A0A096MXN4_PAPAN Loading...

High affinity immunoglobulin epsilon receptor subunit gamma

AlphaFold DB (Q8SPW1), UniProt , Accession A0A096MXN4, Species PAPAN (Papio anubis, Olive baboon), Gene FCER1G, Length 86 aa.

						>A0A096MXN4_PAPAN|A0A096MXN4|FCER1G
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAIASYEKSDGVYTGLSTRNQETYETLKHEKPPQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.3	Low	79	Confident	199 Å²	199	106.5 Å²	106.5	98%	0.98	59%	0.589	S	S	*	*				0	-47.5	0	-61.6	-178	74.5	0	0	112.3	P3 A4 V5	M1-P3 VanDerWaalsContact C-CD 3.45Å; M1-A4 PolarHBondContact O-N 3.08Å; M1-A4 VanDerWaalsContact O-N 3.1Å; M1-V5 PolarHBondContact O-N 2.88Å
2	I	77	Confident	78.4	Confident	135 Å²	135	106.8 Å²	106.8	69%	0.692	59%	0.588	S	S	*	*	H	α-helix	trans	-45.9	-47.7	176.4	-52.7	172.8	0	0	0	114.2	A4 V5 V6	I2-A4 VanDerWaalsContact C-N 3.31Å; I2-A4 PolarHBondContact O-N 3.44Å; I2-V5 PolarHBondContact O-N 2.9Å; I2-V5 VanDerWaalsContact O-N 3.16Å; I2-V6 HydrophobicContact CG2-CG2 4.18Å; I2-V6 WeakPolarHBondContact O-CG2 3.38Å; I2-V6 PolarHBondContact O-N 3.18Å
3	P	83.3	Confident	77.9	Confident	89 Å²	89	104.4 Å²	104.4	58%	0.578	58%	0.578	S	S	*	*	H	α-helix	trans	-63.3	-36.2	-177.7	23.6	-34.9	0	0	0	112.9	M1 V6 L7	M1-P3 VanDerWaalsContact C-CD 3.45Å; P3-V6 PolarHBondContact O-N 3.34Å; P3-L7 WeakPolarHBondContact O-CB 3.34Å; P3-L7 VanDerWaalsContact O-CG 3.26Å; P3-L7 WeakPolarHBondContact O-CG 3.45Å; P3-L7 PolarHBondContact O-N 3.48Å
4	A	84.3	Confident	77.2	Confident	62 Å²	62	106.9 Å²	106.9	51%	0.512	58%	0.584	S	S	.	*	H	α-helix	trans	-67.9	-37.4	177.5	0	0	0	0	0	111.7	M1 I2 L7 L8	M1-A4 PolarHBondContact O-N 3.08Å; M1-A4 VanDerWaalsContact O-N 3.1Å; I2-A4 VanDerWaalsContact C-N 3.31Å; I2-A4 PolarHBondContact O-N 3.44Å; A4-L7 PolarHBondContact O-N 3.29Å; A4-L8 WeakPolarHBondContact O-CB 3.41Å; A4-L8 PolarHBondContact O-N 3.44Å
5	V	83.8	Confident	76.5	Confident	81 Å²	81	107.7 Å²	107.7	49%	0.491	58%	0.582	S	S	.	*	H	α-helix	trans	-67.6	-41.7	175.9	179.2	0	0	0	0	110.9	M1 I2 L8 L9	M1-V5 PolarHBondContact O-N 2.88Å; I2-V5 PolarHBondContact O-N 2.9Å; I2-V5 VanDerWaalsContact O-N 3.16Å; V5-L8 PolarHBondContact O-N 3.1Å; V5-L9 HydrophobicContact CG1-CD1 4.21Å; V5-L9 WeakPolarHBondContact O-CB 3.35Å; V5-L9 WeakPolarHBondContact O-CG 3.46Å; V5-L9 PolarHBondContact O-N 3.41Å
6	V	83.3	Confident	75.5	Confident	74 Å²	74	103.3 Å²	103.3	45%	0.448	57%	0.565	S	S	.	*	H	α-helix	trans	-64.3	-44	176.2	175.1	0	0	0	0	110.7	I2 P3 L8 L9 L10	I2-V6 HydrophobicContact CG2-CG2 4.18Å; I2-V6 WeakPolarHBondContact O-CG2 3.38Å; I2-V6 PolarHBondContact O-N 3.18Å; P3-V6 PolarHBondContact O-N 3.34Å; V6-L8 VanDerWaalsContact C-N 3.34Å; V6-L8 PolarHBondContact O-N 3.31Å; V6-L9 PolarHBondContact O-N 3.16Å; V6-L10 HydrophobicContact CG1-CD1 4.24Å; V6-L10 HydrophobicContact CG1-CG 4.49Å; V6-L10 WeakPolarHBondContact O-CG 3.41Å; V6-L10 PolarHBondContact O-N 3.49Å
7	L	82.7	Confident	74.8	Confident	117 Å²	117	101.8 Å²	101.8	61%	0.613	57%	0.569	S	S	*	*	H	α-helix	trans	-61	-42.2	174.4	-74.2	167.8	0	0	0	111.8	P3 A4 L10 L11	P3-L7 WeakPolarHBondContact O-CB 3.34Å; P3-L7 VanDerWaalsContact O-CG 3.26Å; P3-L7 WeakPolarHBondContact O-CG 3.45Å; P3-L7 PolarHBondContact O-N 3.48Å; A4-L7 PolarHBondContact O-N 3.29Å; L7-L10 PolarHBondContact O-N 2.9Å; L7-L11 WeakPolarHBondContact O-CB 3.35Å; L7-L11 PolarHBondContact O-N 3.3Å
8	L	82.3	Confident	74.2	Confident	117 Å²	117	100.8 Å²	100.8	61%	0.613	58%	0.577	S	S	*	*	H	α-helix	trans	-64.4	-41.3	176.9	-173.5	68.4	0	0	0	111.8	A4 V5 V6 L11 L12	A4-L8 WeakPolarHBondContact O-CB 3.41Å; A4-L8 PolarHBondContact O-N 3.44Å; V5-L8 PolarHBondContact O-N 3.1Å; V6-L8 VanDerWaalsContact C-N 3.34Å; V6-L8 PolarHBondContact O-N 3.31Å; L8-L11 PolarHBondContact O-N 3.24Å; L8-L12 WeakPolarHBondContact O-CB 3.35Å; L8-L12 PolarHBondContact O-N 2.95Å
9	L	77	Confident	73.5	Confident	101 Å²	101	102 Å²	102	53%	0.529	58%	0.58	S	S	.	*	H	α-helix	trans	-64.9	-41.8	175.6	-76.7	171.9	0	0	0	111.9	V5 V6 L12 V13	V5-L9 HydrophobicContact CG1-CD1 4.21Å; V5-L9 WeakPolarHBondContact O-CB 3.35Å; V5-L9 WeakPolarHBondContact O-CG 3.46Å; V5-L9 PolarHBondContact O-N 3.41Å; V6-L9 PolarHBondContact O-N 3.16Å; L9-L12 PolarHBondContact O-N 3.44Å; L9-V13 WeakPolarHBondContact O-CB 3.27Å; L9-V13 VanDerWaalsContact O-CG2 3.27Å; L9-V13 WeakPolarHBondContact O-CG2 3.26Å; L9-V13 PolarHBondContact O-N 3.31Å
