A0A096MYJ1_PAPAN Loading...

Eukaryotic translation initiation factor 5A

Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts. Binds between the exit (E) and peptidyl (P) site of the ribosome and promotes rescue of stalled ribosome: specifically required for efficient translation of polyproline-containing peptides as well as other motifs that stall the ribosome. Acts as ribosome quality control (RQC) cofactor by joining the RQC complex to facilitate peptidyl transfer during CAT tailing step.

AlphaFold DB (C9J7B5), UniProt , Accession A0A096MYJ1, Species PAPAN (Papio anubis, Olive baboon), Gene EIF5A2, Length 109 aa.

						>A0A096MYJ1_PAPAN|A0A096MYJ1|EIF5A2
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQVSVMCAMSEEYAVAIKPCK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.1	Very low	60	Low	240 Å²	240	143.7 Å²	143.7	100%	1.182	80%	0.804	S	S	*	*				0	108.7	0	-86.2	165.9	161.6	0	0	105.5
2	A	50	Low	60.1	Low	96 Å²	96	139.3 Å²	139.3	79%	0.793	80%	0.8	S	S	*	*			trans	-86.2	117	175.9	0	0	0	0	0	106.7	E4	A2-E4 PolarHBondContact O-N 3.14Å; A2-E4 VanDerWaalsContact O-N 3.15Å
3	D	56.6	Low	59.9	Low	152 Å²	152	134.3 Å²	134.3	81%	0.813	80%	0.797	S	S	*	*			trans	-69.3	101.9	169.2	-78	-98.8	0	0	0	108.3	I5	D3-I5 PolarHBondContact O-N 3.07Å; D3-I5 VanDerWaalsContact O-N 3.16Å
4	E	62.1	Low	60.2	Low	191 Å²	191	130.9 Å²	130.9	89%	0.893	79%	0.791	S	S	*	*			trans	-65.5	105.1	165.8	-84.3	177.3	77.6	0	0	108.6	A2 D6	A2-E4 PolarHBondContact O-N 3.14Å; A2-E4 VanDerWaalsContact O-N 3.15Å; E4-D6 PolarHBondContact O-N 3.28Å
5	I	67.4	Low	60.9	Low	125 Å²	125	128.1 Å²	128.1	64%	0.641	78%	0.78	S	S	*	*			trans	-81.8	95.2	177.1	-34.9	174.2	0	0	0	107.6	D3 F7	D3-I5 PolarHBondContact O-N 3.07Å; D3-I5 VanDerWaalsContact O-N 3.16Å; I5-F7 HydrophobicContact CB-CD2 4.16Å; I5-F7 HydrophobicContact CB-CE2 3.65Å; I5-F7 HydrophobicContact CB-CZ 4.28Å; I5-F7 HydrophobicContact CD1-CE2 4.35Å; I5-F7 HydrophobicContact CG2-CD2 4Å; I5-F7 HydrophobicContact CG2-CE1 4.27Å; I5-F7 HydrophobicContact CG2-CE2 3.42Å; I5-F7 VanDerWaalsContact CG2-CE2 3.42Å; I5-F7 HydrophobicContact CG2-CZ 3.58Å; I5-F7 WeakPolarHBondContact O-CD2 3.38Å; I5-F7 PolarHBondContact O-N 3.47Å; I5-F7 VanDerWaalsContact O-N 3.11Å
6	D	62.1	Low	62.2	Low	124 Å²	124	126.3 Å²	126.3	66%	0.663	77%	0.774	S	S	*	*			trans	-71.9	95.6	173.2	-173.6	-98.7	0	0	0	109.8	E4 T8	E4-D6 PolarHBondContact O-N 3.28Å; D6-T8 PolarHBondContact O-N 3.39Å; D6-T8 VanDerWaalsContact O-N 3.11Å; D6-T8 WeakPolarHBondContact OD1-CB 3.41Å; D6-T8 WeakPolarHBondContact OD1-CG2 3.48Å; D6-T8 PolarHBondContact OD1-OG1 2.82Å
7	F	64.8	Low	63.9	Low	175 Å²	175	121.2 Å²	121.2	77%	0.768	74%	0.743	S	S	*	*			trans	-82.6	69.8	170.2	-68	-85.8	0	0	0	109.7	I5 T9	I5-F7 HydrophobicContact CB-CD2 4.16Å; I5-F7 HydrophobicContact CB-CE2 3.65Å; I5-F7 HydrophobicContact CB-CZ 4.28Å; I5-F7 HydrophobicContact CD1-CE2 4.35Å; I5-F7 HydrophobicContact CG2-CD2 4Å; I5-F7 HydrophobicContact CG2-CE1 4.27Å; I5-F7 HydrophobicContact CG2-CE2 3.42Å; I5-F7 VanDerWaalsContact CG2-CE2 3.42Å; I5-F7 HydrophobicContact CG2-CZ 3.58Å; I5-F7 WeakPolarHBondContact O-CD2 3.38Å; I5-F7 PolarHBondContact O-N 3.47Å; I5-F7 VanDerWaalsContact O-N 3.11Å; F7-T9 PolarHBondContact O-N 2.95Å
8	T	65.7	Low	65.4	Low	108 Å²	108	120.2 Å²	120.2	66%	0.663	72%	0.724	S	S	*	*			trans	-69.9	99	164.1	31.2	0	0	0	0	108.4	D6 G10	D6-T8 PolarHBondContact O-N 3.39Å; D6-T8 VanDerWaalsContact O-N 3.11Å; D6-T8 WeakPolarHBondContact OD1-CB 3.41Å; D6-T8 WeakPolarHBondContact OD1-CG2 3.48Å; D6-T8 PolarHBondContact OD1-OG1 2.82Å; T8-G10 VanDerWaalsContact C-N 3.26Å; T8-G10 PolarHBondContact O-N 2.81Å
