact O-N 3.29Å; D4-D6 VanDerWaalsContact C-N 3.27Å; D4-D6 PolarHBondContact O-N 3.34Å
5	V	54.2	Low	62.8	Low	126 Å²	126	137.7 Å²	137.7	76%	0.764	74%	0.74	S	S	*	*			trans	-61.9	100.3	168.3	-81.1	0	0	0	0	105.2	D3 Q7	D3-V5 VanDerWaalsContact C-N 3.35Å; D3-V5 PolarHBondContact O-N 2.91Å; V5-Q7 PolarHBondContact O-N 3.38Å
6	D	51.7	Low	64.6	Low	149 Å²	149	135.6 Å²	135.6	80%	0.797	72%	0.724	S	S	*	*			trans	-48.5	97.7	167.5	-83.3	-42.3	0	0	0	106.6	D4 Q8	D4-D6 VanDerWaalsContact C-N 3.27Å; D4-D6 PolarHBondContact O-N 3.34Å; D6-Q8 PolarHBondContact O-N 3.13Å
7	Q	53.3	Low	66.1	Low	174 Å²	174	134.2 Å²	134.2	81%	0.813	73%	0.725	S	S	*	*			trans	-64.5	93.6	163.5	-70.1	178.7	19.1	0	0	102.5	V5 Q9	V5-Q7 PolarHBondContact O-N 3.38Å; Q7-Q9 PolarHBondContact O-N 2.61Å
8	Q	54.9	Low	67.5	Low	175 Å²	175	129.4 Å²	129.4	82%	0.818	70%	0.698	S	S	*	*			trans	-55	92.8	167.5	-78.5	176.5	-26.3	0	0	105.2	D6 T10	D6-Q8 PolarHBondContact O-N 3.13Å; Q8-T10 PolarHBondContact O-N 2.97Å
9	Q	55.2	Low	68.8	Low	177 Å²	177	122.9 Å²	122.9	83%	0.827	66%	0.663	S	S	*	*			trans	-62.3	98.9	172.8	-162.2	167.7	30.3	0	0	102.5	Q7 T11	Q7-Q9 PolarHBondContact O-N 2.61Å; Q9-T11 VanDerWaalsContact C-N 3.27Å; Q9-T11 PolarHBondContact O-N 2.69Å
10	T	58.6	Low	70	Confident	99 Å²	99	120.9 Å²	120.9	61%	0.607	65%	0.652	S	S	*	*			trans	-60.8	98.9	-175.5	49.6	0	0	0	0	106.1	Q8 N12	Q8-T10 PolarHBondContact O-N 2.97Å; T10-N12 PolarHBondContact O-N 3.46Å
11	T	65.5	Low	71.1	Confident	68 Å²	68	116 Å²	116	42%	0.417	63%	0.625	S	S	.	*			trans	-62.3	137.6	176.6	45	0	0	0	0	106.5	Q9 T13	Q9-T11 VanDerWaalsContact C-N 3.27Å; Q9-T11 PolarHBondContact O-N 2.69Å; T11-T13 WeakPolarHBondContact CB-OG1 3.4Å; T11-T13 PolarHBondContact O-N 2.9Å; T11-T13 PolarHBondContact OG1-OG1 2.86Å
12	N	71.2	Confident	73	Confident	143 Å²	143	107.9 Å²	107.9	77%	0.765	58%	0.581	S	S	*	*	S	Bend	trans	-71.4	14.1	171.3	-74.6	-20.1	0	0	0	111.7	T10	T10-N12 PolarHBondContact O-N 3.46Å
13	T	81.9	Confident	74.8	Confident	69 Å²	69	105.2 Å²	105.2	42%	0.423	55%	0.553	S	S	.	*			trans	-81	141.9	174.8	50.3	0	0	0	0	109.1	T11 E15	T11-T13 WeakPolarHBondContact CB-OG1 3.4Å; T11-T13 PolarHBondContact O-N 2.9Å; T11-T13 PolarHBondContact OG1-OG1 2.86Å; T13-E15 PolarHBondContact OG1-OE1 3.4Å; T13-E15 VanDerWaalsContact OG1-OE1 3.13Å
14	V	86.9	Confident	76.6	Confident	79 Å²	79	97.8 Å²	97.8	48%	0.479	51%	0.513	S	S	.	.			trans	-90.8	110.8	170.1	178.6	0	0	0	0	106.6	D19 L20 L23	V14-D19 HydrophobicContact CG1-CB 4.38Å; V14-L20 HydrophobicContact CG1-CD2 4.06Å; V14-L20 HydrophobicContact CG1-CG 3.99Å; V14-L20 HydrophobicContact CG2-CD2 3.77Å; V14-L20 HydrophobicContact CG2-CG 4.47Å; V14-L23 HydrophobicContact CG2-CD1 3.61Å
15	E	91.3	Very high	78.7	Confident	153 Å²	153	93.7 Å²	93.7	72%	0.715	49%	0.491	S	S	*	.			trans	-106.7	-36.5	178.8	-66.8	179.1	-165.4	0	0	110.6	T13 D19	T13-E15 PolarHBondContact OG1-OE1 3.4Å; T13-E15 VanDerWaalsContact OG1-OE1 3.13Å; E15-D19 PolarHBondContact N-OD2 2.96Å
16	E	91.9	Very high	80.7	Confident	104 Å²	104	92.3 Å²	92.3	49%	0.486	48%	0.48	S	S	.	.	S	Bend	trans	-128.1	158.8	175.8	61	176	-167.1	0	0	112.7	L18 D19	E16-L18 HydrophobicContact CG-CB 4.47Å; E16-L18 PolarHBondContact O-N 2.91Å; E16-L18 VanDerWaalsContact O-N 3.13Å; E16-D19 WeakPolarHBondContact CG-OD2 3.3Å; E16-D19 PolarHBondContact N-OD2 2.79Å; E16-D19 VanDerWaalsContact O-CB 3.3Å; E16-D19 WeakPolarHBondContact O-CB 3.36Å; E16-D19 PolarHBondContact O-N 2.87Å
17	P	90.1	Very high	82.8	Confident	113 Å²	113	88.5 Å²	88.5	73%	0.734	46%	0.457	S	S	*	.	H	α-helix	trans	-55.8	-32.6	-179.3	-27.4	35.8	0	0	0	114.3	D19 L20	P17-D19 VanDerWaalsContact C-N 3.26Å; P17-D19 PolarHBondContact O-N 2.85Å; P17-L20 WeakPolarHBondContact O-CB 3.45Å; P17-L20 PolarHBondContact O-N 2.86Å
18	L	92.3	Very high	84.8	Confident	47 Å²	47	86 Å²	86	25%	0.246	44%	0.44	C	S	.	.	H	α-helix	trans	-69.8	-23	-179.9	-167.1	63.6	0	0	0	112.6	E16 L20 I21 R22 Y46 L50	E16-L18 HydrophobicContact CG-CB 4.47Å; E16-L18 PolarHBondContact O-N 2.91Å; E16-L18 VanDerWaalsContact O-N 3.13Å; L18-L20 PolarHBondContact O-N 2.88Å; L18-I21 HydrophobicContact CD1-CB 4.27Å; L18-I21 HydrophobicContact CD1-CG1 4.22Å; L18-I21 WeakPolarHBondContact O-CB 3.48Å; L18-I21 PolarHBondContact O-N 2.84Å; L18-R22 PolarHBondContact O-N 2.89Å; L18-Y46 HydrophobicContact CD1-CD2 4.06Å; L18-Y46 HydrophobicContact CD1-CE2 3.72Å; L18-Y46 HydrophobicContact CD2-CE2 4.16Å; L18-Y46 HydrophobicContact CG-CE2 3.85Å; L18-L50 HydrophobicContact CD1-CD2 3.94Å
19	D	92	Very high	86.9	Confident	7 Å²	7	77.9 Å²	77.9	4%	0.037	40%	0.402	C	S	.	.	H	α-helix	trans	-61.4	-31.7	174.8	-67.9	-35.6	0	0	0	111.5	V14 E15 E16 P17 I21 R22 L23	V14-D19 HydrophobicContact CG1-CB 4.38Å; E15-D19 PolarHBondContact N-OD2 2.96Å; E16-D19 WeakPolarHBondContact CG-OD2 3.3Å; E16-D19 PolarHBondContact N-OD2 2.79Å; E16-D19 VanDerWaalsContact O-CB 3.3Å; E16-D19 WeakPolarHBondContact O-CB 3.36Å; E16-D19 PolarHBondContact O-N 2.87Å; P17-D19 VanDerWaalsContact C-N 3.26Å; P17-D19 PolarHBondContact O-N 2.85Å; D19-I21 VanDerWaalsContact C-N 3.26Å; D19-I21 PolarHBondContact O-N 2.71Å; D19-R22 WeakPolarHBondContact O-CB 3.32Å; D19-R22 PolarHBondContact O-N 3.4Å; D19-R22 IonicContact OD1-CZ 2.67Å; D19-R22 IonicContact OD1-NE 3.68Å; D19-R22 IonicContact OD1-NH1 2.67Å; D19-R22 PolarHBondContact OD1-NH1 2.83Å; D19-R22 IonicContact OD1-NH2 2.65Å; D19-R22 PolarHBondContact OD1-NH2 2.92Å; D19-R22 VanDerWaalsContact OD1-NH2 3.09Å; D19-L23 WeakPolarHBondContact O-CB 3.39Å; D19-L23 WeakPolarHBondContact O-CG 3.47Å; D19-L23 PolarHBondContact O-N 2.82Å
20	L	92	Very high	88.9	Confident	82 Å²	82	72.1 Å²	72.1	43%	0.429	37%	0.373	S	S	.	.	H	α-helix	trans	-62.3	-36.6	175	-68.4	172.3	0	0	0	111.9	V14 P17 L18 S24	V14-L20 HydrophobicContact CG1-CD2 4.06Å; V14-L20 HydrophobicContact CG1-CG 3.99Å; V14-L20 HydrophobicContact CG2-CD2 3.77Å; V14-L20 HydrophobicContact CG2-CG 4.47Å; P17-L20 WeakPolarHBondContact O-CB 3.45Å; P17-L20 PolarHBondContact O-N 2.86Å; L18-L20 PolarHBondContact O-N 2.88Å; L20-S24 PolarHBondContact O-N 2.66Å; L20-S24 PolarHBondContact O-OG 3.26Å