10	L	74.1	Confident	72.9	Confident	101 Å²	101	100.6 Å²	100.6	53%	0.529	59%	0.589	S	S	.	*	H	α-helix	trans	-63	-46	175.2	-73.6	175.4	0	0	0	111.1	V6 L7 L12 V13 E14	V6-L10 HydrophobicContact CG1-CD1 4.24Å; V6-L10 HydrophobicContact CG1-CG 4.49Å; V6-L10 WeakPolarHBondContact O-CG 3.41Å; V6-L10 PolarHBondContact O-N 3.49Å; L7-L10 PolarHBondContact O-N 2.9Å; L10-L12 VanDerWaalsContact C-N 3.29Å; L10-L12 PolarHBondContact O-N 2.93Å; L10-V13 PolarHBondContact O-N 3.47Å; L10-E14 PolarHBondContact O-N 2.87Å
11	L	75.6	Confident	72.6	Confident	95 Å²	95	101.3 Å²	101.3	50%	0.497	59%	0.587	S	S	.	*	H	α-helix	trans	-61.3	-39.3	177.5	-161.7	87.9	0	0	0	111.6	L7 L8 Q15	L7-L11 WeakPolarHBondContact O-CB 3.35Å; L7-L11 PolarHBondContact O-N 3.3Å; L8-L11 PolarHBondContact O-N 3.24Å; L11-Q15 WeakPolarHBondContact O-CB 3.41Å; L11-Q15 WeakPolarHBondContact O-CG 3.37Å; L11-Q15 PolarHBondContact O-N 3.37Å; L11-Q15 VanDerWaalsContact O-N 3.08Å; L11-Q15 PolarHBondContact O-NE2 3.19Å
12	L	72.6	Confident	72.8	Confident	110 Å²	110	97 Å²	97	58%	0.576	57%	0.573	S	S	*	*	H	α-helix	trans	-67.2	-42.1	176	-167.3	94.4	0	0	0	111.3	L8 L9 L10 Q15 A16	L8-L12 WeakPolarHBondContact O-CB 3.35Å; L8-L12 PolarHBondContact O-N 2.95Å; L9-L12 PolarHBondContact O-N 3.44Å; L10-L12 VanDerWaalsContact C-N 3.29Å; L10-L12 PolarHBondContact O-N 2.93Å; L12-Q15 PolarHBondContact O-N 2.88Å; L12-A16 VanDerWaalsContact O-CB 3.31Å; L12-A16 WeakPolarHBondContact O-CB 3.31Å; L12-A16 PolarHBondContact O-N 2.87Å
13	V	71.6	Confident	72.5	Confident	76 Å²	76	97.4 Å²	97.4	46%	0.461	57%	0.572	S	S	.	*	H	α-helix	trans	-65.4	-42.4	177.1	165.4	0	0	0	0	111.1	L9 L10 A16 A17	L9-V13 WeakPolarHBondContact O-CB 3.27Å; L9-V13 VanDerWaalsContact O-CG2 3.27Å; L9-V13 WeakPolarHBondContact O-CG2 3.26Å; L9-V13 PolarHBondContact O-N 3.31Å; L10-V13 PolarHBondContact O-N 3.47Å; V13-A16 PolarHBondContact O-N 3.38Å; V13-A17 WeakPolarHBondContact O-CB 3.33Å; V13-A17 PolarHBondContact O-N 2.91Å
14	E	68.1	Low	71.9	Confident	140 Å²	140	96.5 Å²	96.5	65%	0.654	56%	0.562	S	S	*	*	H	α-helix	trans	-62.2	-45.2	175.3	-76.8	-166.9	153.7	0	0	111.8	L10 A16 A17 A18	L10-E14 PolarHBondContact O-N 2.87Å; E14-A16 VanDerWaalsContact C-N 3.31Å; E14-A16 PolarHBondContact O-N 3.37Å; E14-A17 PolarHBondContact O-N 2.9Å; E14-A18 PolarHBondContact O-N 3.16Å
15	Q	66.2	Low	71.6	Confident	118 Å²	118	97.5 Å²	97.5	55%	0.551	57%	0.565	S	S	*	*	H	α-helix	trans	-61.2	-39.9	175.1	-80.8	166	83.5	0	0	112.1	L11 L12	L11-Q15 WeakPolarHBondContact O-CB 3.41Å; L11-Q15 WeakPolarHBondContact O-CG 3.37Å; L11-Q15 PolarHBondContact O-N 3.37Å; L11-Q15 VanDerWaalsContact O-N 3.08Å; L11-Q15 PolarHBondContact O-NE2 3.19Å; L12-Q15 PolarHBondContact O-N 2.88Å
16	A	61.7	Low	71.5	Confident	38 Å²	38	102 Å²	102	31%	0.314	57%	0.574	S	S	.	*	H	α-helix	trans	-71.7	-36.8	178.2	0	0	0	0	0	112.4	L12 V13 E14 A18 L19 L24	L12-A16 VanDerWaalsContact O-CB 3.31Å; L12-A16 WeakPolarHBondContact O-CB 3.31Å; L12-A16 PolarHBondContact O-N 2.87Å; V13-A16 PolarHBondContact O-N 3.38Å; E14-A16 VanDerWaalsContact C-N 3.31Å; E14-A16 PolarHBondContact O-N 3.37Å; A16-A18 VanDerWaalsContact C-N 3.26Å; A16-A18 PolarHBondContact O-N 2.85Å; A16-L19 CarbonylContact O-C 3.44Å; A16-L19 PolarHBondContact O-N 3.39Å; A16-L19 VanDerWaalsContact O-N 3.16Å; A16-L24 HydrophobicContact CB-CD1 4.46Å
17	A	63.1	Low	71.5	Confident	77 Å²	77	103 Å²	103	64%	0.636	58%	0.576	S	S	*	*	H	α-helix	trans	-65.6	-29.8	177.1	0	0	0	0	0	112.6	V13 E14 L19	V13-A17 WeakPolarHBondContact O-CB 3.33Å; V13-A17 PolarHBondContact O-N 2.91Å; E14-A17 PolarHBondContact O-N 2.9Å; A17-L19 VanDerWaalsContact C-N 3.28Å; A17-L19 PolarHBondContact O-N 2.82Å
18	A	64	Low	71.5	Confident	85 Å²	85	101.7 Å²	101.7	70%	0.702	57%	0.569	S	S	*	*	H	α-helix	trans	-68.5	-26.5	174.7	0	0	0	0	0	113	E14 A16	E14-A18 PolarHBondContact O-N 3.16Å; A16-A18 VanDerWaalsContact C-N 3.26Å; A16-A18 PolarHBondContact O-N 2.85Å
19	L	60.3	Low	71.8	Confident	123 Å²	123	101.1 Å²	101.1	64%	0.644	57%	0.567	S	S	*	*	S	Bend	trans	-99.7	83.1	173.6	-74.4	165.9	0	0	0	108.3	A16 A17 E21	A16-L19 CarbonylContact O-C 3.44Å; A16-L19 PolarHBondContact O-N 3.39Å; A16-L19 VanDerWaalsContact O-N 3.16Å; A17-L19 VanDerWaalsContact C-N 3.28Å; A17-L19 PolarHBondContact O-N 2.82Å; L19-E21 PolarHBondContact O-N 2.7Å
20	G	61.2	Low	72.5	Confident	73 Å²	73	98.6 Å²	98.6	75%	0.753	56%	0.56	S	S	*	*			trans	-64.1	64.8	-174.8	0	0	0	0	0	115.1
21	E	68.3	Low	73.2	Confident	117 Å²	117	98.5 Å²	98.5	55%	0.547	56%	0.559	S	S	.	*			trans	-84.3	124.6	172.7	-60.1	-154.5	178.7	0	0	110.1	L19 Q23 L24	L19-E21 PolarHBondContact O-N 2.7Å; E21-Q23 PolarHBondContact O-N 3.19Å; E21-L24 HydrophobicContact CB-CD1 4.02Å; E21-L24 HydrophobicContact CB-CG 4.14Å; E21-L24 WeakPolarHBondContact O-CB 3.47Å; E21-L24 PolarHBondContact O-N 3.05Å