9	T	63.5	Low	66.8	Low	145 Å²	145	118.7 Å²	118.7	89%	0.89	72%	0.718	S	S	*	*			trans	-57.7	93.1	166.6	-19.5	0	0	0	0	107.7	F7 D11	F7-T9 PolarHBondContact O-N 2.95Å; T9-D11 PolarHBondContact O-N 3.34Å; T9-D11 VanDerWaalsContact O-N 3.1Å
10	G	60.5	Low	68.1	Low	68 Å²	68	116.1 Å²	116.1	70%	0.701	70%	0.698	S	S	*	*			trans	-68	108.1	-179.3	0	0	0	0	0	109.2	T8 A12	T8-G10 VanDerWaalsContact C-N 3.26Å; T8-G10 PolarHBondContact O-N 2.81Å; G10-A12 PolarHBondContact O-N 3.14Å
11	D	60.7	Low	69.4	Low	157 Å²	157	114.4 Å²	114.4	84%	0.84	68%	0.683	S	S	*	*			trans	-62.3	104	163.7	-164.9	-99.4	0	0	0	106.2	T9 G13	T9-D11 PolarHBondContact O-N 3.34Å; T9-D11 VanDerWaalsContact O-N 3.1Å; D11-G13 VanDerWaalsContact C-N 3.3Å; D11-G13 PolarHBondContact O-N 3.25Å
12	A	60.3	Low	71.4	Confident	91 Å²	91	103 Å²	103	75%	0.752	63%	0.626	S	S	*	*			trans	-63.2	99	176.8	0	0	0	0	0	106.5	G10 A14	G10-A12 PolarHBondContact O-N 3.14Å; A12-A14 PolarHBondContact O-N 3.11Å
13	G	58.3	Low	73.3	Confident	74 Å²	74	100.5 Å²	100.5	76%	0.763	60%	0.604	S	S	*	*			trans	-56.4	81.6	-173.8	0	0	0	0	0	112.2	D11 S15	D11-G13 VanDerWaalsContact C-N 3.3Å; D11-G13 PolarHBondContact O-N 3.25Å; G13-S15 PolarHBondContact O-N 3.16Å
14	A	63.4	Low	75	Confident	86 Å²	86	95.4 Å²	95.4	71%	0.711	58%	0.583	S	S	*	*			trans	-65.9	128.4	174	0	0	0	0	0	107.4	A12 S16	A12-A14 PolarHBondContact O-N 3.11Å; A14-S16 PolarHBondContact O-N 2.63Å
15	S	71.8	Confident	76.5	Confident	89 Å²	89	86.6 Å²	86.6	62%	0.622	54%	0.542	S	S	*	.			trans	-57.7	124.8	177	-173.3	0	0	0	0	109.8	G13 T17	G13-S15 PolarHBondContact O-N 3.16Å; S15-T17 WeakPolarHBondContact CB-O 3.36Å; S15-T17 PolarHBondContact O-N 3.15Å; S15-T17 PolarHBondContact OG-O 3.18Å
16	S	81.1	Confident	77.7	Confident	99 Å²	99	88.1 Å²	88.1	69%	0.692	54%	0.539	S	S	*	.	S	Bend	trans	-63.7	-22.1	179	-57.5	0	0	0	0	112.7	A14 N83	A14-S16 PolarHBondContact O-N 2.63Å; S16-N83 PolarHBondContact O-N 3.09Å; S16-N83 VanDerWaalsContact O-N 3.12Å
17	T	90.3	Very high	79.1	Confident	40 Å²	40	89 Å²	89	25%	0.245	54%	0.537	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.9	160.4	178.5	62.5	0	0	0	0	111.3	S15 V32 D80 V81	S15-T17 WeakPolarHBondContact CB-O 3.36Å; S15-T17 PolarHBondContact O-N 3.15Å; S15-T17 PolarHBondContact OG-O 3.18Å; T17-V32 HydrophobicContact CG2-CG2 3.79Å; T17-D80 HydrophobicContact CG2-CB 4.19Å; T17-D80 PolarHBondContact OG1-OD1 2.81Å; T17-V81 CarbonylContact C-O 3.57Å; T17-V81 WeakPolarHBondContact CA-O 3.38Å; T17-V81 WeakPolarHBondContact CB-O 3.44Å
18	Y	91.2	Very high	80.4	Confident	103 Å²	103	85.2 Å²	85.2	40%	0.404	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	145.5	166.5	62	-88.9	0	0	0	109.9	M20 V81	Y18-M20 HydrophobicContact CE2-CB 4.3Å; Y18-M20 HydrophobicContact CE2-CE 3.87Å; Y18-V81 HydrophobicContact CD1-CB 4.37Å; Y18-V81 WeakPolarHBondContact CD1-O 3.49Å; Y18-V81 HydrophobicContact CD2-CB 4.17Å; Y18-V81 HydrophobicContact CE1-CB 3.96Å; Y18-V81 HydrophobicContact CE1-CG1 3.69Å; Y18-V81 HydrophobicContact CE2-CB 3.72Å; Y18-V81 HydrophobicContact CE2-CG1 3.93Å; Y18-V81 HydrophobicContact CE2-CG2 4.29Å; Y18-V81 HydrophobicContact CG-CB 4.48Å; Y18-V81 PolarHBondContact N-O 2.91Å; Y18-V81 PolarHBondContact O-N 3.11Å; Y18-V81 WeakPolarHBondContact OH-CG1 3.32Å
19	P	93.3	Very high	81.8	Confident	92 Å²	92	81.2 Å²	81.2	60%	0.597	51%	0.505	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.7	137.1	177.9	29.5	-33.8	0	0	0	110.6	N78	P19-N78 HydrophobicContact CB-CB 4.39Å