21	I	94.1	Very high	90.8	Very high	18 Å²	18	67.4 Å²	67.4	9%	0.092	34%	0.344	C	S	.	.	H	α-helix	trans	-71.1	-43.8	175.5	-51.9	-57.9	0	0	0	109.8	L18 D19 L23 S24 L25 L43 Y46 L50 M52 V95	L18-I21 HydrophobicContact CD1-CB 4.27Å; L18-I21 HydrophobicContact CD1-CG1 4.22Å; L18-I21 WeakPolarHBondContact O-CB 3.48Å; L18-I21 PolarHBondContact O-N 2.84Å; D19-I21 VanDerWaalsContact C-N 3.26Å; D19-I21 PolarHBondContact O-N 2.71Å; I21-L23 VanDerWaalsContact C-N 3.3Å; I21-L23 PolarHBondContact O-N 2.78Å; I21-S24 WeakPolarHBondContact O-CB 3.41Å; I21-S24 PolarHBondContact O-N 2.78Å; I21-L25 PolarHBondContact O-N 2.86Å; I21-L43 HydrophobicContact CG2-CD2 3.88Å; I21-Y46 HydrophobicContact CG2-CD1 3.94Å; I21-Y46 HydrophobicContact CG2-CD2 3.8Å; I21-Y46 HydrophobicContact CG2-CE1 4.37Å; I21-Y46 HydrophobicContact CG2-CE2 4.23Å; I21-Y46 HydrophobicContact CG2-CG 3.66Å; I21-L50 HydrophobicContact CG1-CD2 4.07Å; I21-M52 HydrophobicContact CG2-CE 4.1Å; I21-V95 HydrophobicContact CD1-CB 3.8Å; I21-V95 HydrophobicContact CD1-CG1 3.64Å; I21-V95 HydrophobicContact CD1-CG2 4.27Å
22	R	93	Very high	92.3	Very high	73 Å²	73	65.8 Å²	65.8	28%	0.275	33%	0.331	S	S	.	.	H	α-helix	trans	-55.1	-47	175	-167.5	176.4	69.3	-145.2	-3	111.9	L18 D19 S24 L25 Y46	L18-R22 PolarHBondContact O-N 2.89Å; D19-R22 WeakPolarHBondContact O-CB 3.32Å; D19-R22 PolarHBondContact O-N 3.4Å; D19-R22 IonicContact OD1-CZ 2.67Å; D19-R22 IonicContact OD1-NE 3.68Å; D19-R22 IonicContact OD1-NH1 2.67Å; D19-R22 PolarHBondContact OD1-NH1 2.83Å; D19-R22 IonicContact OD1-NH2 2.65Å; D19-R22 PolarHBondContact OD1-NH2 2.92Å; D19-R22 VanDerWaalsContact OD1-NH2 3.09Å; R22-S24 PolarHBondContact O-N 2.85Å; R22-L25 HydrophobicContact CG-CD1 4.49Å; R22-L25 WeakPolarHBondContact O-CB 3.25Å; R22-L25 WeakPolarHBondContact O-CG 3.36Å; R22-L25 PolarHBondContact O-N 2.81Å; R22-Y46 HydrophobicContact CB-CE1 4.33Å; R22-Y46 WeakPolarHBondContact CB-OH 3.43Å; R22-Y46 WeakPolarHBondContact CG-OH 3.48Å
23	L	92.7	Very high	93.6	Very high	41 Å²	41	59.5 Å²	59.5	22%	0.215	30%	0.298	C	S	.	.	H	α-helix	trans	-68.1	-17.8	179.7	-70	170.6	0	0	0	113.1	V14 D19 I21	V14-L23 HydrophobicContact CG2-CD1 3.61Å; D19-L23 WeakPolarHBondContact O-CB 3.39Å; D19-L23 WeakPolarHBondContact O-CG 3.47Å; D19-L23 PolarHBondContact O-N 2.82Å; I21-L23 VanDerWaalsContact C-N 3.3Å; I21-L23 PolarHBondContact O-N 2.78Å
24	S	93.9	Very high	94.3	Very high	2 Å²	2	64 Å²	64	1%	0.014	31%	0.307	C	S	.	.	T	Hydrogen-bonded Turn	trans	-92.1	2.3	176.9	-53.9	0	0	0	0	113	L20 I21 R22 E27	L20-S24 PolarHBondContact O-N 2.66Å; L20-S24 PolarHBondContact O-OG 3.26Å; I21-S24 WeakPolarHBondContact O-CB 3.41Å; I21-S24 PolarHBondContact O-N 2.78Å; R22-S24 PolarHBondContact O-N 2.85Å; S24-E27 PolarHBondContact O-N 2.86Å
25	L	95.9	Very high	94.6	Very high	69 Å²	69	67.2 Å²	67.2	36%	0.361	32%	0.321	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.3	140.2	173.3	-81.6	173.4	0	0	0	110.3	I21 R22 E27 L43 Y46	I21-L25 PolarHBondContact O-N 2.86Å; R22-L25 HydrophobicContact CG-CD1 4.49Å; R22-L25 WeakPolarHBondContact O-CB 3.25Å; R22-L25 WeakPolarHBondContact O-CG 3.36Å; R22-L25 PolarHBondContact O-N 2.81Å; L25-E27 PolarHBondContact O-N 3.18Å; L25-E27 VanDerWaalsContact O-N 3.13Å; L25-L43 HydrophobicContact CD2-CD2 4.36Å; L25-L43 HydrophobicContact CD2-CG 4.24Å; L25-Y46 HydrophobicContact CD1-CE1 3.99Å; L25-Y46 HydrophobicContact CD2-CD1 3.87Å; L25-Y46 HydrophobicContact CD2-CE1 4.13Å; L25-Y46 HydrophobicContact CG-CD1 4.2Å; L25-Y46 HydrophobicContact CG-CE1 3.99Å
26	D	96.1	Very high	94.6	Very high	97 Å²	97	64.1 Å²	64.1	52%	0.519	31%	0.31	S	S	.	.	T	Hydrogen-bonded Turn	trans	67.6	-1.1	-178	-150.1	54.3	0	0	0	115.1	R42 L43	D26-R42 WeakPolarHBondContact O-CG 3.2Å; D26-R42 PolarHBondContact O-NE 2.89Å; D26-R42 IonicContact OD1-CZ 3.09Å; D26-R42 IonicContact OD1-NE 3.05Å; D26-R42 PolarHBondContact OD1-NE 3.2Å; D26-R42 VanDerWaalsContact OD1-NE 3.13Å; D26-R42 IonicContact OD1-NH1 3.81Å; D26-R42 IonicContact OD1-NH2 2.78Å; D26-R42 PolarHBondContact OD1-NH2 3.27Å; D26-R42 IonicContact OD2-CZ 2.93Å; D26-R42 IonicContact OD2-NE 3.13Å; D26-R42 IonicContact OD2-NH2 2.61Å; D26-R42 PolarHBondContact OD2-NH2 2.83Å; D26-L43 PolarHBondContact N-O 2.85Å
27	E	96.3	Very high	94.9	Very high	69 Å²	69	62.6 Å²	62.6	32%	0.322	30%	0.3	S	S	.	.	S	Bend	trans	-101.2	162.1	177.4	-54.6	-167	114.5	0	0	112.5	S24 L25 R42 L43 P98	S24-E27 PolarHBondContact O-N 2.86Å; L25-E27 PolarHBondContact O-N 3.18Å; L25-E27 VanDerWaalsContact O-N 3.13Å; E27-R42 CarbonylContact O-C 3.53Å; E27-R42 VanDerWaalsContact O-CA 3.3Å; E27-R42 WeakPolarHBondContact O-CA 3.45Å; E27-L43 PolarHBondContact O-N 2.84Å; E27-P98 HydrophobicContact CB-CG 3.84Å; E27-P98 VanDerWaalsContact CD-CG 3.46Å; E27-P98 HydrophobicContact CG-CG 4.27Å; E27-P98 WeakPolarHBondContact OE2-CG 3.49Å
28	R	96.3	Very high	95.2	Very high	122 Å²	122	59.6 Å²	59.6	46%	0.46	28%	0.276	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84	115.3	175.9	-166.4	172.8	-175.8	92.4	-0.2	110.1	R40 G41 D56	R28-R40 PolarHBondContact NH2-O 2.9Å; R28-G41 CarbonylContact C-O 3.59Å; R28-G41 WeakPolarHBondContact CA-O 3.35Å; R28-D56 PolarHBondContact NH1-O 2.78Å; R28-D56 PolarHBondContact NH2-O 3.4Å
29	I	97.4	Very high	95.5	Very high	4 Å²	4	57.3 Å²	57.3	2%	0.021	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	162.3	-179	63	166.1	0	0	0	111.7	V31 R40 G41 L43 M52 L54 V95	I29-V31 HydrophobicContact CD1-CG2 3.63Å; I29-V31 HydrophobicContact CG1-CG2 4.11Å; I29-R40 WeakPolarHBondContact O-CA 3.45Å; I29-G41 PolarHBondContact N-O 2.67Å; I29-G41 PolarHBondContact O-N 3.2Å; I29-L43 HydrophobicContact CD1-CB 3.96Å; I29-L43 HydrophobicContact CD1-CD1 4.12Å; I29-L43 HydrophobicContact CD1-CD2 4.27Å; I29-L43 HydrophobicContact CD1-CG 4.33Å; I29-L43 HydrophobicContact CG1-CB 4.19Å; I29-L43 HydrophobicContact CG2-CB 4.38Å; I29-M52 HydrophobicContact CD1-SD 3.94Å; I29-L54 HydrophobicContact CD1-CD2 3.97Å; I29-L54 HydrophobicContact CG1-CD2 4.25Å; I29-V95 HydrophobicContact CD1-CG1 3.9Å
30	Y	97.7	Very high	95.8	Very high	55 Å²	55	63.2 Å²	63.2	22%	0.216	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	134.4	167	169.4	-93	0	0	0	110.1	K32 E38 L39 R40 L94 V95 A96	Y30-K32 HydrophobicContact CE1-CB 4.09Å; Y30-E38 HydrophobicContact CE2-CB 3.97Å; Y30-E38 HydrophobicContact CE2-CG 4.13Å; Y30-E38 VanDerWaalsContact CE2-OE2 3.3Å; Y30-E38 WeakPolarHBondContact CE2-OE2 3.19Å; Y30-E38 WeakPolarHBondContact OH-CG 3.31Å; Y30-E38 PolarHBondContact OH-OE1 2.65Å; Y30-E38 PolarHBondContact OH-OE2 2.67Å; Y30-L39 CarbonylContact C-O 3.51Å; Y30-L39 WeakPolarHBondContact CA-O 3.45Å; Y30-R40 HydrophobicContact CD2-CG 3.85Å; Y30-L94 HydrophobicContact CD1-CD1 4.05Å; Y30-L94 HydrophobicContact CE1-CD1 3.97Å; Y30-V95 WeakPolarHBondContact O-CA 3.28Å; Y30-A96 HydrophobicContact CD1-CB 4.09Å; Y30-A96 PolarHBondContact N-O 3.13Å; Y30-A96 VanDerWaalsContact N-O 3.17Å; Y30-A96 PolarHBondContact O-N 3.19Å