22	P	68.6	Low	73.8	Confident	108 Å²	108	98.8 Å²	98.8	70%	0.701	56%	0.561	S	S	*	*	H	α-helix	trans	-64	-14.1	-177	26.6	-35.5	0	0	0	113.5	C25	P22-C25 PolarHBondContact O-SG 3.31Å
23	Q	70.8	Confident	74.9	Confident	143 Å²	143	100.2 Å²	100.2	67%	0.668	56%	0.562	S	S	*	*	H	α-helix	trans	-76.3	-26.2	176.4	-60.9	-176.2	3.1	0	0	112.3	E21 Y26	E21-Q23 PolarHBondContact O-N 3.19Å; Q23-Y26 WeakPolarHBondContact O-CB 3.47Å; Q23-Y26 PolarHBondContact O-N 2.96Å
24	L	71.1	Confident	76.1	Confident	70 Å²	70	101.7 Å²	101.7	37%	0.366	57%	0.567	S	S	.	*	H	α-helix	trans	-71.1	-36	-178.2	-64.7	171.4	0	0	0	111.8	A16 E21 Y26 I27 L28	A16-L24 HydrophobicContact CB-CD1 4.46Å; E21-L24 HydrophobicContact CB-CD1 4.02Å; E21-L24 HydrophobicContact CB-CG 4.14Å; E21-L24 WeakPolarHBondContact O-CB 3.47Å; E21-L24 PolarHBondContact O-N 3.05Å; L24-Y26 PolarHBondContact O-N 3.39Å; L24-I27 PolarHBondContact O-N 3.04Å; L24-L28 PolarHBondContact O-N 3.01Å
25	C	77	Confident	77.3	Confident	84 Å²	84	101.8 Å²	101.8	57%	0.568	56%	0.563	S	S	*	*	H	α-helix	trans	-63.1	-32.1	178.2	71.9	0	0	0	0	111.6	P22 L28 D29	P22-C25 PolarHBondContact O-SG 3.31Å; C25-L28 PolarHBondContact O-N 3.38Å; C25-D29 VanDerWaalsContact O-CB 3.26Å; C25-D29 WeakPolarHBondContact O-CB 3.26Å; C25-D29 PolarHBondContact O-N 3.48Å
26	Y	82.3	Confident	78.8	Confident	175 Å²	175	97.5 Å²	97.5	69%	0.686	55%	0.55	S	S	*	*	H	α-helix	trans	-64.7	-42.8	175.3	-177.5	-101.9	0	0	0	112.2	Q23 L24 D29 A30	Q23-Y26 WeakPolarHBondContact O-CB 3.47Å; Q23-Y26 PolarHBondContact O-N 2.96Å; L24-Y26 PolarHBondContact O-N 3.39Å; Y26-D29 PolarHBondContact O-N 2.88Å; Y26-A30 WeakPolarHBondContact O-CB 3.26Å; Y26-A30 PolarHBondContact O-N 3.23Å
27	I	82.9	Confident	80.5	Confident	96 Å²	96	99 Å²	99	49%	0.492	55%	0.552	S	S	.	*	H	α-helix	trans	-67.7	-43	177.8	-64	159.1	0	0	0	110.1	L24 A30 I31	L24-I27 PolarHBondContact O-N 3.04Å; I27-A30 PolarHBondContact O-N 2.98Å; I27-I31 HydrophobicContact CG2-CD1 4.06Å; I27-I31 WeakPolarHBondContact O-CG1 3.35Å; I27-I31 PolarHBondContact O-N 2.94Å
28	L	83.6	Confident	82	Confident	89 Å²	89	99.3 Å²	99.3	47%	0.466	55%	0.546	S	S	.	.	H	α-helix	trans	-63.4	-43.8	177.8	-166.4	73.5	0	0	0	111.1	L24 C25 A30 I31 L32	L24-L28 PolarHBondContact O-N 3.01Å; C25-L28 PolarHBondContact O-N 3.38Å; L28-A30 VanDerWaalsContact C-N 3.34Å; L28-A30 PolarHBondContact O-N 3.5Å; L28-I31 PolarHBondContact O-N 3.49Å; L28-L32 HydrophobicContact CG-CD1 4.29Å; L28-L32 WeakPolarHBondContact O-CB 3.35Å; L28-L32 VanDerWaalsContact O-CG 3.26Å; L28-L32 WeakPolarHBondContact O-CG 3.47Å; L28-L32 PolarHBondContact O-N 2.84Å
29	D	88.9	Confident	83.5	Confident	105 Å²	105	99 Å²	99	56%	0.561	53%	0.532	S	S	*	.	H	α-helix	trans	-61.4	-42.6	175.4	-171.1	36.4	0	0	0	111.3	C25 Y26 I31 L32 F33	C25-D29 VanDerWaalsContact O-CB 3.26Å; C25-D29 WeakPolarHBondContact O-CB 3.26Å; C25-D29 PolarHBondContact O-N 3.48Å; Y26-D29 PolarHBondContact O-N 2.88Å; D29-I31 VanDerWaalsContact C-N 3.34Å; D29-I31 PolarHBondContact O-N 2.92Å; D29-L32 PolarHBondContact O-N 2.88Å; D29-F33 VanDerWaalsContact O-CB 3.24Å; D29-F33 WeakPolarHBondContact O-CB 3.39Å; D29-F33 PolarHBondContact O-N 3.4Å
30	A	91.4	Very high	85.2	Confident	47 Å²	47	97.5 Å²	97.5	39%	0.388	53%	0.528	S	S	.	.	H	α-helix	trans	-60.8	-40.6	174.8	0	0	0	0	0	112.8	Y26 I27 L28 F33 L34	Y26-A30 WeakPolarHBondContact O-CB 3.26Å; Y26-A30 PolarHBondContact O-N 3.23Å; I27-A30 PolarHBondContact O-N 2.98Å; L28-A30 VanDerWaalsContact C-N 3.34Å; L28-A30 PolarHBondContact O-N 3.5Å; A30-F33 PolarHBondContact O-N 3.43Å; A30-L34 WeakPolarHBondContact O-CB 3.28Å; A30-L34 PolarHBondContact O-N 3.31Å
31	I	89.2	Confident	86.8	Confident	100 Å²	100	99.2 Å²	99.2	51%	0.513	52%	0.52	S	S	.	.	H	α-helix	trans	-66.6	-44.5	175.7	-68	166.2	0	0	0	110.7	I27 L28 D29 F33 L34 Y35	I27-I31 HydrophobicContact CG2-CD1 4.06Å; I27-I31 WeakPolarHBondContact O-CG1 3.35Å; I27-I31 PolarHBondContact O-N 2.94Å; L28-I31 PolarHBondContact O-N 3.49Å; D29-I31 VanDerWaalsContact C-N 3.34Å; D29-I31 PolarHBondContact O-N 2.92Å; I31-F33 VanDerWaalsContact C-N 3.33Å; I31-F33 PolarHBondContact O-N 3.44Å; I31-L34 PolarHBondContact O-N 2.91Å; I31-Y35 VanDerWaalsContact O-CB 3.28Å; I31-Y35 WeakPolarHBondContact O-CB 3.24Å; I31-Y35 PolarHBondContact O-N 2.77Å
32	L	87.6	Confident	88.1	Confident	100 Å²	100	98.5 Å²	98.5	52%	0.524	52%	0.519	S	S	.	.	H	α-helix	trans	-63.1	-40.2	177.3	-70.4	173.2	0	0	0	111.4	L28 D29 Y35 G36	L28-L32 HydrophobicContact CG-CD1 4.29Å; L28-L32 WeakPolarHBondContact O-CB 3.35Å; L28-L32 VanDerWaalsContact O-CG 3.26Å; L28-L32 WeakPolarHBondContact O-CG 3.47Å; L28-L32 PolarHBondContact O-N 2.84Å; D29-L32 PolarHBondContact O-N 2.88Å; L32-Y35 PolarHBondContact O-N 2.89Å; L32-G36 PolarHBondContact O-N 3.42Å