20	M	92.9	Very high	83.3	Confident	66 Å²	66	77.7 Å²	77.7	33%	0.325	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.4	143.6	172.4	-177.5	170.8	-90	0	0	110	Y18 C22 A24 L25 N78 M79 V81	Y18-M20 HydrophobicContact CE2-CB 4.3Å; Y18-M20 HydrophobicContact CE2-CE 3.87Å; M20-C22 PolarHBondContact O-N 2.83Å; M20-A24 HydrophobicContact CG-CB 3.92Å; M20-A24 HydrophobicContact SD-CB 4.28Å; M20-L25 HydrophobicContact SD-CD2 4.15Å; M20-N78 WeakPolarHBondContact O-CA 3.45Å; M20-M79 PolarHBondContact N-O 2.81Å; M20-M79 PolarHBondContact O-N 2.8Å; M20-V81 HydrophobicContact CB-CG2 3.63Å; M20-V81 HydrophobicContact CG-CG2 4.46Å; M20-V81 HydrophobicContact SD-CG2 4.28Å
21	Q	93.6	Very high	84.9	Confident	81 Å²	81	74.4 Å²	74.4	38%	0.379	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.9	136.6	178.8	-169	173.9	60.1	0	0	111.2	S23 A24 S75 T76	Q21-S23 WeakPolarHBondContact CG-OG 3.04Å; Q21-S23 PolarHBondContact O-N 3.03Å; Q21-S23 VanDerWaalsContact O-N 3.15Å; Q21-S23 PolarHBondContact OE1-OG 3.1Å; Q21-A24 HydrophobicContact CB-CB 4.42Å; Q21-A24 WeakPolarHBondContact O-CA 3.32Å; Q21-A24 WeakPolarHBondContact O-CB 3.41Å; Q21-A24 PolarHBondContact O-N 2.78Å; Q21-S75 WeakPolarHBondContact CG-O 3.36Å; Q21-T76 PolarHBondContact NE2-O 2.95Å
22	C	90.3	Very high	86.5	Confident	0 Å²	0	68.4 Å²	68.4	0%	0	41%	0.413	C	S	.	.	G	3₁₀ helix	trans	-55.7	-32.6	-178.8	173.9	0	0	0	0	112.1	M20 A24 M43 V56 C73 H77 M79	M20-C22 PolarHBondContact O-N 2.83Å; C22-A24 PolarHBondContact O-N 3.34Å; C22-M43 WeakPolarHBondContact O-CE 3.47Å; C22-V56 WeakPolarHBondContact SG-CB 3.2Å; C22-C73 HydrophobicContact CB-CB 4.15Å; C22-C73 WeakPolarHBondContact CB-SG 3.41Å; C22-C73 WeakPolarHBondContact SG-CB 3.24Å; C22-C73 CovalentContact SG-SG 2.08Å; C22-C73 PolarHBondContact SG-SG 2.66Å; C22-H77 VanDerWaalsContact CB-O 3.3Å; C22-H77 WeakPolarHBondContact CB-O 3.43Å; C22-H77 PolarHBondContact N-O 2.08Å; C22-M79 HydrophobicContact CB-CG 3.96Å
23	S	89.9	Confident	88.1	Confident	45 Å²	45	64.1 Å²	64.1	32%	0.315	38%	0.377	S	S	.	.	G	3₁₀ helix	trans	-69	-24.4	172.7	68.8	0	0	0	0	115.2	Q21 R26 S75	Q21-S23 WeakPolarHBondContact CG-OG 3.04Å; Q21-S23 PolarHBondContact O-N 3.03Å; Q21-S23 VanDerWaalsContact O-N 3.15Å; Q21-S23 PolarHBondContact OE1-OG 3.1Å; S23-R26 PolarHBondContact O-NH1 3.4Å; S23-S75 WeakPolarHBondContact CB-O 3.49Å; S23-S75 PolarHBondContact N-O 2.8Å
24	A	92.5	Very high	89.6	Confident	45 Å²	45	67.9 Å²	67.9	37%	0.372	37%	0.372	S	S	.	.	G	3₁₀ helix	trans	-83.8	-17.3	-179	0	0	0	0	0	112.1	M20 Q21 C22 R26	M20-A24 HydrophobicContact CG-CB 3.92Å; M20-A24 HydrophobicContact SD-CB 4.28Å; Q21-A24 HydrophobicContact CB-CB 4.42Å; Q21-A24 WeakPolarHBondContact O-CA 3.32Å; Q21-A24 WeakPolarHBondContact O-CB 3.41Å; Q21-A24 PolarHBondContact O-N 2.78Å; C22-A24 PolarHBondContact O-N 3.34Å; A24-R26 PolarHBondContact O-NH1 2.68Å
25	L	93.4	Very high	90.8	Very high	6 Å²	6	67.1 Å²	67.1	3%	0.031	37%	0.373	C	S	.	.			trans	-61.3	151.4	173.8	-62.3	175.3	0	0	0	111.3	M20 V31 I40 M43 L58 M79 V81	M20-L25 HydrophobicContact SD-CD2 4.15Å; L25-V31 HydrophobicContact CD1-CB 4.19Å; L25-V31 HydrophobicContact CD1-CG2 3.86Å; L25-V31 HydrophobicContact CD2-CB 4.44Å; L25-I40 HydrophobicContact CB-CD1 3.93Å; L25-I40 HydrophobicContact CD1-CD1 4.31Å; L25-I40 HydrophobicContact CD2-CD1 4.29Å; L25-I40 HydrophobicContact CG-CD1 4.41Å; L25-M43 HydrophobicContact CB-CE 4.43Å; L25-M43 WeakPolarHBondContact O-CE 3.21Å; L25-L58 HydrophobicContact CD1-CD1 3.89Å; L25-L58 HydrophobicContact CD1-CD2 4.37Å; L25-M79 HydrophobicContact CD1-CB 4.44Å; L25-V81 HydrophobicContact CD2-CG2 3.77Å