31	V	98.1	Very high	96.1	Very high	0 Å²	0	59.3 Å²	59.3	0%	0	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	119.1	177.8	-172.4	0	0	0	0	109.1	I29 M33 L39 M52 L54 V92 L94 V95	I29-V31 HydrophobicContact CD1-CG2 3.63Å; I29-V31 HydrophobicContact CG1-CG2 4.11Å; V31-M33 HydrophobicContact CG1-CG 4.46Å; V31-M33 HydrophobicContact CG1-SD 3.7Å; V31-L39 HydrophobicContact CB-CB 4.23Å; V31-L39 PolarHBondContact N-O 2.94Å; V31-L39 PolarHBondContact O-N 2.8Å; V31-M52 HydrophobicContact CG2-SD 4.32Å; V31-L54 HydrophobicContact CG2-CD1 4.3Å; V31-V92 HydrophobicContact CG1-CG1 3.97Å; V31-V92 HydrophobicContact CG1-CG2 4.12Å; V31-L94 WeakPolarHBondContact CA-O 3.47Å; V31-V95 HydrophobicContact CG1-CG2 4.38Å; V31-V95 HydrophobicContact CG2-CG1 4.41Å; V31-V95 HydrophobicContact CG2-CG2 4.49Å
32	K	98	Very high	96.3	Very high	34 Å²	34	62.7 Å²	62.7	15%	0.148	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	125.7	167.1	-174.3	66.9	170.4	-176.9	0	107.8	Y30 D36 E38 V93 L94	Y30-K32 HydrophobicContact CE1-CB 4.09Å; K32-D36 IonicContact NZ-OD1 2.76Å; K32-D36 PolarHBondContact NZ-OD1 3.03Å; K32-D36 VanDerWaalsContact NZ-OD1 3.13Å; K32-E38 HydrophobicContact CD-CG 3.47Å; K32-E38 VanDerWaalsContact CD-CG 3.47Å; K32-E38 IonicContact NZ-OE1 3.95Å; K32-E38 PolarHBondContact NZ-OE1 3.48Å; K32-V93 HydrophobicContact CB-CB 4.49Å; K32-V93 HydrophobicContact CG-CB 4.37Å; K32-V93 WeakPolarHBondContact O-CB 3.39Å; K32-V93 PolarHBondContact O-N 2.85Å; K32-L94 HydrophobicContact CB-CD2 3.55Å; K32-L94 HydrophobicContact CB-CG 3.61Å; K32-L94 HydrophobicContact CG-CD2 4.16Å; K32-L94 PolarHBondContact N-O 3.43Å; K32-L94 PolarHBondContact O-N 3.29Å
33	M	97.6	Very high	96.5	Very high	12 Å²	12	59.2 Å²	59.2	6%	0.059	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	165.1	173.1	-57.1	-63.6	-70.1	0	0	109.6	V31 R37 L39 V87 G91 V92	V31-M33 HydrophobicContact CG1-CG 4.46Å; V31-M33 HydrophobicContact CG1-SD 3.7Å; M33-R37 WeakPolarHBondContact CA-O 3.3Å; M33-R37 HydrophobicContact CB-CB 3.99Å; M33-R37 HydrophobicContact CB-CG 4.16Å; M33-R37 WeakPolarHBondContact CB-O 3.33Å; M33-R37 HydrophobicContact CG-CG 4.39Å; M33-R37 PolarHBondContact N-O 3.32Å; M33-L39 HydrophobicContact CG-CD1 3.89Å; M33-L39 HydrophobicContact CG-CG 4.15Å; M33-L39 HydrophobicContact SD-CD1 4.22Å; M33-V87 HydrophobicContact CE-CG1 3.58Å; M33-V87 HydrophobicContact SD-CG1 3.69Å; M33-G91 CarbonylContact C-O 3.54Å; M33-G91 VanDerWaalsContact CA-O 3.24Å; M33-G91 WeakPolarHBondContact CA-O 3.39Å; M33-G91 VanDerWaalsContact CE-C 3.43Å; M33-V92 HydrophobicContact CE-CG2 4.11Å; M33-V92 HydrophobicContact SD-CB 4.31Å; M33-V92 HydrophobicContact SD-CG2 3.66Å
34	R	96.1	Very high	96.8	Very high	162 Å²	162	61.2 Å²	61.2	61%	0.611	27%	0.272	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.3	159.7	167	-64.5	-178.8	-171.8	-153.7	1.4	111.1	D90 G91 V93	R34-D90 PolarHBondContact NE-O 2.75Å; R34-D90 PolarHBondContact NH2-O 2.89Å; R34-G91 PolarHBondContact N-O 3.36Å; R34-V93 HydrophobicContact CG-CG2 3.85Å
35	N	93.4	Very high	97	Very high	147 Å²	147	63.3 Å²	63.3	79%	0.786	29%	0.289	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.6	44.7	176.9	-49.5	-27.1	0	0	0	113	R37	N35-R37 PolarHBondContact O-N 3.09Å
36	D	92.7	Very high	97.1	Very high	88 Å²	88	63.1 Å²	63.1	47%	0.471	28%	0.284	S	S	.	.	T	Hydrogen-bonded Turn	trans	50	36.3	175.5	-68.5	-61.6	0	0	0	115.7	K32 T62	K32-D36 IonicContact NZ-OD1 2.76Å; K32-D36 PolarHBondContact NZ-OD1 3.03Å; K32-D36 VanDerWaalsContact NZ-OD1 3.13Å; D36-T62 PolarHBondContact O-N 2.88Å; D36-T62 VanDerWaalsContact O-N 3.12Å
37	R	96.7	Very high	97.1	Very high	73 Å²	73	61.3 Å²	61.3	28%	0.275	27%	0.274	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	133.6	176	176.5	176.7	175.1	-149.6	-0.8	109.9	M33 N35 E59 T60 V61	M33-R37 WeakPolarHBondContact CA-O 3.3Å; M33-R37 HydrophobicContact CB-CB 3.99Å; M33-R37 HydrophobicContact CB-CG 4.16Å; M33-R37 WeakPolarHBondContact CB-O 3.33Å; M33-R37 HydrophobicContact CG-CG 4.39Å; M33-R37 PolarHBondContact N-O 3.32Å; N35-R37 PolarHBondContact O-N 3.09Å; R37-E59 HydrophobicContact CG-CG 4.3Å; R37-E59 IonicContact CZ-OE1 2.67Å; R37-E59 IonicContact NE-OE1 3.3Å; R37-E59 PolarHBondContact NE-OE1 3.36Å; R37-E59 IonicContact NH2-OE1 3.04Å; R37-E59 PolarHBondContact NH2-OE1 2.67Å; R37-T60 WeakPolarHBondContact CA-O 3Å; R37-V61 HydrophobicContact CB-CG2 4.42Å; R37-V61 HydrophobicContact CG-CG2 4.12Å
38	E	98	Very high	97.1	Very high	49 Å²	49	66 Å²	66	23%	0.229	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	134.8	-175	-66.7	-177	-159.9	0	0	109.6	Y30 K32 E59 T60	Y30-E38 HydrophobicContact CE2-CB 3.97Å; Y30-E38 HydrophobicContact CE2-CG 4.13Å; Y30-E38 VanDerWaalsContact CE2-OE2 3.3Å; Y30-E38 WeakPolarHBondContact CE2-OE2 3.19Å; Y30-E38 WeakPolarHBondContact OH-CG 3.31Å; Y30-E38 PolarHBondContact OH-OE1 2.65Å; Y30-E38 PolarHBondContact OH-OE2 2.67Å; K32-E38 HydrophobicContact CD-CG 3.47Å; K32-E38 VanDerWaalsContact CD-CG 3.47Å; K32-E38 IonicContact NZ-OE1 3.95Å; K32-E38 PolarHBondContact NZ-OE1 3.48Å; E38-E59 CarbonylContact O-C 3.49Å; E38-E59 WeakPolarHBondContact O-CA 3.21Å; E38-T60 PolarHBondContact N-O 3Å; E38-T60 PolarHBondContact O-N 3.16Å
39	L	98.3	Very high	97	Very high	0 Å²	0	67 Å²	67	0%	0	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	135.6	-179.2	-52.2	174	0	0	0	109.4	Y30 V31 M33 L54 V57 E59 L85 V87	Y30-L39 CarbonylContact C-O 3.51Å; Y30-L39 WeakPolarHBondContact CA-O 3.45Å; V31-L39 HydrophobicContact CB-CB 4.23Å; V31-L39 PolarHBondContact N-O 2.94Å; V31-L39 PolarHBondContact O-N 2.8Å; M33-L39 HydrophobicContact CG-CD1 3.89Å; M33-L39 HydrophobicContact CG-CG 4.15Å; M33-L39 HydrophobicContact SD-CD1 4.22Å; L39-L54 HydrophobicContact CB-CD1 4.22Å; L39-L54 HydrophobicContact CD1-CD1 4.22Å; L39-V57 HydrophobicContact CB-CG1 4.17Å; L39-V57 HydrophobicContact CD2-CG1 4.13Å; L39-E59 HydrophobicContact CD2-CB 3.73Å; L39-E59 HydrophobicContact CD2-CG 3.63Å; L39-E59 WeakPolarHBondContact CD2-OE1 3.46Å; L39-L85 HydrophobicContact CD1-CD2 3.92Å; L39-L85 HydrophobicContact CD2-CD2 3.87Å; L39-V87 HydrophobicContact CD1-CG1 4.21Å; L39-V87 HydrophobicContact CD1-CG2 3.61Å