33	F	95.1	Very high	89.2	Confident	140 Å²	140	100.4 Å²	100.4	61%	0.614	51%	0.513	S	S	*	.	H	α-helix	trans	-64.1	-48.5	175.6	-178.6	-107.4	0	0	0	111.7	D29 A30 I31 Y35 G36 I37	D29-F33 VanDerWaalsContact O-CB 3.24Å; D29-F33 WeakPolarHBondContact O-CB 3.39Å; D29-F33 PolarHBondContact O-N 3.4Å; A30-F33 PolarHBondContact O-N 3.43Å; I31-F33 VanDerWaalsContact C-N 3.33Å; I31-F33 PolarHBondContact O-N 3.44Å; F33-Y35 VanDerWaalsContact C-N 3.31Å; F33-Y35 PolarHBondContact O-N 3.37Å; F33-G36 PolarHBondContact O-N 2.97Å; F33-G36 VanDerWaalsContact O-N 3.17Å; F33-I37 HydrophobicContact CD1-CD1 3.76Å; F33-I37 HydrophobicContact CE1-CD1 3.29Å; F33-I37 HydrophobicContact CE1-CG1 4.28Å; F33-I37 HydrophobicContact CE2-CD1 4.43Å; F33-I37 HydrophobicContact CZ-CD1 3.67Å; F33-I37 HydrophobicContact CZ-CG1 4.33Å; F33-I37 WeakPolarHBondContact O-CG1 3.36Å; F33-I37 PolarHBondContact O-N 3.47Å
34	L	96.2	Very high	90.2	Very high	108 Å²	108	96.4 Å²	96.4	57%	0.565	50%	0.5	S	S	*	.	H	α-helix	trans	-59.6	-44	176.2	179.7	64.2	0	0	0	111.3	A30 I31 G36 I37 V38	A30-L34 WeakPolarHBondContact O-CB 3.28Å; A30-L34 PolarHBondContact O-N 3.31Å; I31-L34 PolarHBondContact O-N 2.91Å; L34-G36 VanDerWaalsContact C-N 3.33Å; L34-G36 PolarHBondContact O-N 3.23Å; L34-I37 PolarHBondContact O-N 3.49Å; L34-V38 WeakPolarHBondContact O-CG2 3.48Å; L34-V38 PolarHBondContact O-N 2.95Å
35	Y	94.9	Very high	91.1	Very high	142 Å²	142	100.9 Å²	100.9	56%	0.557	51%	0.512	S	S	*	.	H	α-helix	trans	-58.8	-44.8	175.1	174.9	-107.9	0	0	0	111.7	I31 L32 F33 I37 V38 L39	I31-Y35 VanDerWaalsContact O-CB 3.28Å; I31-Y35 WeakPolarHBondContact O-CB 3.24Å; I31-Y35 PolarHBondContact O-N 2.77Å; L32-Y35 PolarHBondContact O-N 2.89Å; F33-Y35 VanDerWaalsContact C-N 3.31Å; F33-Y35 PolarHBondContact O-N 3.37Å; Y35-I37 VanDerWaalsContact C-N 3.34Å; Y35-I37 PolarHBondContact O-N 3.49Å; Y35-V38 PolarHBondContact O-N 3.44Å; Y35-L39 HydrophobicContact CD1-CD1 3.81Å; Y35-L39 HydrophobicContact CE1-CD1 3.24Å; Y35-L39 HydrophobicContact CE1-CG 4.18Å; Y35-L39 HydrophobicContact CE2-CD1 4.02Å; Y35-L39 HydrophobicContact CE2-CD2 4.49Å; Y35-L39 HydrophobicContact CE2-CG 4.1Å; Y35-L39 HydrophobicContact CG-CD1 4.42Å; Y35-L39 WeakPolarHBondContact O-CB 3.47Å; Y35-L39 WeakPolarHBondContact O-CG 3.33Å; Y35-L39 PolarHBondContact O-N 2.9Å
36	G	96.3	Very high	91.7	Very high	28 Å²	28	101.9 Å²	101.9	29%	0.289	51%	0.511	S	S	.	.	H	α-helix	trans	-59.5	-41.7	174.3	0	0	0	0	0	112.9	L32 F33 L34 T40	L32-G36 PolarHBondContact O-N 3.42Å; F33-G36 PolarHBondContact O-N 2.97Å; F33-G36 VanDerWaalsContact O-N 3.17Å; L34-G36 VanDerWaalsContact C-N 3.33Å; L34-G36 PolarHBondContact O-N 3.23Å; G36-T40 WeakPolarHBondContact O-CB 3.38Å; G36-T40 PolarHBondContact O-N 3.31Å; G36-T40 PolarHBondContact O-OG1 3.2Å
37	I	96.9	Very high	91.9	Very high	69 Å²	69	97.6 Å²	97.6	35%	0.354	50%	0.496	S	S	.	.	H	α-helix	trans	-62.1	-49.6	175.7	-70.9	172.3	0	0	0	110.6	F33 L34 Y35 L39 T40 L41	F33-I37 HydrophobicContact CD1-CD1 3.76Å; F33-I37 HydrophobicContact CE1-CD1 3.29Å; F33-I37 HydrophobicContact CE1-CG1 4.28Å; F33-I37 HydrophobicContact CE2-CD1 4.43Å; F33-I37 HydrophobicContact CZ-CD1 3.67Å; F33-I37 HydrophobicContact CZ-CG1 4.33Å; F33-I37 WeakPolarHBondContact O-CG1 3.36Å; F33-I37 PolarHBondContact O-N 3.47Å; L34-I37 PolarHBondContact O-N 3.49Å; Y35-I37 VanDerWaalsContact C-N 3.34Å; Y35-I37 PolarHBondContact O-N 3.49Å; I37-L39 VanDerWaalsContact C-N 3.35Å; I37-L39 PolarHBondContact O-N 3.17Å; I37-T40 PolarHBondContact O-N 3.32Å; I37-L41 HydrophobicContact CG2-CD1 4.07Å; I37-L41 HydrophobicContact CG2-CG 4.38Å; I37-L41 WeakPolarHBondContact O-CG 3.43Å; I37-L41 PolarHBondContact O-N 2.89Å
38	V	96.6	Very high	91.8	Very high	83 Å²	83	97.1 Å²	97.1	50%	0.503	49%	0.494	S	S	.	.	H	α-helix	trans	-60.7	-45.4	-178.9	173.1	0	0	0	0	110.8	L34 Y35 T40 L41 L42	L34-V38 WeakPolarHBondContact O-CG2 3.48Å; L34-V38 PolarHBondContact O-N 2.95Å; Y35-V38 PolarHBondContact O-N 3.44Å; V38-T40 PolarHBondContact O-N 3.45Å; V38-L41 PolarHBondContact O-N 2.92Å; V38-L42 WeakPolarHBondContact O-CB 3.48Å; V38-L42 PolarHBondContact O-N 2.73Å
39	L	95.1	Very high	91.7	Very high	79 Å²	79	98.1 Å²	98.1	41%	0.414	50%	0.496	S	S	.	.	H	α-helix	trans	-60.4	-44	174.7	-79.3	175.9	0	0	0	112.2	Y35 I37 L41 L42 Y43	Y35-L39 HydrophobicContact CD1-CD1 3.81Å; Y35-L39 HydrophobicContact CE1-CD1 3.24Å; Y35-L39 HydrophobicContact CE1-CG 4.18Å; Y35-L39 HydrophobicContact CE2-CD1 4.02Å; Y35-L39 HydrophobicContact CE2-CD2 4.49Å; Y35-L39 HydrophobicContact CE2-CG 4.1Å; Y35-L39 HydrophobicContact CG-CD1 4.42Å; Y35-L39 WeakPolarHBondContact O-CB 3.47Å; Y35-L39 WeakPolarHBondContact O-CG 3.33Å; Y35-L39 PolarHBondContact O-N 2.9Å; I37-L39 VanDerWaalsContact C-N 3.35Å; I37-L39 PolarHBondContact O-N 3.17Å; L39-L41 VanDerWaalsContact C-N 3.35Å; L39-L41 PolarHBondContact O-N 3.31Å; L39-L42 PolarHBondContact O-N 2.78Å; L39-Y43 WeakPolarHBondContact O-CB 3.19Å; L39-Y43 PolarHBondContact O-N 3.48Å