26	R	92.4	Very high	91.7	Very high	157 Å²	157	67.6 Å²	67.6	59%	0.592	36%	0.361	S	S	*	.			trans	-138.6	157.6	-178.6	-64.1	-66.7	-179.3	-90.8	0.9	110.3	S23 A24 G29 I40	S23-R26 PolarHBondContact O-NH1 3.4Å; A24-R26 PolarHBondContact O-NH1 2.68Å; R26-G29 WeakPolarHBondContact O-CA 3.47Å; R26-G29 PolarHBondContact O-N 3.12Å; R26-I40 WeakPolarHBondContact O-CD1 3.29Å
27	K	92.2	Very high	92.4	Very high	142 Å²	142	64.4 Å²	64.4	62%	0.617	34%	0.338	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.4	143	171.1	-173.2	175.5	-180	172.5	0	110.1	G29 V41	K27-G29 PolarHBondContact O-N 2.9Å; K27-V41 WeakPolarHBondContact CE-O 3.28Å
28	N	92.3	Very high	92.6	Very high	96 Å²	96	62.5 Å²	62.5	51%	0.513	33%	0.326	S	S	.	.	T	Hydrogen-bonded Turn	trans	65.2	-1.3	-170.7	-61.3	-55.5	0	0	0	115.8	K39 I40	N28-K39 VanDerWaalsContact OD1-CE 3.23Å; N28-K39 WeakPolarHBondContact OD1-CE 3.34Å; N28-K39 PolarHBondContact OD1-NZ 3.19Å; N28-I40 WeakPolarHBondContact CA-O 3.39Å; N28-I40 PolarHBondContact N-O 3.22Å
29	G	93.6	Very high	92.9	Very high	23 Å²	23	61.4 Å²	61.4	24%	0.237	32%	0.324	C	S	.	.			trans	-70.7	177.6	167.9	0	0	0	0	0	112.1	R26 K27 I40	R26-G29 WeakPolarHBondContact O-CA 3.47Å; R26-G29 PolarHBondContact O-N 3.12Å; K27-G29 PolarHBondContact O-N 2.9Å; G29-I40 PolarHBondContact O-N 2.82Å
30	F	94.6	Very high	93	Very high	71 Å²	71	57 Å²	57	31%	0.311	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	148.2	177.7	-57.3	-80.2	0	0	0	110.4	C38 K39 I63 V81 P82 I84	F30-C38 WeakPolarHBondContact CA-O 3.23Å; F30-K39 HydrophobicContact CD1-CB 4.04Å; F30-K39 HydrophobicContact CD1-CG 4.43Å; F30-K39 HydrophobicContact CE1-CB 3.94Å; F30-K39 HydrophobicContact CE1-CG 4.12Å; F30-I63 HydrophobicContact CD1-CG2 4.25Å; F30-I63 HydrophobicContact CE1-CG2 4.05Å; F30-V81 WeakPolarHBondContact O-CG1 3.44Å; F30-P82 HydrophobicContact CB-CG 3.86Å; F30-I84 HydrophobicContact CB-CD1 3.93Å; F30-I84 HydrophobicContact CD1-CD1 3.28Å; F30-I84 HydrophobicContact CD2-CD1 3.78Å; F30-I84 HydrophobicContact CE1-CD1 3.57Å; F30-I84 HydrophobicContact CE2-CD1 4.05Å; F30-I84 HydrophobicContact CG-CD1 3.38Å; F30-I84 HydrophobicContact CG-CG1 4.44Å; F30-I84 HydrophobicContact CZ-CD1 3.94Å
31	V	95.3	Very high	93.1	Very high	0 Å²	0	56 Å²	56	0%	0	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.8	148.7	176.5	63.5	0	0	0	0	108.2	L25 L33 C38 I40 M79 D80	L25-V31 HydrophobicContact CD1-CB 4.19Å; L25-V31 HydrophobicContact CD1-CG2 3.86Å; L25-V31 HydrophobicContact CD2-CB 4.44Å; V31-L33 HydrophobicContact CG1-CD1 4.4Å; V31-L33 HydrophobicContact CG1-CD2 3.97Å; V31-L33 HydrophobicContact CG1-CG 3.94Å; V31-L33 HydrophobicContact CG2-CD2 4.5Å; V31-C38 PolarHBondContact N-O 2.96Å; V31-C38 PolarHBondContact O-N 3.2Å; V31-C38 VanDerWaalsContact O-O 3.13Å; V31-I40 HydrophobicContact CB-CD1 4.23Å; V31-I40 HydrophobicContact CB-CG1 4.4Å; V31-I40 HydrophobicContact CG1-CD1 3.91Å; V31-I40 HydrophobicContact CG1-CG1 3.61Å; V31-M79 HydrophobicContact CG2-CB 3.93Å; V31-D80 WeakPolarHBondContact CG2-O 3.44Å
32	V	94.4	Very high	93.1	Very high	31 Å²	31	57.4 Å²	57.4	19%	0.188	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83	114.9	172.8	-176.7	0	0	0	0	108.5	T17 R36 D80 P82	T17-V32 HydrophobicContact CG2-CG2 3.79Å; V32-R36 CarbonylContact C-O 3.52Å; V32-R36 VanDerWaalsContact CA-O 3.29Å; V32-R36 WeakPolarHBondContact CA-O 3.41Å; V32-D80 HydrophobicContact CB-CB 3.95Å; V32-D80 HydrophobicContact CG2-CB 3.95Å; V32-D80 PolarHBondContact N-O 2.95Å; V32-P82 HydrophobicContact CG2-CB 4.26Å; V32-P82 HydrophobicContact CG2-CG 4.31Å