40	R	97.7	Very high	97	Very high	131 Å²	131	69.4 Å²	69.4	49%	0.494	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	113.9	168.4	-69.5	179.2	176.6	-166.1	-2.8	108.7	R28 I29 Y30 V57 E58	R28-R40 PolarHBondContact NH2-O 2.9Å; I29-R40 WeakPolarHBondContact O-CA 3.45Å; Y30-R40 HydrophobicContact CD2-CG 3.85Å; R40-V57 CarbonylContact O-C 3.59Å; R40-V57 WeakPolarHBondContact O-CA 3.36Å; R40-E58 HydrophobicContact CB-CB 4.48Å; R40-E58 PolarHBondContact N-O 3.36Å; R40-E58 PolarHBondContact O-N 3.38Å
41	G	97.9	Very high	97	Very high	0 Å²	0	68.1 Å²	68.1	0%	0	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.5	167.3	-175	0	0	0	0	0	112	R28 I29 G55	R28-G41 CarbonylContact C-O 3.59Å; R28-G41 WeakPolarHBondContact CA-O 3.35Å; I29-G41 PolarHBondContact N-O 2.67Å; I29-G41 PolarHBondContact O-N 3.2Å; G41-G55 CarbonylContact C-O 3.58Å; G41-G55 WeakPolarHBondContact CA-O 3.41Å
42	R	97.9	Very high	97	Very high	89 Å²	89	68.2 Å²	68.2	34%	0.336	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.2	128.2	175.7	-168.1	-179.5	-172.2	-163.5	2.8	110	D26 E27 H44 L54 G55	D26-R42 WeakPolarHBondContact O-CG 3.2Å; D26-R42 PolarHBondContact O-NE 2.89Å; D26-R42 IonicContact OD1-CZ 3.09Å; D26-R42 IonicContact OD1-NE 3.05Å; D26-R42 PolarHBondContact OD1-NE 3.2Å; D26-R42 VanDerWaalsContact OD1-NE 3.13Å; D26-R42 IonicContact OD1-NH1 3.81Å; D26-R42 IonicContact OD1-NH2 2.78Å; D26-R42 PolarHBondContact OD1-NH2 3.27Å; D26-R42 IonicContact OD2-CZ 2.93Å; D26-R42 IonicContact OD2-NE 3.13Å; D26-R42 IonicContact OD2-NH2 2.61Å; D26-R42 PolarHBondContact OD2-NH2 2.83Å; E27-R42 CarbonylContact O-C 3.53Å; E27-R42 VanDerWaalsContact O-CA 3.3Å; E27-R42 WeakPolarHBondContact O-CA 3.45Å; R42-H44 PolarHBondContact O-CD2 2.82Å; R42-H44 PolarHBondContact O-N 2.93Å; R42-L54 CarbonylContact O-C 3.54Å; R42-L54 VanDerWaalsContact O-CA 3.25Å; R42-L54 WeakPolarHBondContact O-CA 3.08Å; R42-G55 PolarHBondContact N-O 3Å; R42-G55 PolarHBondContact O-N 3.13Å
43	L	98.3	Very high	97	Very high	0 Å²	0	69.1 Å²	69.1	0%	0	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.9	111.8	177.8	-178.9	63.9	0	0	0	110.5	I21 L25 D26 E27 I29 A45 Y46 M52 L54	I21-L43 HydrophobicContact CG2-CD2 3.88Å; L25-L43 HydrophobicContact CD2-CD2 4.36Å; L25-L43 HydrophobicContact CD2-CG 4.24Å; D26-L43 PolarHBondContact N-O 2.85Å; E27-L43 PolarHBondContact O-N 2.84Å; I29-L43 HydrophobicContact CD1-CB 3.96Å; I29-L43 HydrophobicContact CD1-CD1 4.12Å; I29-L43 HydrophobicContact CD1-CD2 4.27Å; I29-L43 HydrophobicContact CD1-CG 4.33Å; I29-L43 HydrophobicContact CG1-CB 4.19Å; I29-L43 HydrophobicContact CG2-CB 4.38Å; L43-A45 WeakPolarHBondContact CD1-O 3.06Å; L43-Y46 HydrophobicContact CD2-CD1 4.49Å; L43-M52 HydrophobicContact CD1-CB 3.86Å; L43-M52 HydrophobicContact CD1-CG 3.87Å; L43-M52 HydrophobicContact CD1-SD 3.87Å; L43-L54 HydrophobicContact CB-CD2 4.27Å; L43-L54 HydrophobicContact CD1-CD2 3.74Å
44	H	98.1	Very high	97.1	Very high	83 Å²	83	68.6 Å²	68.6	38%	0.384	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	-40.2	178.3	-75.7	-98.6	0	0	0	113.1	R42 I53 G55	R42-H44 PolarHBondContact O-CD2 2.82Å; R42-H44 PolarHBondContact O-N 2.93Å; H44-I53 HydrophobicContact CB-CB 4.2Å; H44-I53 HydrophobicContact CB-CG2 4.05Å; H44-I53 WeakPolarHBondContact CB-O 3.41Å; H44-I53 PolarHBondContact N-O 2.88Å; H44-G55 PolarHBondContact CD2-N 3.17Å
45	A	98.1	Very high	97.2	Very high	45 Å²	45	61 Å²	61	37%	0.372	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.6	153.6	-177.5	0	0	0	0	0	109.9	L43 M52 I53	L43-A45 WeakPolarHBondContact CD1-O 3.06Å; A45-M52 VanDerWaalsContact O-CA 3.31Å; A45-M52 WeakPolarHBondContact O-CA 3.17Å; A45-I53 HydrophobicContact CB-CB 4.24Å; A45-I53 HydrophobicContact CB-CG1 4.18Å; A45-I53 PolarHBondContact O-N 2.75Å
46	Y	97.5	Very high	97.4	Very high	65 Å²	65	59.2 Å²	59.2	26%	0.255	28%	0.281	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.6	167	172.6	73.7	-80.4	0	0	0	111	L18 I21 R22 L25 L43 N51	L18-Y46 HydrophobicContact CD1-CD2 4.06Å; L18-Y46 HydrophobicContact CD1-CE2 3.72Å; L18-Y46 HydrophobicContact CD2-CE2 4.16Å; L18-Y46 HydrophobicContact CG-CE2 3.85Å; I21-Y46 HydrophobicContact CG2-CD1 3.94Å; I21-Y46 HydrophobicContact CG2-CD2 3.8Å; I21-Y46 HydrophobicContact CG2-CE1 4.37Å; I21-Y46 HydrophobicContact CG2-CE2 4.23Å; I21-Y46 HydrophobicContact CG2-CG 3.66Å; R22-Y46 HydrophobicContact CB-CE1 4.33Å; R22-Y46 WeakPolarHBondContact CB-OH 3.43Å; R22-Y46 WeakPolarHBondContact CG-OH 3.48Å; L25-Y46 HydrophobicContact CD1-CE1 3.99Å; L25-Y46 HydrophobicContact CD2-CD1 3.87Å; L25-Y46 HydrophobicContact CD2-CE1 4.13Å; L25-Y46 HydrophobicContact CG-CD1 4.2Å; L25-Y46 HydrophobicContact CG-CE1 3.99Å; L43-Y46 HydrophobicContact CD2-CD1 4.49Å; Y46-N51 WeakPolarHBondContact CA-O 3.36Å
47	D	96.6	Very high	97.7	Very high	59 Å²	59	55 Å²	55	32%	0.316	26%	0.259	S	S	.	.			trans	-131.1	179.9	170.2	69	20.8	0	0	0	112.2	H49 L50 N51	D47-H49 PolarHBondContact O-N 3.26Å; D47-H49 WeakPolarHBondContact OD1-CA 3.48Å; D47-H49 WeakPolarHBondContact OD1-CB 3.41Å; D47-H49 PolarHBondContact OD1-N 3.02Å; D47-L50 PolarHBondContact O-N 3.38Å; D47-L50 PolarHBondContact OD1-N 2.83Å; D47-L50 VanDerWaalsContact OD1-N 3.16Å; D47-N51 PolarHBondContact N-O 2.76Å; D47-N51 PolarHBondContact OD1-N 3.01Å; D47-N51 PolarHBondContact OD1-ND2 3.37Å; D47-N51 WeakPolarHBondContact OD2-CB 3.18Å; D47-N51 PolarHBondContact OD2-ND2 3.09Å
48	Q	95.8	Very high	97.8	Very high	169 Å²	169	53.7 Å²	53.7	79%	0.79	26%	0.256	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64	-20.8	-179.9	-173.2	177.1	-14.7	0	0	113.6	L50	Q48-L50 VanDerWaalsContact C-N 3.26Å
49	H	96	Very high	97.8	Very high	142 Å²	142	51.5 Å²	51.5	66%	0.657	25%	0.246	S	C	*	.	T	Hydrogen-bonded Turn	trans	-86.7	2.4	175.5	-60.6	-60.9	0	0	0	112.5	D47 N51 G89	D47-H49 PolarHBondContact O-N 3.26Å; D47-H49 WeakPolarHBondContact OD1-CA 3.48Å; D47-H49 WeakPolarHBondContact OD1-CB 3.41Å; D47-H49 PolarHBondContact OD1-N 3.02Å; H49-N51 PolarHBondContact O-N 3.22Å; H49-G89 WeakPolarHBondContact O-CA 3.42Å