40	T	95	Very high	91.3	Very high	92 Å²	92	97.5 Å²	97.5	56%	0.564	50%	0.496	S	S	*	.	H	α-helix	trans	-62.2	-43.8	179	-58.8	0	0	0	0	110.9	G36 I37 V38 Y43 C44	G36-T40 WeakPolarHBondContact O-CB 3.38Å; G36-T40 PolarHBondContact O-N 3.31Å; G36-T40 PolarHBondContact O-OG1 3.2Å; I37-T40 PolarHBondContact O-N 3.32Å; V38-T40 PolarHBondContact O-N 3.45Å; T40-Y43 PolarHBondContact O-N 2.89Å; T40-C44 WeakPolarHBondContact O-CB 3.39Å; T40-C44 PolarHBondContact O-N 3.18Å
41	L	96	Very high	90.7	Very high	109 Å²	109	102.4 Å²	102.4	57%	0.571	50%	0.504	S	S	*	.	H	α-helix	trans	-64.2	-45.6	175.8	-70.2	177.6	0	0	0	111.6	I37 V38 L39 C44 R45	I37-L41 HydrophobicContact CG2-CD1 4.07Å; I37-L41 HydrophobicContact CG2-CG 4.38Å; I37-L41 WeakPolarHBondContact O-CG 3.43Å; I37-L41 PolarHBondContact O-N 2.89Å; V38-L41 PolarHBondContact O-N 2.92Å; L39-L41 VanDerWaalsContact C-N 3.35Å; L39-L41 PolarHBondContact O-N 3.31Å; L41-C44 PolarHBondContact O-N 2.85Å; L41-R45 WeakPolarHBondContact O-CG 3.33Å; L41-R45 PolarHBondContact O-N 3.5Å
42	L	94.1	Very high	90	Very high	102 Å²	102	104.5 Å²	104.5	53%	0.534	51%	0.51	S	S	.	.	H	α-helix	trans	-63.3	-43.5	178.6	-175.6	60.2	0	0	0	111.5	V38 L39 R45 L46	V38-L42 WeakPolarHBondContact O-CB 3.48Å; V38-L42 PolarHBondContact O-N 2.73Å; L39-L42 PolarHBondContact O-N 2.78Å; L42-R45 PolarHBondContact O-N 2.91Å; L42-L46 WeakPolarHBondContact O-CB 3.33Å; L42-L46 PolarHBondContact O-N 3.33Å
43	Y	93.2	Very high	89.4	Confident	148 Å²	148	102.7 Å²	102.7	58%	0.58	51%	0.509	S	S	*	.	H	α-helix	trans	-61.7	-44.6	174.9	177.6	-106.3	0	0	0	111.4	L39 T40 R45 L46 K47	L39-Y43 WeakPolarHBondContact O-CB 3.19Å; L39-Y43 PolarHBondContact O-N 3.48Å; T40-Y43 PolarHBondContact O-N 2.89Å; Y43-R45 PolarHBondContact O-N 3.42Å; Y43-L46 PolarHBondContact O-N 3.22Å; Y43-K47 HydrophobicContact CE1-CD 3.91Å; Y43-K47 WeakPolarHBondContact O-CB 3.16Å; Y43-K47 PolarHBondContact O-N 2.87Å
44	C	91.6	Very high	88.4	Confident	58 Å²	58	98.5 Å²	98.5	39%	0.392	50%	0.5	S	S	.	.	H	α-helix	trans	-60.2	-46.4	176.2	-169.1	0	0	0	0	111.1	T40 L41 K47 I48	T40-C44 WeakPolarHBondContact O-CB 3.39Å; T40-C44 PolarHBondContact O-N 3.18Å; L41-C44 PolarHBondContact O-N 2.85Å; C44-K47 PolarHBondContact O-N 3.44Å; C44-I48 WeakPolarHBondContact O-CB 3.22Å; C44-I48 WeakPolarHBondContact O-CD1 3.45Å; C44-I48 WeakPolarHBondContact O-CG1 3.28Å; C44-I48 PolarHBondContact O-N 2.84Å; C44-I48 VanDerWaalsContact SG-CD1 3.52Å
45	R	90.1	Very high	87.3	Confident	164 Å²	164	98.2 Å²	98.2	62%	0.619	50%	0.498	S	S	*	.	H	α-helix	trans	-59.9	-49.7	176.8	-73.8	-178.7	70.2	-167.9	1.7	111.9	L41 L42 Y43 I48 Q49	L41-R45 WeakPolarHBondContact O-CG 3.33Å; L41-R45 PolarHBondContact O-N 3.5Å; L42-R45 PolarHBondContact O-N 2.91Å; Y43-R45 PolarHBondContact O-N 3.42Å; R45-I48 PolarHBondContact O-N 2.93Å; R45-Q49 WeakPolarHBondContact O-CB 3.17Å; R45-Q49 VanDerWaalsContact O-CG 3.28Å; R45-Q49 WeakPolarHBondContact O-CG 3.33Å; R45-Q49 PolarHBondContact O-N 2.88Å
46	L	88.3	Confident	86.1	Confident	105 Å²	105	94.2 Å²	94.2	55%	0.55	49%	0.494	S	S	.	.	H	α-helix	trans	-63.6	-45.6	-179.5	-173.7	63.2	0	0	0	111.1	L42 Y43 I48 Q49 V50	L42-L46 WeakPolarHBondContact O-CB 3.33Å; L42-L46 PolarHBondContact O-N 3.33Å; Y43-L46 PolarHBondContact O-N 3.22Å; L46-I48 PolarHBondContact O-N 3.47Å; L46-Q49 PolarHBondContact O-N 3.39Å; L46-V50 WeakPolarHBondContact O-CG2 3.31Å; L46-V50 PolarHBondContact O-N 3.48Å
47	K	86.9	Confident	84.6	Confident	85 Å²	85	96.4 Å²	96.4	37%	0.37	51%	0.505	S	S	.	.	H	α-helix	trans	-63.7	-40.6	178.7	-173.7	176.8	-178.1	178.6	0	112.2	Y43 C44 R51	Y43-K47 HydrophobicContact CE1-CD 3.91Å; Y43-K47 WeakPolarHBondContact O-CB 3.16Å; Y43-K47 PolarHBondContact O-N 2.87Å; C44-K47 PolarHBondContact O-N 3.44Å; K47-R51 WeakPolarHBondContact O-CB 3.37Å; K47-R51 VanDerWaalsContact O-CG 3.32Å; K47-R51 WeakPolarHBondContact O-CG 3.47Å; K47-R51 PolarHBondContact O-N 3.29Å