33	L	93.6	Very high	93.3	Very high	1 Å²	1	59.9 Å²	59.9	1%	0.005	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	125	172.6	-60	177.7	0	0	0	108.8	V31 G35 R36 C38 D71 M79	V31-L33 HydrophobicContact CG1-CD1 4.4Å; V31-L33 HydrophobicContact CG1-CD2 3.97Å; V31-L33 HydrophobicContact CG1-CG 3.94Å; V31-L33 HydrophobicContact CG2-CD2 4.5Å; L33-G35 PolarHBondContact O-N 3.45Å; L33-G35 VanDerWaalsContact O-N 3.17Å; L33-R36 PolarHBondContact N-O 2.99Å; L33-R36 PolarHBondContact O-N 2.84Å; L33-C38 HydrophobicContact CB-CB 4.43Å; L33-C38 HydrophobicContact CD1-CB 3.96Å; L33-C38 HydrophobicContact CG-CB 4.15Å; L33-D71 HydrophobicContact CD2-CB 3.92Å; L33-M79 HydrophobicContact CD2-CE 4.35Å
34	K	89.2	Confident	93.4	Very high	152 Å²	152	60 Å²	60	66%	0.661	31%	0.312	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.8	40	179.3	-57.8	-178.7	-178.8	176.5	0	113.1	R36 Y69	K34-R36 VanDerWaalsContact C-N 3.29Å; K34-R36 PolarHBondContact O-N 3.31Å; K34-Y69 HydrophobicContact CD-CD1 4.13Å
35	G	89.3	Confident	93.4	Very high	70 Å²	70	62.3 Å²	62.3	72%	0.722	32%	0.322	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.7	10.3	-179.2	0	0	0	0	0	115.1	L33	L33-G35 PolarHBondContact O-N 3.45Å; L33-G35 VanDerWaalsContact O-N 3.17Å
36	R	91.6	Very high	93.3	Very high	99 Å²	99	65 Å²	65	37%	0.374	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	138.8	177.8	-62	-163.5	174.9	-153.1	-3.7	112.2	V32 L33 K34 C38 D62 T65	V32-R36 CarbonylContact C-O 3.52Å; V32-R36 VanDerWaalsContact CA-O 3.29Å; V32-R36 WeakPolarHBondContact CA-O 3.41Å; L33-R36 PolarHBondContact N-O 2.99Å; L33-R36 PolarHBondContact O-N 2.84Å; K34-R36 VanDerWaalsContact C-N 3.29Å; K34-R36 PolarHBondContact O-N 3.31Å; R36-C38 PolarHBondContact O-N 2.8Å; R36-D62 VanDerWaalsContact CD-OD2 3.28Å; R36-D62 WeakPolarHBondContact CD-OD2 3.48Å; R36-D62 IonicContact CZ-OD2 3.94Å; R36-D62 IonicContact NH1-OD2 3Å; R36-D62 PolarHBondContact NH1-OD2 2.88Å; R36-T65 VanDerWaalsContact NH1-CG2 3.28Å; R36-T65 PolarHBondContact NH1-OG1 2.86Å
37	P	94.1	Very high	93.1	Very high	32 Å²	32	65.8 Å²	65.8	21%	0.208	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72	117.6	175.2	28.4	-30.8	0	0	0	110.1	I63 F64 P82	P37-I63 HydrophobicContact CB-CD1 4.01Å; P37-I63 HydrophobicContact CB-CG1 4.39Å; P37-I63 HydrophobicContact CG-CD1 4.02Å; P37-I63 HydrophobicContact CG-CG1 4.15Å; P37-I63 PolarHBondContact O-N 2.83Å; P37-F64 HydrophobicContact CG-CD2 3.91Å; P37-F64 HydrophobicContact CG-CE2 3.52Å; P37-P82 HydrophobicContact CB-CB 4.07Å; P37-P82 HydrophobicContact CB-CG 3.87Å
38	C	96	Very high	92.7	Very high	0 Å²	0	62.9 Å²	62.9	0%	0	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	143.8	-179	-66.1	0	0	0	0	110.7	F30 V31 L33 R36 I61	F30-C38 WeakPolarHBondContact CA-O 3.23Å; V31-C38 PolarHBondContact N-O 2.96Å; V31-C38 PolarHBondContact O-N 3.2Å; V31-C38 VanDerWaalsContact O-O 3.13Å; L33-C38 HydrophobicContact CB-CB 4.43Å; L33-C38 HydrophobicContact CD1-CB 3.96Å; L33-C38 HydrophobicContact CG-CB 4.15Å; R36-C38 PolarHBondContact O-N 2.8Å; C38-I61 CarbonylContact C-O 3.52Å; C38-I61 VanDerWaalsContact CA-O 3.28Å; C38-I61 WeakPolarHBondContact CA-O 3.22Å
39	K	95.7	Very high	92.4	Very high	81 Å²	81	60.5 Å²	60.5	35%	0.352	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	126.6	166.9	-178	-179	178.2	-177.4	0	109.4	N28 F30 V41 G60 I61 I63	N28-K39 VanDerWaalsContact OD1-CE 3.23Å; N28-K39 WeakPolarHBondContact OD1-CE 3.34Å; N28-K39 PolarHBondContact OD1-NZ 3.19Å; F30-K39 HydrophobicContact CD1-CB 4.04Å; F30-K39 HydrophobicContact CD1-CG 4.43Å; F30-K39 HydrophobicContact CE1-CB 3.94Å; F30-K39 HydrophobicContact CE1-CG 4.12Å; K39-V41 PolarHBondContact O-N 2.85Å; K39-G60 CarbonylContact O-C 3.51Å; K39-G60 WeakPolarHBondContact O-CA 3.5Å; K39-I61 PolarHBondContact N-O 2.8Å; K39-I61 PolarHBondContact O-N 3.49Å; K39-I63 HydrophobicContact CB-CG2 4.11Å