50	L	96.4	Very high	97.8	Very high	54 Å²	54	52.5 Å²	52.5	28%	0.283	25%	0.252	S	S	.	.			trans	59.3	27.7	-171.6	-59.8	174.2	0	0	0	113	L18 I21 D47 Q48 M52 G89	L18-L50 HydrophobicContact CD1-CD2 3.94Å; I21-L50 HydrophobicContact CG1-CD2 4.07Å; D47-L50 PolarHBondContact O-N 3.38Å; D47-L50 PolarHBondContact OD1-N 2.83Å; D47-L50 VanDerWaalsContact OD1-N 3.16Å; Q48-L50 VanDerWaalsContact C-N 3.26Å; L50-M52 HydrophobicContact CB-CE 4.37Å; L50-M52 HydrophobicContact CD2-CE 4.09Å; L50-G89 WeakPolarHBondContact O-CA 3.33Å
51	N	98	Very high	97.7	Very high	28 Å²	28	48.2 Å²	48.2	15%	0.15	24%	0.24	C	C	.	.			trans	-66	141.7	159	-56.9	-53.5	0	0	0	107.8	Y46 D47 H49 F86 V87 R88 G89	Y46-N51 WeakPolarHBondContact CA-O 3.36Å; D47-N51 PolarHBondContact N-O 2.76Å; D47-N51 PolarHBondContact OD1-N 3.01Å; D47-N51 PolarHBondContact OD1-ND2 3.37Å; D47-N51 WeakPolarHBondContact OD2-CB 3.18Å; D47-N51 PolarHBondContact OD2-ND2 3.09Å; H49-N51 PolarHBondContact O-N 3.22Å; N51-F86 HydrophobicContact CB-CE2 4.1Å; N51-F86 HydrophobicContact CB-CZ 4.11Å; N51-V87 CarbonylContact C-O 3.54Å; N51-V87 VanDerWaalsContact CA-O 3.25Å; N51-V87 WeakPolarHBondContact CA-O 3.3Å; N51-R88 WeakPolarHBondContact OD1-CA 3.3Å; N51-G89 PolarHBondContact OD1-N 2.99Å
52	M	98.2	Very high	97.4	Very high	2 Å²	2	50.3 Å²	50.3	1%	0.01	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	146.5	-176.1	-59.2	-179.7	176.8	0	0	111.6	I21 I29 V31 L43 A45 L50 L54 V87 V95	I21-M52 HydrophobicContact CG2-CE 4.1Å; I29-M52 HydrophobicContact CD1-SD 3.94Å; V31-M52 HydrophobicContact CG2-SD 4.32Å; L43-M52 HydrophobicContact CD1-CB 3.86Å; L43-M52 HydrophobicContact CD1-CG 3.87Å; L43-M52 HydrophobicContact CD1-SD 3.87Å; A45-M52 VanDerWaalsContact O-CA 3.31Å; A45-M52 WeakPolarHBondContact O-CA 3.17Å; L50-M52 HydrophobicContact CB-CE 4.37Å; L50-M52 HydrophobicContact CD2-CE 4.09Å; M52-L54 HydrophobicContact CB-CD2 4.13Å; M52-L54 HydrophobicContact CB-CG 4.36Å; M52-V87 HydrophobicContact CB-CB 4.2Å; M52-V87 PolarHBondContact N-O 2.78Å; M52-V87 PolarHBondContact O-N 2.83Å; M52-V95 HydrophobicContact CE-CG1 4.29Å; M52-V95 HydrophobicContact CE-CG2 3.62Å
53	I	98.5	Very high	97.1	Very high	54 Å²	54	48.9 Å²	48.9	28%	0.277	25%	0.254	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	116.4	162.3	-56.7	-63.1	0	0	0	107.2	H44 A45 M84 F86	H44-I53 HydrophobicContact CB-CB 4.2Å; H44-I53 HydrophobicContact CB-CG2 4.05Å; H44-I53 WeakPolarHBondContact CB-O 3.41Å; H44-I53 PolarHBondContact N-O 2.88Å; A45-I53 HydrophobicContact CB-CB 4.24Å; A45-I53 HydrophobicContact CB-CG1 4.18Å; A45-I53 PolarHBondContact O-N 2.75Å; I53-M84 HydrophobicContact CG2-CG 4.3Å; I53-F86 HydrophobicContact CD1-CB 4.22Å; I53-F86 HydrophobicContact CD1-CD2 3.67Å; I53-F86 HydrophobicContact CD1-CG 4.44Å
54	L	98.6	Very high	96.6	Very high	0 Å²	0	53.3 Å²	53.3	0%	0	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	138.8	176.5	-56.9	-174.8	0	0	0	110.8	I29 V31 L39 R42 L43 M52 V57 M84 L85 V87	I29-L54 HydrophobicContact CD1-CD2 3.97Å; I29-L54 HydrophobicContact CG1-CD2 4.25Å; V31-L54 HydrophobicContact CG2-CD1 4.3Å; L39-L54 HydrophobicContact CB-CD1 4.22Å; L39-L54 HydrophobicContact CD1-CD1 4.22Å; R42-L54 CarbonylContact O-C 3.54Å; R42-L54 VanDerWaalsContact O-CA 3.25Å; R42-L54 WeakPolarHBondContact O-CA 3.08Å; L43-L54 HydrophobicContact CB-CD2 4.27Å; L43-L54 HydrophobicContact CD1-CD2 3.74Å; M52-L54 HydrophobicContact CB-CD2 4.13Å; M52-L54 HydrophobicContact CB-CG 4.36Å; L54-V57 HydrophobicContact CB-CG2 3.42Å; L54-V57 VanDerWaalsContact CB-CG2 3.42Å; L54-M84 CarbonylContact O-C 3.57Å; L54-M84 WeakPolarHBondContact O-CA 3.46Å; L54-L85 PolarHBondContact N-O 2.87Å; L54-L85 PolarHBondContact O-N 3.1Å; L54-V87 HydrophobicContact CD1-CG2 3.77Å; L54-V87 HydrophobicContact CG-CG2 3.97Å
55	G	98.5	Very high	96	Very high	2 Å²	2	53.4 Å²	53.4	2%	0.021	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	155	173.7	0	0	0	0	0	111.9	G41 R42 H44 V57 P83	G41-G55 CarbonylContact C-O 3.58Å; G41-G55 WeakPolarHBondContact CA-O 3.41Å; R42-G55 PolarHBondContact N-O 3Å; R42-G55 PolarHBondContact O-N 3.13Å; H44-G55 PolarHBondContact CD2-N 3.17Å; G55-V57 VanDerWaalsContact C-N 3.29Å; G55-V57 PolarHBondContact O-N 2.86Å; G55-P83 CarbonylContact C-O 3.6Å; G55-P83 WeakPolarHBondContact CA-O 3.41Å
56	D	98.2	Very high	95.5	Very high	110 Å²	110	56.5 Å²	56.5	59%	0.588	29%	0.287	S	S	*	.	E	Extended strand (participates in β ladder)	trans	47.9	50.2	177.9	-59.6	-44.7	0	0	0	113	R28 P83	R28-D56 PolarHBondContact NH1-O 2.78Å; R28-D56 PolarHBondContact NH2-O 3.4Å; D56-P83 PolarHBondContact N-O 3.38Å
57	V	98.5	Very high	94.9	Very high	1 Å²	1	55.9 Å²	55.9	1%	0.006	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.3	124.2	-168	-171.1	0	0	0	0	110.6	L39 R40 L54 G55 N81 I82 L85	L39-V57 HydrophobicContact CB-CG1 4.17Å; L39-V57 HydrophobicContact CD2-CG1 4.13Å; R40-V57 CarbonylContact O-C 3.59Å; R40-V57 WeakPolarHBondContact O-CA 3.36Å; L54-V57 HydrophobicContact CB-CG2 3.42Å; L54-V57 VanDerWaalsContact CB-CG2 3.42Å; G55-V57 VanDerWaalsContact C-N 3.29Å; G55-V57 PolarHBondContact O-N 2.86Å; V57-N81 CarbonylContact O-C 3.57Å; V57-N81 VanDerWaalsContact O-CA 3.3Å; V57-N81 WeakPolarHBondContact O-CA 3.48Å; V57-I82 HydrophobicContact CB-CB 4.35Å; V57-I82 WeakPolarHBondContact CB-O 3.44Å; V57-I82 PolarHBondContact N-O 3.28Å; V57-I82 PolarHBondContact O-N 3.14Å; V57-L85 HydrophobicContact CG1-CD2 4.07Å; V57-L85 HydrophobicContact CG2-CB 3.96Å
58	E	98.3	Very high	94.5	Very high	45 Å²	45	61.5 Å²	61.5	21%	0.21	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	116.9	159.8	-176.6	-176	155	0	0	107.9	R40 K79	R40-E58 HydrophobicContact CB-CB 4.48Å; R40-E58 PolarHBondContact N-O 3.36Å; R40-E58 PolarHBondContact O-N 3.38Å; E58-K79 IonicContact OE1-NZ 2.6Å; E58-K79 PolarHBondContact OE1-NZ 2.96Å
59	E	98.3	Very high	94.2	Very high	3 Å²	3	62 Å²	62	1%	0.014	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	134.6	172.2	177.5	178.6	-85.1	0	0	110	R37 E38 L39 V61 K79 R80 I82	R37-E59 HydrophobicContact CG-CG 4.3Å; R37-E59 IonicContact CZ-OE1 2.67Å; R37-E59 IonicContact NE-OE1 3.3Å; R37-E59 PolarHBondContact NE-OE1 3.36Å; R37-E59 IonicContact NH2-OE1 3.04Å; R37-E59 PolarHBondContact NH2-OE1 2.67Å; E38-E59 CarbonylContact O-C 3.49Å; E38-E59 WeakPolarHBondContact O-CA 3.21Å; L39-E59 HydrophobicContact CD2-CB 3.73Å; L39-E59 HydrophobicContact CD2-CG 3.63Å; L39-E59 WeakPolarHBondContact CD2-OE1 3.46Å; E59-V61 HydrophobicContact CG-CG2 4.04Å; E59-K79 CarbonylContact O-C 3.58Å; E59-K79 VanDerWaalsContact O-CA 3.28Å; E59-K79 WeakPolarHBondContact O-CA 3.35Å; E59-R80 HydrophobicContact CB-CG 4.13Å; E59-R80 PolarHBondContact N-O 3.4Å; E59-R80 PolarHBondContact O-N 2.8Å; E59-R80 IonicContact OE1-NH2 3.9Å; E59-R80 IonicContact OE2-CZ 3.62Å; E59-R80 IonicContact OE2-NE 2.78Å; E59-R80 PolarHBondContact OE2-NE 3.29Å; E59-R80 IonicContact OE2-NH2 2.69Å; E59-R80 PolarHBondContact OE2-NH2 2.72Å; E59-I82 HydrophobicContact CB-CD1 4.41Å