48	I	81.6	Confident	82.9	Confident	86 Å²	86	100.2 Å²	100.2	44%	0.441	52%	0.516	S	S	.	.	H	α-helix	trans	-65.7	-41.4	174.9	-69.4	166.9	0	0	0	110.4	C44 R45 L46 R51 K52	C44-I48 WeakPolarHBondContact O-CB 3.22Å; C44-I48 WeakPolarHBondContact O-CD1 3.45Å; C44-I48 WeakPolarHBondContact O-CG1 3.28Å; C44-I48 PolarHBondContact O-N 2.84Å; C44-I48 VanDerWaalsContact SG-CD1 3.52Å; R45-I48 PolarHBondContact O-N 2.93Å; L46-I48 PolarHBondContact O-N 3.47Å; I48-R51 PolarHBondContact O-N 2.85Å; I48-K52 HydrophobicContact CG2-CD 4.16Å; I48-K52 HydrophobicContact CG2-CG 4.35Å; I48-K52 VanDerWaalsContact O-CB 3.31Å; I48-K52 WeakPolarHBondContact O-CB 3.45Å; I48-K52 WeakPolarHBondContact O-CG 3.38Å; I48-K52 PolarHBondContact O-N 2.86Å
49	Q	80.9	Confident	81.3	Confident	111 Å²	111	103 Å²	103	52%	0.519	52%	0.524	S	S	.	.	H	α-helix	trans	-62.5	-45.2	176.3	-75.9	175.4	-4.5	0	0	112	R45 L46 K52 A53	R45-Q49 WeakPolarHBondContact O-CB 3.17Å; R45-Q49 VanDerWaalsContact O-CG 3.28Å; R45-Q49 WeakPolarHBondContact O-CG 3.33Å; R45-Q49 PolarHBondContact O-N 2.88Å; L46-Q49 PolarHBondContact O-N 3.39Å; Q49-K52 PolarHBondContact O-N 3.47Å; Q49-A53 WeakPolarHBondContact O-CB 3.41Å; Q49-A53 PolarHBondContact O-N 3.38Å
50	V	80.1	Confident	79.5	Confident	91 Å²	91	107 Å²	107	55%	0.552	54%	0.538	S	S	*	.	H	α-helix	trans	-63.8	-43.8	176.7	172.3	0	0	0	0	111	L46 A53 A54	L46-V50 WeakPolarHBondContact O-CG2 3.31Å; L46-V50 PolarHBondContact O-N 3.48Å; V50-A53 PolarHBondContact O-N 3.28Å; V50-A54 WeakPolarHBondContact O-CB 3.35Å; V50-A54 PolarHBondContact O-N 3.42Å
51	R	78.7	Confident	77.7	Confident	151 Å²	151	105.3 Å²	105.3	57%	0.57	53%	0.53	S	S	*	.	H	α-helix	trans	-63	-41.9	174.9	-76.2	-179.4	175.3	-165	-4.2	112.1	K47 I48 A53 A54 I55	K47-R51 WeakPolarHBondContact O-CB 3.37Å; K47-R51 VanDerWaalsContact O-CG 3.32Å; K47-R51 WeakPolarHBondContact O-CG 3.47Å; K47-R51 PolarHBondContact O-N 3.29Å; I48-R51 PolarHBondContact O-N 2.85Å; R51-A53 VanDerWaalsContact C-N 3.34Å; R51-A54 PolarHBondContact O-N 2.92Å; R51-I55 WeakPolarHBondContact O-CB 3.19Å; R51-I55 VanDerWaalsContact O-CG1 3.23Å; R51-I55 WeakPolarHBondContact O-CG1 3.23Å; R51-I55 PolarHBondContact O-N 2.89Å
52	K	75.2	Confident	75.7	Confident	144 Å²	144	102.2 Å²	102.2	63%	0.626	51%	0.514	S	S	*	.	H	α-helix	trans	-61.9	-41.4	174.6	-82.7	-175.9	157.5	-173.8	0	111.7	I48 Q49 A56	I48-K52 HydrophobicContact CG2-CD 4.16Å; I48-K52 HydrophobicContact CG2-CG 4.35Å; I48-K52 VanDerWaalsContact O-CB 3.31Å; I48-K52 WeakPolarHBondContact O-CB 3.45Å; I48-K52 WeakPolarHBondContact O-CG 3.38Å; I48-K52 PolarHBondContact O-N 2.86Å; Q49-K52 PolarHBondContact O-N 3.47Å; K52-A56 WeakPolarHBondContact O-CB 3.45Å; K52-A56 PolarHBondContact O-N 3.28Å
53	A	74.8	Confident	73.9	Confident	61 Å²	61	99.8 Å²	99.8	50%	0.504	51%	0.514	S	S	.	.	H	α-helix	trans	-65.9	-40	175.3	0	0	0	0	0	111.8	Q49 V50 R51 A56 S57	Q49-A53 WeakPolarHBondContact O-CB 3.41Å; Q49-A53 PolarHBondContact O-N 3.38Å; V50-A53 PolarHBondContact O-N 3.28Å; R51-A53 VanDerWaalsContact C-N 3.34Å; A53-A56 PolarHBondContact O-N 2.86Å; A53-S57 WeakPolarHBondContact O-CB 3.32Å; A53-S57 PolarHBondContact O-N 3.3Å; A53-S57 PolarHBondContact O-OG 2.81Å
54	A	74.8	Confident	72.3	Confident	52 Å²	52	98.1 Å²	98.1	43%	0.43	52%	0.519	S	S	.	.	H	α-helix	trans	-65.2	-46.6	175.4	0	0	0	0	0	111.7	V50 R51 S57 Y58	V50-A54 WeakPolarHBondContact O-CB 3.35Å; V50-A54 PolarHBondContact O-N 3.42Å; R51-A54 PolarHBondContact O-N 2.92Å; A54-S57 WeakPolarHBondContact CA-OG 3.43Å; A54-S57 PolarHBondContact O-N 3.16Å; A54-S57 PolarHBondContact O-OG 2.74Å; A54-Y58 WeakPolarHBondContact O-CB 3.21Å; A54-Y58 PolarHBondContact O-N 2.82Å
55	I	72.9	Confident	70.5	Confident	103 Å²	103	103.5 Å²	103.5	53%	0.528	53%	0.532	S	S	.	.	H	α-helix	trans	-62.4	-45.1	175.3	-66.4	164.2	0	0	0	110.2	R51 S57 Y58 E59	R51-I55 WeakPolarHBondContact O-CB 3.19Å; R51-I55 VanDerWaalsContact O-CG1 3.23Å; R51-I55 WeakPolarHBondContact O-CG1 3.23Å; R51-I55 PolarHBondContact O-N 2.89Å; I55-S57 VanDerWaalsContact C-N 3.27Å; I55-S57 PolarHBondContact O-N 2.86Å; I55-Y58 CarbonylContact O-C 3.59Å; I55-Y58 PolarHBondContact O-N 2.68Å; I55-Y58 VanDerWaalsContact O-N 3.16Å; I55-E59 WeakPolarHBondContact O-CB 3.33Å; I55-E59 PolarHBondContact O-N 3.41Å
56	A	68.8	Low	68.8	Low	57 Å²	57	98.9 Å²	98.9	47%	0.471	52%	0.522	S	S	.	.	H	α-helix	trans	-63	-34.5	176.6	0	0	0	0	0	112.3	K52 A53 K60	K52-A56 WeakPolarHBondContact O-CB 3.45Å; K52-A56 PolarHBondContact O-N 3.28Å; A53-A56 PolarHBondContact O-N 2.86Å; A56-K60 WeakPolarHBondContact O-CB 3.45Å; A56-K60 PolarHBondContact O-N 2.95Å
57	S	64.6	Low	67.2	Low	75 Å²	75	97.5 Å²	97.5	52%	0.524	53%	0.533	S	S	.	.	H	α-helix	trans	-70	-38.8	173.8	71.8	0	0	0	0	112.4	A53 A54 I55 K60 S61	A53-S57 WeakPolarHBondContact O-CB 3.32Å; A53-S57 PolarHBondContact O-N 3.3Å; A53-S57 PolarHBondContact O-OG 2.81Å; A54-S57 WeakPolarHBondContact CA-OG 3.43Å; A54-S57 PolarHBondContact O-N 3.16Å; A54-S57 PolarHBondContact O-OG 2.74Å; I55-S57 VanDerWaalsContact C-N 3.27Å; I55-S57 PolarHBondContact O-N 2.86Å; S57-K60 PolarHBondContact O-N 3.36Å; S57-S61 PolarHBondContact O-N 3.22Å; S57-S61 PolarHBondContact O-OG 2.84Å