40	I	95.6	Very high	92	Very high	0 Å²	0	68.7 Å²	68.7	0%	0	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.5	113.2	179.2	-57.3	167.7	0	0	0	109.2	L25 R26 N28 G29 V31 M43 L58	L25-I40 HydrophobicContact CB-CD1 3.93Å; L25-I40 HydrophobicContact CD1-CD1 4.31Å; L25-I40 HydrophobicContact CD2-CD1 4.29Å; L25-I40 HydrophobicContact CG-CD1 4.41Å; R26-I40 WeakPolarHBondContact O-CD1 3.29Å; N28-I40 WeakPolarHBondContact CA-O 3.39Å; N28-I40 PolarHBondContact N-O 3.22Å; G29-I40 PolarHBondContact O-N 2.82Å; V31-I40 HydrophobicContact CB-CD1 4.23Å; V31-I40 HydrophobicContact CB-CG1 4.4Å; V31-I40 HydrophobicContact CG1-CD1 3.91Å; V31-I40 HydrophobicContact CG1-CG1 3.61Å; I40-M43 HydrophobicContact CG2-CB 4.28Å; I40-L58 HydrophobicContact CD1-CD2 4.36Å; I40-L58 HydrophobicContact CG2-CD2 4.31Å
41	V	96.1	Very high	91.7	Very high	44 Å²	44	73.2 Å²	73.2	27%	0.267	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	-31.6	175.9	-68.7	0	0	0	0	112.2	K27 K39 V59 I61	K27-V41 WeakPolarHBondContact CE-O 3.28Å; K39-V41 PolarHBondContact O-N 2.85Å; V41-V59 HydrophobicContact CG2-CB 4.16Å; V41-V59 HydrophobicContact CG2-CG1 3.87Å; V41-V59 VanDerWaalsContact CG2-O 3.22Å; V41-V59 WeakPolarHBondContact CG2-O 3.47Å; V41-V59 PolarHBondContact N-O 2.98Å; V41-I61 HydrophobicContact CG1-CB 4.34Å; V41-I61 HydrophobicContact CG1-CD1 3.62Å; V41-I61 HydrophobicContact CG1-CG1 3.67Å; V41-I61 HydrophobicContact CG2-CD1 4.41Å; V41-I61 HydrophobicContact CG2-CG1 4.06Å
42	E	94.3	Very high	91.1	Very high	110 Å²	110	74.7 Å²	74.7	51%	0.514	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.9	143.2	178.5	-160.8	179.6	129	0	0	110.3	V59	E42-V59 HydrophobicContact CB-CB 3.96Å; E42-V59 HydrophobicContact CB-CG2 4.19Å; E42-V59 PolarHBondContact N-O 3.28Å; E42-V59 VanDerWaalsContact N-O 3.16Å; E42-V59 PolarHBondContact O-N 2.76Å
43	M	93.3	Very high	90.8	Very high	53 Å²	53	80 Å²	80	26%	0.261	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.4	123.4	176	-179.8	-173.8	-174.1	0	0	107.8	C22 L25 I40 V56 H57 L58	C22-M43 WeakPolarHBondContact O-CE 3.47Å; L25-M43 HydrophobicContact CB-CE 4.43Å; L25-M43 WeakPolarHBondContact O-CE 3.21Å; I40-M43 HydrophobicContact CG2-CB 4.28Å; M43-V56 HydrophobicContact CE-CG1 3.52Å; M43-V56 HydrophobicContact CE-CG2 4.38Å; M43-V56 HydrophobicContact CG-CG1 3.71Å; M43-V56 HydrophobicContact SD-CG1 4.44Å; M43-H57 WeakPolarHBondContact CA-O 3.17Å; M43-L58 HydrophobicContact CB-CD2 4.24Å; M43-L58 HydrophobicContact CG-CD2 3.86Å; M43-L58 HydrophobicContact SD-CD2 4.43Å
44	S	92.8	Very high	90.7	Very high	48 Å²	48	80.9 Å²	80.9	34%	0.336	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	138.8	175.8	50.4	0	0	0	0	109.9	V56 H57	S44-V56 CarbonylContact O-C 3.54Å; S44-V56 WeakPolarHBondContact O-CA 3.49Å; S44-H57 PolarHBondContact N-O 3.31Å; S44-H57 PolarHBondContact O-N 2.87Å; S44-H57 PolarHBondContact OG-ND1 3.27Å
45	T	91.8	Very high	90.8	Very high	92 Å²	92	78 Å²	78	56%	0.564	43%	0.425	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.4	127.5	178.8	-57.3	0	0	0	0	108.9	A54 K55 V56	T45-A54 HydrophobicContact CG2-CB 3.8Å; T45-K55 CarbonylContact C-O 3.49Å; T45-K55 WeakPolarHBondContact CA-O 3.44Å; T45-V56 HydrophobicContact CG2-CG2 4.46Å
46	S	90.9	Very high	91.1	Very high	63 Å²	63	74.7 Å²	74.7	44%	0.441	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	146.6	176.9	62.4	0	0	0	0	110.5	A54 K55	S46-A54 CarbonylContact O-C 3.52Å; S46-A54 VanDerWaalsContact O-CA 3.31Å; S46-A54 WeakPolarHBondContact O-CA 3.43Å; S46-K55 PolarHBondContact N-O 2.61Å; S46-K55 PolarHBondContact O-N 3Å