60	T	97.7	Very high	93.9	Very high	20 Å²	20	58.8 Å²	58.8	12%	0.123	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	127.1	170.9	-57.5	0	0	0	0	108.9	R37 E38 S77 T78 K79	R37-T60 WeakPolarHBondContact CA-O 3Å; E38-T60 PolarHBondContact N-O 3Å; E38-T60 PolarHBondContact O-N 3.16Å; T60-S77 WeakPolarHBondContact CG2-OG 3.45Å; T60-T78 WeakPolarHBondContact CA-O 3.31Å; T60-K79 HydrophobicContact CG2-CG 4.26Å
61	V	95.9	Very high	93.4	Very high	42 Å²	42	65.3 Å²	65.3	26%	0.255	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	124.9	173.9	-177.1	0	0	0	0	108.1	R37 E59 T63 S77 T78	R37-V61 HydrophobicContact CB-CG2 4.42Å; R37-V61 HydrophobicContact CG-CG2 4.12Å; E59-V61 HydrophobicContact CG-CG2 4.04Å; V61-T63 HydrophobicContact CG1-CG2 4.32Å; V61-S77 WeakPolarHBondContact O-CA 3.44Å; V61-T78 PolarHBondContact N-O 3.01Å; V61-T78 PolarHBondContact O-N 2.84Å
62	T	92.9	Very high	93.1	Very high	43 Å²	43	70.1 Å²	70.1	26%	0.264	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	125.2	174.9	-57	0	0	0	0	109.6	D36 Y75 K76	D36-T62 PolarHBondContact O-N 2.88Å; D36-T62 VanDerWaalsContact O-N 3.12Å; T62-Y75 HydrophobicContact CG2-CD1 4.23Å; T62-K76 CarbonylContact C-O 3.58Å; T62-K76 VanDerWaalsContact CA-O 3.31Å; T62-K76 WeakPolarHBondContact CA-O 3.24Å
63	T	90.2	Very high	92.6	Very high	60 Å²	60	75.6 Å²	75.6	37%	0.368	37%	0.374	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	141.8	175.7	57	0	0	0	0	109.6	V61 K76	V61-T63 HydrophobicContact CG1-CG2 4.32Å; T63-K76 PolarHBondContact N-O 2.92Å; T63-K76 PolarHBondContact O-N 3.13Å
64	I	88.2	Confident	92	Very high	93 Å²	93	76.2 Å²	76.2	48%	0.477	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	120.4	172.5	-54.6	175.5	0	0	0	106.9	E73 Y75	I64-E73 HydrophobicContact CG2-CB 4.01Å; I64-E73 HydrophobicContact CG2-CG 4.06Å; I64-Y75 HydrophobicContact CD1-CE1 3.79Å; I64-Y75 HydrophobicContact CG1-CD1 3.95Å; I64-Y75 HydrophobicContact CG1-CE1 3.72Å
65	E	86.4	Confident	91.5	Very high	84 Å²	84	83.1 Å²	83.1	39%	0.393	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	146	168.2	-66.8	-176.9	-165	0	0	108.5	I74 K76	E65-I74 PolarHBondContact N-O 3.22Å; E65-I74 PolarHBondContact O-N 2.6Å; E65-K76 VanDerWaalsContact CD-NZ 3.29Å; E65-K76 WeakPolarHBondContact OE1-CD 3.44Å; E65-K76 IonicContact OE1-NZ 3.29Å; E65-K76 PolarHBondContact OE1-NZ 3.3Å; E65-K76 WeakPolarHBondContact OE2-CE 3.25Å; E65-K76 IonicContact OE2-NZ 3.44Å; E65-K76 PolarHBondContact OE2-NZ 3.03Å
66	I	86.6	Confident	91.1	Very high	111 Å²	111	87.5 Å²	87.5	57%	0.569	42%	0.423	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.9	126.3	174.9	-59.8	173.4	0	0	0	106.8	E68	I66-E68 PolarHBondContact O-N 2.81Å
67	D	84.7	Confident	90.8	Very high	51 Å²	51	85.6 Å²	85.6	27%	0.273	42%	0.418	S	S	.	.			trans	-67.9	122.1	171.7	-169.7	-66.6	0	0	0	109.5	E69 T70 Y71 E72 I74	D67-E69 PolarHBondContact O-N 3.31Å; D67-E69 WeakPolarHBondContact OD1-CA 3.13Å; D67-E69 WeakPolarHBondContact OD1-CB 3.38Å; D67-E69 PolarHBondContact OD1-N 3.12Å; D67-T70 WeakPolarHBondContact CB-OG1 3.39Å; D67-T70 PolarHBondContact OD1-N 2.81Å; D67-T70 PolarHBondContact OD1-OG1 2.77Å; D67-Y71 WeakPolarHBondContact O-CA 3.34Å; D67-Y71 PolarHBondContact O-N 2.86Å; D67-E72 PolarHBondContact N-O 3.47Å; D67-I74 HydrophobicContact CB-CD1 3.96Å
68	E	88.3	Confident	90.7	Very high	177 Å²	177	89.8 Å²	89.8	83%	0.827	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.3	-21	-176.2	-64.4	-173.4	167.8	0	0	113.1	I66	I66-E68 PolarHBondContact O-N 2.81Å
69	E	90	Very high	90.6	Very high	180 Å²	180	93.8 Å²	93.8	84%	0.841	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.5	-41	-178	-60.1	-174	174.1	0	0	111.7	D67	D67-E69 PolarHBondContact O-N 3.31Å; D67-E69 WeakPolarHBondContact OD1-CA 3.13Å; D67-E69 WeakPolarHBondContact OD1-CB 3.38Å; D67-E69 PolarHBondContact OD1-N 3.12Å
70	T	89.9	Confident	90.5	Very high	75 Å²	75	100.4 Å²	100.4	46%	0.46	49%	0.486	S	S	.	.	T	Hydrogen-bonded Turn	trans	-101.7	-14.2	-177.1	70.2	0	0	0	0	114.3	D67 E72	D67-T70 WeakPolarHBondContact CB-OG1 3.39Å; D67-T70 PolarHBondContact OD1-N 2.81Å; D67-T70 PolarHBondContact OD1-OG1 2.77Å; T70-E72 PolarHBondContact O-N 2.99Å; T70-E72 WeakPolarHBondContact OG1-CB 3.48Å; T70-E72 WeakPolarHBondContact OG1-CG 3.39Å; T70-E72 PolarHBondContact OG1-N 3.03Å
71	Y	85.5	Confident	90.6	Very high	191 Å²	191	106 Å²	106	75%	0.749	52%	0.515	S	S	*	.			trans	58	21.7	-171.4	-61.9	-80.5	0	0	0	114.5	D67	D67-Y71 WeakPolarHBondContact O-CA 3.34Å; D67-Y71 PolarHBondContact O-N 2.86Å
72	E	90.8	Very high	90.7	Very high	129 Å²	129	105.5 Å²	105.5	60%	0.603	51%	0.51	S	S	*	.			trans	-83.2	143.6	176.1	-66.6	-177.3	159.8	0	0	111.4	D67 T70 I74	D67-E72 PolarHBondContact N-O 3.47Å; T70-E72 PolarHBondContact O-N 2.99Å; T70-E72 WeakPolarHBondContact OG1-CB 3.48Å; T70-E72 WeakPolarHBondContact OG1-CG 3.39Å; T70-E72 PolarHBondContact OG1-N 3.03Å; E72-I74 PolarHBondContact O-N 3.28Å
73	E	87.7	Confident	90.9	Very high	117 Å²	117	108.4 Å²	108.4	55%	0.547	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	114.7	172.1	-70.3	-175.7	177.5	0	0	110.4	I64 Y75	I64-E73 HydrophobicContact CG2-CB 4.01Å; I64-E73 HydrophobicContact CG2-CG 4.06Å; E73-Y75 HydrophobicContact CB-CE2 4.06Å; E73-Y75 PolarHBondContact OE2-OH 3.29Å
74	I	87.1	Confident	91.3	Very high	67 Å²	67	111.7 Å²	111.7	34%	0.344	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	117	175.8	-56.4	176.1	0	0	0	109.1	E65 D67 E72 K76	E65-I74 PolarHBondContact N-O 3.22Å; E65-I74 PolarHBondContact O-N 2.6Å; D67-I74 HydrophobicContact CB-CD1 3.96Å; E72-I74 PolarHBondContact O-N 3.28Å; I74-K76 HydrophobicContact CG2-CG 4.23Å; I74-K76 PolarHBondContact O-N 3.4Å