58	Y	62.7	Low	65.6	Low	148 Å²	148	101.1 Å²	101.1	58%	0.58	56%	0.555	S	S	*	*	H	α-helix	trans	-70.4	-42.7	177.1	-174.7	-94.9	0	0	0	111.2	A54 I55 K60 S61 D62	A54-Y58 WeakPolarHBondContact O-CB 3.21Å; A54-Y58 PolarHBondContact O-N 2.82Å; I55-Y58 CarbonylContact O-C 3.59Å; I55-Y58 PolarHBondContact O-N 2.68Å; I55-Y58 VanDerWaalsContact O-N 3.16Å; Y58-K60 VanDerWaalsContact C-N 3.3Å; Y58-K60 PolarHBondContact O-N 3.32Å; Y58-S61 WeakPolarHBondContact CA-OG 2.85Å; Y58-S61 PolarHBondContact O-N 2.74Å; Y58-S61 PolarHBondContact O-OG 3.16Å; Y58-D62 WeakPolarHBondContact CE1-OD2 3.38Å; Y58-D62 VanDerWaalsContact O-CB 3.23Å; Y58-D62 WeakPolarHBondContact O-CB 3.44Å; Y58-D62 PolarHBondContact O-N 3.14Å; Y58-D62 PolarHBondContact OH-OD2 3.28Å
59	E	61.6	Low	64.1	Low	143 Å²	143	101.1 Å²	101.1	67%	0.668	56%	0.563	S	S	*	*	H	α-helix	trans	-66	-32.1	173.7	-171.9	177.6	116.1	0	0	111.6	I55 G63	I55-E59 WeakPolarHBondContact O-CB 3.33Å; I55-E59 PolarHBondContact O-N 3.41Å; E59-G63 WeakPolarHBondContact O-CA 3.39Å; E59-G63 PolarHBondContact O-N 3.46Å
60	K	58.6	Low	62.9	Low	162 Å²	162	101 Å²	101	70%	0.704	57%	0.57	S	S	*	*	H	α-helix	trans	-73.9	-37.3	173	-172.5	173.2	-178.1	-176.6	0	112.3	A56 S57 Y58 G63 V64	A56-K60 WeakPolarHBondContact O-CB 3.45Å; A56-K60 PolarHBondContact O-N 2.95Å; S57-K60 PolarHBondContact O-N 3.36Å; Y58-K60 VanDerWaalsContact C-N 3.3Å; Y58-K60 PolarHBondContact O-N 3.32Å; K60-G63 PolarHBondContact O-N 3.44Å; K60-V64 WeakPolarHBondContact O-CG2 3.29Å; K60-V64 PolarHBondContact O-N 2.71Å
61	S	56.6	Low	61.6	Low	57 Å²	57	107.4 Å²	107.4	40%	0.399	58%	0.584	S	S	.	*	H	α-helix	trans	-70.7	-43.1	174.6	59.6	0	0	0	0	111.4	S57 Y58 G63 V64 Y65	S57-S61 PolarHBondContact O-N 3.22Å; S57-S61 PolarHBondContact O-OG 2.84Å; Y58-S61 WeakPolarHBondContact CA-OG 2.85Å; Y58-S61 PolarHBondContact O-N 2.74Å; Y58-S61 PolarHBondContact O-OG 3.16Å; S61-G63 VanDerWaalsContact C-N 3.32Å; S61-V64 PolarHBondContact O-N 3.21Å; S61-Y65 PolarHBondContact O-N 2.88Å; S61-Y65 VanDerWaalsContact O-N 3.16Å
62	D	54.6	Low	60.4	Low	44 Å²	44	106 Å²	106	24%	0.235	59%	0.588	C	S	.	*	H	α-helix	trans	-63.5	-40.3	171.7	-83.1	6.6	0	0	0	108.9	Y58 V64 Y65 T66	Y58-D62 WeakPolarHBondContact CE1-OD2 3.38Å; Y58-D62 VanDerWaalsContact O-CB 3.23Å; Y58-D62 WeakPolarHBondContact O-CB 3.44Å; Y58-D62 PolarHBondContact O-N 3.14Å; Y58-D62 PolarHBondContact OH-OD2 3.28Å; D62-V64 PolarHBondContact O-N 2.55Å; D62-V64 VanDerWaalsContact O-N 3.09Å; D62-Y65 CarbonylContact O-C 3.35Å; D62-Y65 PolarHBondContact O-N 3.2Å; D62-T66 HydrophobicContact CB-CG2 4.18Å; D62-T66 VanDerWaalsContact O-CA 3.23Å; D62-T66 WeakPolarHBondContact O-CA 3.23Å; D62-T66 WeakPolarHBondContact O-CB 3.14Å; D62-T66 VanDerWaalsContact O-CG2 3.29Å; D62-T66 WeakPolarHBondContact O-CG2 3.1Å; D62-T66 PolarHBondContact O-N 3.09Å; D62-T66 PolarHBondContact O-OG1 2.98Å
63	G	56.6	Low	59.3	Low	51 Å²	51	108 Å²	108	53%	0.526	60%	0.6	S	S	.	*	H	α-helix	trans	-54.4	-31	174.2	0	0	0	0	0	114.7	E59 K60 S61 T66	E59-G63 WeakPolarHBondContact O-CA 3.39Å; E59-G63 PolarHBondContact O-N 3.46Å; K60-G63 PolarHBondContact O-N 3.44Å; S61-G63 VanDerWaalsContact C-N 3.32Å; G63-T66 WeakPolarHBondContact CA-OG1 3.23Å; G63-T66 PolarHBondContact O-OG1 3.11Å
64	V	58.9	Low	58.5	Low	113 Å²	113	112.8 Å²	112.8	69%	0.685	61%	0.612	S	S	*	*	H	α-helix	trans	-84.2	-29.2	176.8	178.3	0	0	0	0	111.9	K60 S61 D62	K60-V64 WeakPolarHBondContact O-CG2 3.29Å; K60-V64 PolarHBondContact O-N 2.71Å; S61-V64 PolarHBondContact O-N 3.21Å; D62-V64 PolarHBondContact O-N 2.55Å; D62-V64 VanDerWaalsContact O-N 3.09Å
65	Y	54	Low	57.6	Low	171 Å²	171	116.5 Å²	116.5	67%	0.671	63%	0.629	S	S	*	*	H	α-helix	trans	-109.6	2.3	179.9	-75.9	-83.3	0	0	0	115	S61 D62 G67 L68	S61-Y65 PolarHBondContact O-N 2.88Å; S61-Y65 VanDerWaalsContact O-N 3.16Å; D62-Y65 CarbonylContact O-C 3.35Å; D62-Y65 PolarHBondContact O-N 3.2Å; Y65-G67 PolarHBondContact O-N 3.14Å; Y65-G67 VanDerWaalsContact O-N 3.11Å; Y65-L68 PolarHBondContact O-N 2.88Å
66	T	54.8	Low	56.8	Low	66 Å²	66	122.2 Å²	122.2	41%	0.405	65%	0.646	S	S	.	*	H	α-helix	trans	-69.7	-11.2	-178.5	18.8	0	0	0	0	111.1	D62 G63 L68	D62-T66 HydrophobicContact CB-CG2 4.18Å; D62-T66 VanDerWaalsContact O-CA 3.23Å; D62-T66 WeakPolarHBondContact O-CA 3.23Å; D62-T66 WeakPolarHBondContact O-CB 3.14Å; D62-T66 VanDerWaalsContact O-CG2 3.29Å; D62-T66 WeakPolarHBondContact O-CG2 3.1Å; D62-T66 PolarHBondContact O-N 3.09Å; D62-T66 PolarHBondContact O-OG1 2.98Å; G63-T66 WeakPolarHBondContact CA-OG1 3.23Å; G63-T66 PolarHBondContact O-OG1 3.11Å; T66-L68 PolarHBondContact O-N 2.55Å; T66-L68 VanDerWaalsContact O-N 3.14Å