47	K	88.3	Confident	91.2	Very high	174 Å²	174	72.4 Å²	72.4	76%	0.757	39%	0.385	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104	123.9	170.3	-69.3	-175.3	178.8	-179.1	0	108	G49	K47-G49 PolarHBondContact O-N 3.25Å
48	T	84.5	Confident	91.2	Very high	81 Å²	81	70.9 Å²	70.9	50%	0.497	38%	0.375	S	S	.	.			trans	-87.5	32	-177.7	57.3	0	0	0	0	113.7	K55	T48-K55 HydrophobicContact CG2-CD 3.56Å; T48-K55 HydrophobicContact CG2-CG 4.02Å
49	G	86.3	Confident	91.2	Very high	46 Å²	46	71.9 Å²	71.9	47%	0.474	38%	0.381	S	S	.	.	S	Bend	trans	138	-174.8	177.9	0	0	0	0	0	113.9	K47 H51	K47-G49 PolarHBondContact O-N 3.25Å; G49-H51 PolarHBondContact O-N 2.86Å
50	K	84.1	Confident	91.2	Very high	195 Å²	195	68 Å²	68	85%	0.848	36%	0.364	S	S	*	.	S	Bend	trans	-63.9	-38.3	-176.7	-171.5	-178.3	-179.6	-174.6	0	113.7
51	H	88.4	Confident	91.3	Very high	165 Å²	165	70.5 Å²	70.5	76%	0.764	38%	0.377	S	S	*	.	S	Bend	trans	-118.2	9.8	-179.2	-60	-73.9	0	0	0	112.7	G49	G49-H51 PolarHBondContact O-N 2.86Å
52	G	83.4	Confident	91.3	Very high	32 Å²	32	68.6 Å²	68.6	33%	0.33	37%	0.365	S	S	.	.	P	Polyproline II helix	trans	-75.3	144.7	-178.4	0	0	0	0	0	111.9
53	H	87.8	Confident	91.2	Very high	141 Å²	141	66.6 Å²	66.6	65%	0.653	36%	0.357	S	S	*	.	P	Polyproline II helix	trans	-61.2	145.1	167.1	-63.8	-77.4	0	0	0	110.1
54	A	91.3	Very high	91.2	Very high	21 Å²	21	72 Å²	72	17%	0.174	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.2	137.6	172.5	0	0	0	0	0	109.4	T45 S46 S75	T45-A54 HydrophobicContact CG2-CB 3.8Å; S46-A54 CarbonylContact O-C 3.52Å; S46-A54 VanDerWaalsContact O-CA 3.31Å; S46-A54 WeakPolarHBondContact O-CA 3.43Å; A54-S75 WeakPolarHBondContact O-CB 3.35Å; A54-S75 PolarHBondContact O-N 2.84Å; A54-S75 PolarHBondContact O-OG 2.92Å
55	K	92.4	Very high	91.2	Very high	90 Å²	90	72.9 Å²	72.9	39%	0.391	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	138.5	171.1	-61.4	-172.6	-177.3	-178.5	0	108.1	T45 S46 T48 I72	T45-K55 CarbonylContact C-O 3.49Å; T45-K55 WeakPolarHBondContact CA-O 3.44Å; S46-K55 PolarHBondContact N-O 2.61Å; S46-K55 PolarHBondContact O-N 3Å; T48-K55 HydrophobicContact CG2-CD 3.56Å; T48-K55 HydrophobicContact CG2-CG 4.02Å; K55-I72 HydrophobicContact CB-CG2 4.15Å; K55-I72 HydrophobicContact CD-CG2 4.35Å
56	V	94.1	Very high	91.3	Very high	1 Å²	1	71 Å²	71	1%	0.006	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.4	123.8	175.3	-174.5	0	0	0	0	107.3	C22 M43 S44 T45 L58 I72 C73	C22-V56 WeakPolarHBondContact SG-CB 3.2Å; M43-V56 HydrophobicContact CE-CG1 3.52Å; M43-V56 HydrophobicContact CE-CG2 4.38Å; M43-V56 HydrophobicContact CG-CG1 3.71Å; M43-V56 HydrophobicContact SD-CG1 4.44Å; S44-V56 CarbonylContact O-C 3.54Å; S44-V56 WeakPolarHBondContact O-CA 3.49Å; T45-V56 HydrophobicContact CG2-CG2 4.46Å; V56-L58 HydrophobicContact CG1-CD2 3.96Å; V56-L58 HydrophobicContact CG1-CG 3.95Å; V56-I72 WeakPolarHBondContact O-CA 3.28Å; V56-C73 PolarHBondContact N-O 3.15Å; V56-C73 PolarHBondContact O-N 3.5Å
57	H	94.6	Very high	91.5	Very high	52 Å²	52	74 Å²	74	24%	0.241	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	119.5	167.9	175.7	-107.6	0	0	0	108	M43 S44 V59 I72	M43-H57 WeakPolarHBondContact CA-O 3.17Å; S44-H57 PolarHBondContact N-O 3.31Å; S44-H57 PolarHBondContact O-N 2.87Å; S44-H57 PolarHBondContact OG-ND1 3.27Å; H57-V59 WeakPolarHBondContact CE1-CG2 3.28Å; H57-I72 HydrophobicContact CB-CG1 4.31Å