75	Y	88.2	Confident	91.8	Very high	144 Å²	144	108.4 Å²	108.4	57%	0.565	53%	0.526	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.6	111.3	175.4	-65.4	-99.4	0	0	0	109.6	T62 I64 E73	T62-Y75 HydrophobicContact CG2-CD1 4.23Å; I64-Y75 HydrophobicContact CD1-CE1 3.79Å; I64-Y75 HydrophobicContact CG1-CD1 3.95Å; I64-Y75 HydrophobicContact CG1-CE1 3.72Å; E73-Y75 HydrophobicContact CB-CE2 4.06Å; E73-Y75 PolarHBondContact OE2-OH 3.29Å
76	K	90.7	Very high	92.3	Very high	94 Å²	94	110.5 Å²	110.5	41%	0.409	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	134.7	173.1	-68.7	-168.5	-172.8	164.9	0	110.3	T62 T63 E65 I74	T62-K76 CarbonylContact C-O 3.58Å; T62-K76 VanDerWaalsContact CA-O 3.31Å; T62-K76 WeakPolarHBondContact CA-O 3.24Å; T63-K76 PolarHBondContact N-O 2.92Å; T63-K76 PolarHBondContact O-N 3.13Å; E65-K76 VanDerWaalsContact CD-NZ 3.29Å; E65-K76 WeakPolarHBondContact OE1-CD 3.44Å; E65-K76 IonicContact OE1-NZ 3.29Å; E65-K76 PolarHBondContact OE1-NZ 3.3Å; E65-K76 WeakPolarHBondContact OE2-CE 3.25Å; E65-K76 IonicContact OE2-NZ 3.44Å; E65-K76 PolarHBondContact OE2-NZ 3.03Å; I74-K76 HydrophobicContact CG2-CG 4.23Å; I74-K76 PolarHBondContact O-N 3.4Å
77	S	91.9	Very high	92.9	Very high	70 Å²	70	105.4 Å²	105.4	49%	0.49	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	121	176.3	-169.9	0	0	0	0	109.5	T60 V61	T60-S77 WeakPolarHBondContact CG2-OG 3.45Å; V61-S77 WeakPolarHBondContact O-CA 3.44Å
78	T	94.7	Very high	93.5	Very high	90 Å²	90	110 Å²	110	55%	0.552	52%	0.522	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.2	132.6	173.9	-60.8	0	0	0	0	109.5	T60 V61	T60-T78 WeakPolarHBondContact CA-O 3.31Å; V61-T78 PolarHBondContact N-O 3.01Å; V61-T78 PolarHBondContact O-N 2.84Å
79	K	96.9	Very high	94	Very high	129 Å²	129	102 Å²	102	56%	0.561	49%	0.487	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.1	140	176.8	-66.6	-170.8	168.6	-154	0	111.6	E58 E59 T60	E58-K79 IonicContact OE1-NZ 2.6Å; E58-K79 PolarHBondContact OE1-NZ 2.96Å; E59-K79 CarbonylContact O-C 3.58Å; E59-K79 VanDerWaalsContact O-CA 3.28Å; E59-K79 WeakPolarHBondContact O-CA 3.35Å; T60-K79 HydrophobicContact CG2-CG 4.26Å
80	R	97.1	Very high	94.3	Very high	141 Å²	141	97.6 Å²	97.6	53%	0.532	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.1	150.7	171.2	63.2	179.3	177.8	178.5	-0.8	112	E59 I82	E59-R80 HydrophobicContact CB-CG 4.13Å; E59-R80 PolarHBondContact N-O 3.4Å; E59-R80 PolarHBondContact O-N 2.8Å; E59-R80 IonicContact OE1-NH2 3.9Å; E59-R80 IonicContact OE2-CZ 3.62Å; E59-R80 IonicContact OE2-NE 2.78Å; E59-R80 PolarHBondContact OE2-NE 3.29Å; E59-R80 IonicContact OE2-NH2 2.69Å; E59-R80 PolarHBondContact OE2-NH2 2.72Å; R80-I82 HydrophobicContact CG-CD1 4.44Å; R80-I82 HydrophobicContact CG-CG1 4.36Å
81	N	98.2	Very high	94.6	Very high	137 Å²	137	94.7 Å²	94.7	73%	0.733	45%	0.454	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.4	133.4	175.4	-65	-30.1	0	0	0	110.1	V57	V57-N81 CarbonylContact O-C 3.57Å; V57-N81 VanDerWaalsContact O-CA 3.3Å; V57-N81 WeakPolarHBondContact O-CA 3.48Å
82	I	98.2	Very high	95.2	Very high	32 Å²	32	86.8 Å²	86.8	16%	0.164	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	115.6	-178.7	-52.8	175.1	0	0	0	107.5	V57 E59 R80 M84 L85	V57-I82 HydrophobicContact CB-CB 4.35Å; V57-I82 WeakPolarHBondContact CB-O 3.44Å; V57-I82 PolarHBondContact N-O 3.28Å; V57-I82 PolarHBondContact O-N 3.14Å; E59-I82 HydrophobicContact CB-CD1 4.41Å; R80-I82 HydrophobicContact CG-CD1 4.44Å; R80-I82 HydrophobicContact CG-CG1 4.36Å; I82-M84 VanDerWaalsContact C-N 3.29Å; I82-M84 WeakPolarHBondContact CG2-O 3.49Å; I82-M84 PolarHBondContact O-N 3.25Å; I82-L85 HydrophobicContact CD1-CD1 4.23Å; I82-L85 HydrophobicContact CD1-CD2 4.41Å; I82-L85 HydrophobicContact CG2-CB 4.17Å; I82-L85 HydrophobicContact CG2-CD1 4.48Å
83	P	98.1	Very high	95.5	Very high	104 Å²	104	85 Å²	85	68%	0.675	42%	0.423	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.5	-38.8	-176.6	-26.9	34.8	0	0	0	113.7	G55 D56	G55-P83 CarbonylContact C-O 3.6Å; G55-P83 WeakPolarHBondContact CA-O 3.41Å; D56-P83 PolarHBondContact N-O 3.38Å
84	M	98.1	Very high	95.9	Very high	129 Å²	129	83.2 Å²	83.2	64%	0.635	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-147.6	132.6	178.3	-171.4	169.3	-72.6	0	0	110.1	I53 L54 I82	I53-M84 HydrophobicContact CG2-CG 4.3Å; L54-M84 CarbonylContact O-C 3.57Å; L54-M84 WeakPolarHBondContact O-CA 3.46Å; I82-M84 VanDerWaalsContact C-N 3.29Å; I82-M84 WeakPolarHBondContact CG2-O 3.49Å; I82-M84 PolarHBondContact O-N 3.25Å
85	L	98.1	Very high	96.4	Very high	25 Å²	25	81.5 Å²	81.5	13%	0.131	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.2	126.7	-175.2	-177.9	66.9	0	0	0	110.5	L39 L54 V57 I82 V87	L39-L85 HydrophobicContact CD1-CD2 3.92Å; L39-L85 HydrophobicContact CD2-CD2 3.87Å; L54-L85 PolarHBondContact N-O 2.87Å; L54-L85 PolarHBondContact O-N 3.1Å; V57-L85 HydrophobicContact CG1-CD2 4.07Å; V57-L85 HydrophobicContact CG2-CB 3.96Å; I82-L85 HydrophobicContact CD1-CD1 4.23Å; I82-L85 HydrophobicContact CD1-CD2 4.41Å; I82-L85 HydrophobicContact CG2-CB 4.17Å; I82-L85 HydrophobicContact CG2-CD1 4.48Å; L85-V87 HydrophobicContact CD2-CG2 3.99Å; L85-V87 HydrophobicContact CG-CG2 4.11Å
86	F	98.2	Very high	96.7	Very high	127 Å²	127	76.2 Å²	76.2	56%	0.557	40%	0.396	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.9	125.1	162.7	174.9	-96.1	0	0	0	109.2	N51 I53 R88	N51-F86 HydrophobicContact CB-CE2 4.1Å; N51-F86 HydrophobicContact CB-CZ 4.11Å; I53-F86 HydrophobicContact CD1-CB 4.22Å; I53-F86 HydrophobicContact CD1-CD2 3.67Å; I53-F86 HydrophobicContact CD1-CG 4.44Å; F86-R88 HydrophobicContact CE1-CB 4.15Å
87	V	98.3	Very high	96.6	Very high	4 Å²	4	75 Å²	75	2%	0.024	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	126.3	176.6	-177.1	0	0	0	0	108.3	M33 L39 N51 M52 L54 L85 V92	M33-V87 HydrophobicContact CE-CG1 3.58Å; M33-V87 HydrophobicContact SD-CG1 3.69Å; L39-V87 HydrophobicContact CD1-CG1 4.21Å; L39-V87 HydrophobicContact CD1-CG2 3.61Å; N51-V87 CarbonylContact C-O 3.54Å; N51-V87 VanDerWaalsContact CA-O 3.25Å; N51-V87 WeakPolarHBondContact CA-O 3.3Å; M52-V87 HydrophobicContact CB-CB 4.2Å; M52-V87 PolarHBondContact N-O 2.78Å; M52-V87 PolarHBondContact O-N 2.83Å; L54-V87 HydrophobicContact CD1-CG2 3.77Å; L54-V87 HydrophobicContact CG-CG2 3.97Å; L85-V87 HydrophobicContact CD2-CG2 3.99Å; L85-V87 HydrophobicContact CG-CG2 4.11Å; V87-V92 HydrophobicContact CG1-CG2 4.06Å