67	G	52.7	Low	56.5	Low	76 Å²	76	128.3 Å²	128.3	78%	0.784	67%	0.665	S	S	*	*	H	α-helix	trans	-56.4	-16	161.2	0	0	0	0	0	113.9	Y65	Y65-G67 PolarHBondContact O-N 3.14Å; Y65-G67 VanDerWaalsContact O-N 3.11Å
68	L	54.4	Low	56.5	Low	161 Å²	161	130.9 Å²	130.9	84%	0.843	68%	0.678	S	S	*	*	H	α-helix	trans	-132.8	-19.7	179.7	-133.7	76.1	0	0	0	117.3	Y65 T66	Y65-L68 PolarHBondContact O-N 2.88Å; T66-L68 PolarHBondContact O-N 2.55Å; T66-L68 VanDerWaalsContact O-N 3.14Å
69	S	50.3	Low	56.6	Low	87 Å²	87	130.6 Å²	130.6	61%	0.608	69%	0.685	S	S	*	*	H	α-helix	trans	-104.1	-5.9	-163.1	-66.3	0	0	0	0	118.1
70	T	55.4	Low	56.7	Low	108 Å²	108	132.8 Å²	132.8	66%	0.663	69%	0.692	S	S	*	*	S	Bend	trans	-105.6	-10.5	-172.4	-46.4	0	0	0	0	115.2	N72	T70-N72 PolarHBondContact O-N 3.27Å
71	R	53	Low	57	Low	225 Å²	225	133.2 Å²	133.2	85%	0.849	70%	0.697	S	S	*	*	S	Bend	trans	-97.6	76.2	-177.9	-173.7	149.9	137.3	89.2	-0.9	110.8
72	N	52.8	Low	57.5	Low	122 Å²	122	139.1 Å²	139.1	65%	0.652	72%	0.718	S	S	*	*			trans	56.3	99.4	-179.4	-68.2	-80.3	0	0	0	110.8	T70 E74	T70-N72 PolarHBondContact O-N 3.27Å; N72-E74 HydrophobicContact CB-CG 4Å; N72-E74 WeakPolarHBondContact O-CG 3.47Å; N72-E74 PolarHBondContact O-N 2.73Å
73	Q	52.3	Low	57.8	Low	187 Å²	187	146.3 Å²	146.3	87%	0.874	75%	0.747	S	S	*	*				0.9	56.7	95.8	-144.4	172.6	19.9	0	0	114.2	T75	Q73-T75 VanDerWaalsContact C-N 3.3Å; Q73-T75 PolarHBondContact O-N 2.89Å
74	E	57.7	Low	57.5	Low	161 Å²	161	149 Å²	149	75%	0.752	76%	0.756	S	S	*	*			trans	-61.6	101.2	167.2	-65.2	-163.4	175	0	0	105.2	N72 Y76	N72-E74 HydrophobicContact CB-CG 4Å; N72-E74 WeakPolarHBondContact O-CG 3.47Å; N72-E74 PolarHBondContact O-N 2.73Å; E74-Y76 PolarHBondContact O-N 2.94Å
75	T	55.9	Low	57.6	Low	130 Å²	130	149.9 Å²	149.9	80%	0.798	76%	0.764	S	S	*	*			trans	-47.6	109.9	171.8	-59	0	0	0	0	106.7	Q73 E77	Q73-T75 VanDerWaalsContact C-N 3.3Å; Q73-T75 PolarHBondContact O-N 2.89Å; T75-E77 PolarHBondContact O-N 3.13Å; T75-E77 VanDerWaalsContact O-N 3.13Å
76	Y	57.2	Low	57.3	Low	222 Å²	222	154.6 Å²	154.6	87%	0.871	79%	0.791	S	S	*	*			trans	-40.1	118.3	-174	-74.8	-94.4	0	0	0	111.5	E74 T78	E74-Y76 PolarHBondContact O-N 2.94Å; Y76-T78 PolarHBondContact O-N 3.07Å
77	E	61.6	Low	57.4	Low	185 Å²	185	159 Å²	159	86%	0.864	81%	0.811	S	S	*	*			trans	-70.4	117.4	164.4	-79.8	-163.3	166.6	0	0	108.2	T75 L79	T75-E77 PolarHBondContact O-N 3.13Å; T75-E77 VanDerWaalsContact O-N 3.13Å; E77-L79 PolarHBondContact O-N 3.27Å
78	T	65.7	Low	57.6	Low	130 Å²	130	163.4 Å²	163.4	80%	0.798	81%	0.812	S	S	*	*			trans	-55.2	113.3	172.9	-57.2	0	0	0	0	109.3	Y76 K80	Y76-T78 PolarHBondContact O-N 3.07Å; T78-K80 PolarHBondContact O-N 3.08Å
79	L	63.1	Low	57.8	Low	141 Å²	141	163.5 Å²	163.5	74%	0.738	81%	0.811	S	S	*	*			trans	-52.8	105.7	174.4	-72.8	168.9	0	0	0	109.8	E77 H81	E77-L79 PolarHBondContact O-N 3.27Å; L79-H81 PolarHBondContact O-N 2.94Å; L79-H81 VanDerWaalsContact O-N 3.08Å
80	K	63.7	Low	58.3	Low	189 Å²	189	168 Å²	168	82%	0.822	82%	0.822	S	S	*	*			trans	-71.6	102.6	169.3	-67.2	-170.2	-178.9	-174.7	0	107.6	T78 E82	T78-K80 PolarHBondContact O-N 3.08Å; K80-E82 PolarHBondContact O-N 3.05Å
81	H	65.4	Low	58.4	Low	171 Å²	171	171.8 Å²	171.8	79%	0.792	83%	0.832	S	S	*	*			trans	-70.1	96.1	167.9	-70.2	-81.6	0	0	0	108.5	L79 K83	L79-H81 PolarHBondContact O-N 2.94Å; L79-H81 VanDerWaalsContact O-N 3.08Å; H81-K83 PolarHBondContact O-N 3.24Å
82	E	66.5	Low	58.8	Low	181 Å²	181	168.2 Å²	168.2	85%	0.846	83%	0.831	S	S	*	*			trans	-74.8	108	164.1	-64.5	-142.5	156.6	0	0	108.4	K80	K80-E82 PolarHBondContact O-N 3.05Å
83	K	61	Low	59.2	Low	195 Å²	195	171.5 Å²	171.5	85%	0.848	84%	0.844	S	S	*	*	P	Polyproline II helix	trans	-62.6	128.9	176.4	-175.2	178.6	-171.1	170	0	108.8	H81	H81-K83 PolarHBondContact O-N 3.24Å
84	P	51.9	Low	59.8	Low	109 Å²	109	170.3 Å²	170.3	71%	0.708	84%	0.842	S	S	*	*	P	Polyproline II helix	trans	-60.5	147.7	-176.1	21.8	-31.6	0	0	0	112.3	Q86	P84-Q86 PolarHBondContact O-N 3.5Å
85	P	60.5	Low	59.9	Low	131 Å²	131	171.1 Å²	171.1	85%	0.851	85%	0.849	S	S	*	*	P	Polyproline II helix	trans	-64.6	131.5	-175.9	26.2	-33.1	0	0	0	111
86	Q	46.6	Very low	60.3	Low	269 Å²	269	174.8 Å²	174.8	100%	1.257	85%	0.854	S	S	*	*			trans	-95.9	0	161.2	-106.1	-175.6	-2.9	0	0	109.2	P84	P84-Q86 PolarHBondContact O-N 3.5Å

Retrieved 86 of 86 residues in 21.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).