88	R	97.9	Very high	96.3	Very high	147 Å²	147	73.1 Å²	73.1	56%	0.555	38%	0.384	S	S	*	.			trans	-86.1	130.5	174.8	-163.1	-177.8	154.5	70.9	7.6	109.9	N51 F86 D90 G91	N51-R88 WeakPolarHBondContact OD1-CA 3.3Å; F86-R88 HydrophobicContact CE1-CB 4.15Å; R88-D90 VanDerWaalsContact C-N 3.33Å; R88-D90 WeakPolarHBondContact CB-OD1 3.15Å; R88-D90 WeakPolarHBondContact CD-OD1 3.43Å; R88-D90 WeakPolarHBondContact CG-OD1 3.42Å; R88-D90 IonicContact CZ-OD2 2.72Å; R88-D90 IonicContact NE-OD1 3.06Å; R88-D90 PolarHBondContact NE-OD1 2.92Å; R88-D90 VanDerWaalsContact NE-OD1 3.14Å; R88-D90 IonicContact NE-OD2 3.13Å; R88-D90 PolarHBondContact NE-OD2 3.13Å; R88-D90 IonicContact NH2-OD2 3.14Å; R88-D90 PolarHBondContact NH2-OD2 2.76Å; R88-D90 PolarHBondContact O-N 3.46Å; R88-G91 PolarHBondContact O-N 2.85Å
89	G	97.7	Very high	95.6	Very high	10 Å²	10	76.8 Å²	76.8	10%	0.103	40%	0.399	C	S	.	.	G	3₁₀ helix	trans	-69.8	-22.8	-170.9	0	0	0	0	0	115.5	H49 L50 N51 G91 V92	H49-G89 WeakPolarHBondContact O-CA 3.42Å; L50-G89 WeakPolarHBondContact O-CA 3.33Å; N51-G89 PolarHBondContact OD1-N 2.99Å; G89-G91 PolarHBondContact O-N 3.45Å; G89-V92 WeakPolarHBondContact O-CB 3.16Å; G89-V92 PolarHBondContact O-N 3.39Å; G89-V92 VanDerWaalsContact O-N 3.1Å
90	D	97.3	Very high	94.6	Very high	88 Å²	88	79.6 Å²	79.6	47%	0.471	41%	0.406	S	S	.	.	G	3₁₀ helix	trans	-64.3	-27.1	177.1	62.9	-17	0	0	0	113.8	R34 R88	R34-D90 PolarHBondContact NE-O 2.75Å; R34-D90 PolarHBondContact NH2-O 2.89Å; R88-D90 VanDerWaalsContact C-N 3.33Å; R88-D90 WeakPolarHBondContact CB-OD1 3.15Å; R88-D90 WeakPolarHBondContact CD-OD1 3.43Å; R88-D90 WeakPolarHBondContact CG-OD1 3.42Å; R88-D90 IonicContact CZ-OD2 2.72Å; R88-D90 IonicContact NE-OD1 3.06Å; R88-D90 PolarHBondContact NE-OD1 2.92Å; R88-D90 VanDerWaalsContact NE-OD1 3.14Å; R88-D90 IonicContact NE-OD2 3.13Å; R88-D90 PolarHBondContact NE-OD2 3.13Å; R88-D90 IonicContact NH2-OD2 3.14Å; R88-D90 PolarHBondContact NH2-OD2 2.76Å; R88-D90 PolarHBondContact O-N 3.46Å
91	G	96.5	Very high	93.4	Very high	13 Å²	13	79.5 Å²	79.5	13%	0.134	42%	0.421	C	S	.	.	G	3₁₀ helix	trans	-85.8	-10.1	175.7	0	0	0	0	0	114.3	M33 R34 R88 G89	M33-G91 CarbonylContact C-O 3.54Å; M33-G91 VanDerWaalsContact CA-O 3.24Å; M33-G91 WeakPolarHBondContact CA-O 3.39Å; M33-G91 VanDerWaalsContact CE-C 3.43Å; R34-G91 PolarHBondContact N-O 3.36Å; R88-G91 PolarHBondContact O-N 2.85Å; G89-G91 PolarHBondContact O-N 3.45Å
92	V	97.7	Very high	91.2	Very high	25 Å²	25	79.9 Å²	79.9	15%	0.152	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.2	128.6	-178.3	177.5	0	0	0	0	109.4	V31 M33 V87 G89 V95	V31-V92 HydrophobicContact CG1-CG1 3.97Å; V31-V92 HydrophobicContact CG1-CG2 4.12Å; M33-V92 HydrophobicContact CE-CG2 4.11Å; M33-V92 HydrophobicContact SD-CB 4.31Å; M33-V92 HydrophobicContact SD-CG2 3.66Å; V87-V92 HydrophobicContact CG1-CG2 4.06Å; G89-V92 WeakPolarHBondContact O-CB 3.16Å; G89-V92 PolarHBondContact O-N 3.39Å; G89-V92 VanDerWaalsContact O-N 3.1Å; V92-V95 HydrophobicContact CG1-CG2 3.68Å
93	V	97.4	Very high	90.9	Very high	91 Å²	91	82.3 Å²	82.3	55%	0.552	47%	0.472	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.7	-44.5	175.7	177.9	0	0	0	0	110.1	K32 R34	K32-V93 HydrophobicContact CB-CB 4.49Å; K32-V93 HydrophobicContact CG-CB 4.37Å; K32-V93 WeakPolarHBondContact O-CB 3.39Å; K32-V93 PolarHBondContact O-N 2.85Å; R34-V93 HydrophobicContact CG-CG2 3.85Å
94	L	95.8	Very high	90.5	Very high	81 Å²	81	81.1 Å²	81.1	42%	0.424	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151	153.1	175.7	77.8	101.1	0	0	0	111.1	Y30 V31 K32 A96	Y30-L94 HydrophobicContact CD1-CD1 4.05Å; Y30-L94 HydrophobicContact CE1-CD1 3.97Å; V31-L94 WeakPolarHBondContact CA-O 3.47Å; K32-L94 HydrophobicContact CB-CD2 3.55Å; K32-L94 HydrophobicContact CB-CG 3.61Å; K32-L94 HydrophobicContact CG-CD2 4.16Å; K32-L94 PolarHBondContact N-O 3.43Å; K32-L94 PolarHBondContact O-N 3.29Å; L94-A96 HydrophobicContact CD1-CB 4.23Å
95	V	96.7	Very high	90.1	Very high	31 Å²	31	78.4 Å²	78.4	19%	0.188	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	124	171.2	-176.3	0	0	0	0	107.4	I21 I29 Y30 V31 M52 V92	I21-V95 HydrophobicContact CD1-CB 3.8Å; I21-V95 HydrophobicContact CD1-CG1 3.64Å; I21-V95 HydrophobicContact CD1-CG2 4.27Å; I29-V95 HydrophobicContact CD1-CG1 3.9Å; Y30-V95 WeakPolarHBondContact O-CA 3.28Å; V31-V95 HydrophobicContact CG1-CG2 4.38Å; V31-V95 HydrophobicContact CG2-CG1 4.41Å; V31-V95 HydrophobicContact CG2-CG2 4.49Å; M52-V95 HydrophobicContact CE-CG1 4.29Å; M52-V95 HydrophobicContact CE-CG2 3.62Å; V92-V95 HydrophobicContact CG1-CG2 3.68Å
96	A	95.1	Very high	89.6	Confident	33 Å²	33	81.6 Å²	81.6	27%	0.273	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	124.1	175.5	0	0	0	0	0	109.5	Y30 L94	Y30-A96 HydrophobicContact CD1-CB 4.09Å; Y30-A96 PolarHBondContact N-O 3.13Å; Y30-A96 VanDerWaalsContact N-O 3.17Å; Y30-A96 PolarHBondContact O-N 3.19Å; L94-A96 HydrophobicContact CD1-CB 4.23Å
97	P	88.5	Confident	89.1	Confident	68 Å²	68	78.8 Å²	78.8	44%	0.442	47%	0.465	S	S	.	.			trans	-63.7	163.6	173.8	29.2	-34.6	0	0	0	110.4
98	P	85	Confident	88.5	Confident	31 Å²	31	83.7 Å²	83.7	20%	0.201	49%	0.494	C	S	.	.			trans	-59.9	145.9	177.6	24.6	-33.1	0	0	0	111.5	E27 R100	E27-P98 HydrophobicContact CB-CG 3.84Å; E27-P98 VanDerWaalsContact CD-CG 3.46Å; E27-P98 HydrophobicContact CG-CG 4.27Å; E27-P98 WeakPolarHBondContact OE2-CG 3.49Å; P98-R100 PolarHBondContact O-N 3.28Å
99	L	80.7	Confident	87.8	Confident	166 Å²	166	79.2 Å²	79.2	87%	0.869	49%	0.49	S	S	*	.			trans	-66.5	106.7	171	-67.6	172.3	0	0	0	108.5	V101	L99-V101 PolarHBondContact O-N 3.4Å; L99-V101 VanDerWaalsContact O-N 3.09Å
100	R	77	Confident	87	Confident	188 Å²	188	84.5 Å²	84.5	71%	0.709	52%	0.519	S	S	*	.			trans	-74.8	97.5	170.4	-64	-177.7	179.9	177.5	-0.1	107.8	P98 G102	P98-R100 PolarHBondContact O-N 3.28Å; R100-G102 PolarHBondContact O-N 2.82Å
101	V	70.7	Confident	86.2	Confident	139 Å²	139	84.3 Å²	84.3	84%	0.842	52%	0.523	S	S	*	.			trans	-74.5	110.8	165.7	-168.3	0	0	0	0	105.8	L99	L99-V101 PolarHBondContact O-N 3.4Å; L99-V101 VanDerWaalsContact O-N 3.09Å
102	G	52.9	Low	85.2	Confident	145 Å²	145	90.7 Å²	90.7	100%	1.495	56%	0.559	S	S	*	*			trans	-71	0	175.3	0	0	0	0	0	112.7	R100	R100-G102 PolarHBondContact O-N 2.82Å

Retrieved 102 of 102 residues in 610.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).