58	L	94.5	Very high	91.8	Very high	0 Å²	0	73.4 Å²	73.4	0%	0	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	128.7	-178.7	-69	165.8	0	0	0	108.5	L25 I40 M43 V56 E70 D71 C73 M79	L25-L58 HydrophobicContact CD1-CD1 3.89Å; L25-L58 HydrophobicContact CD1-CD2 4.37Å; I40-L58 HydrophobicContact CD1-CD2 4.36Å; I40-L58 HydrophobicContact CG2-CD2 4.31Å; M43-L58 HydrophobicContact CB-CD2 4.24Å; M43-L58 HydrophobicContact CG-CD2 3.86Å; M43-L58 HydrophobicContact SD-CD2 4.43Å; V56-L58 HydrophobicContact CG1-CD2 3.96Å; V56-L58 HydrophobicContact CG1-CG 3.95Å; L58-E70 VanDerWaalsContact O-CA 3.3Å; L58-E70 WeakPolarHBondContact O-CA 3.49Å; L58-D71 PolarHBondContact N-O 2.83Å; L58-D71 PolarHBondContact O-N 3.47Å; L58-C73 VanDerWaalsContact CD1-SG 3.54Å; L58-M79 HydrophobicContact CD1-CE 4.26Å
59	V	95.6	Very high	92.4	Very high	21 Å²	21	71.8 Å²	71.8	13%	0.127	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	119.7	168.8	-171.5	0	0	0	0	107.7	V41 E42 H57	V41-V59 HydrophobicContact CG2-CB 4.16Å; V41-V59 HydrophobicContact CG2-CG1 3.87Å; V41-V59 VanDerWaalsContact CG2-O 3.22Å; V41-V59 WeakPolarHBondContact CG2-O 3.47Å; V41-V59 PolarHBondContact N-O 2.98Å; E42-V59 HydrophobicContact CB-CB 3.96Å; E42-V59 HydrophobicContact CB-CG2 4.19Å; E42-V59 PolarHBondContact N-O 3.28Å; E42-V59 VanDerWaalsContact N-O 3.16Å; E42-V59 PolarHBondContact O-N 2.76Å; H57-V59 WeakPolarHBondContact CE1-CG2 3.28Å
60	G	96.3	Very high	92.7	Very high	0 Å²	0	75.7 Å²	75.7	0%	0	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	154.3	180	0	0	0	0	0	112.6	K39 K68 Y69	K39-G60 CarbonylContact O-C 3.51Å; K39-G60 WeakPolarHBondContact O-CA 3.5Å; G60-K68 WeakPolarHBondContact O-CA 3.48Å; G60-Y69 PolarHBondContact N-O 2.81Å; G60-Y69 PolarHBondContact O-N 3.42Å; G60-Y69 VanDerWaalsContact O-O 3.08Å
61	I	96.5	Very high	93.2	Very high	52 Å²	52	69.3 Å²	69.3	27%	0.267	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	125.3	169.5	-61	-175	0	0	0	107.9	C38 K39 V41 I63 K68	C38-I61 CarbonylContact C-O 3.52Å; C38-I61 VanDerWaalsContact CA-O 3.28Å; C38-I61 WeakPolarHBondContact CA-O 3.22Å; K39-I61 PolarHBondContact N-O 2.8Å; K39-I61 PolarHBondContact O-N 3.49Å; V41-I61 HydrophobicContact CG1-CB 4.34Å; V41-I61 HydrophobicContact CG1-CD1 3.62Å; V41-I61 HydrophobicContact CG1-CG1 3.67Å; V41-I61 HydrophobicContact CG2-CD1 4.41Å; V41-I61 HydrophobicContact CG2-CG1 4.06Å; I61-I63 PolarHBondContact O-N 3.31Å; I61-K68 HydrophobicContact CD1-CG 4.42Å; I61-K68 HydrophobicContact CG1-CG 4.03Å
62	D	95.5	Very high	93.4	Very high	3 Å²	3	66.5 Å²	66.5	2%	0.016	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-57	124.6	172.1	179.6	-13.5	0	0	0	110	R36 F64 T65 G66 K67 Y69	R36-D62 VanDerWaalsContact CD-OD2 3.28Å; R36-D62 WeakPolarHBondContact CD-OD2 3.48Å; R36-D62 IonicContact CZ-OD2 3.94Å; R36-D62 IonicContact NH1-OD2 3Å; R36-D62 PolarHBondContact NH1-OD2 2.88Å; D62-F64 PolarHBondContact O-N 2.85Å; D62-F64 PolarHBondContact OD1-N 3.09Å; D62-T65 WeakPolarHBondContact CB-OG1 3.21Å; D62-T65 PolarHBondContact OD1-N 2.91Å; D62-T65 WeakPolarHBondContact OD2-CB 3.3Å; D62-T65 WeakPolarHBondContact OD2-CG2 3.32Å; D62-T65 PolarHBondContact OD2-OG1 3.16Å; D62-G66 VanDerWaalsContact O-CA 3.28Å; D62-G66 WeakPolarHBondContact O-CA 3.41Å; D62-G66 PolarHBondContact O-N 3.24Å; D62-K67 PolarHBondContact N-O 2.85Å; D62-Y69 HydrophobicContact CB-CD2 4.07Å; D62-Y69 HydrophobicContact CB-CE2 3.84Å
63	I	93.3	Very high	93.8	Very high	69 Å²	69	65.2 Å²	65.2	35%	0.354	33%	0.325	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.8	-20.4	-175.9	65.5	179.8	0	0	0	113.1	F30 P37 K39 I61 I84	F30-I63 HydrophobicContact CD1-CG2 4.25Å; F30-I63 HydrophobicContact CE1-CG2 4.05Å; P37-I63 HydrophobicContact CB-CD1 4.01Å; P37-I63 HydrophobicContact CB-CG1 4.39Å; P37-I63 HydrophobicContact CG-CD1 4.02Å; P37-I63 HydrophobicContact CG-CG1 4.15Å; P37-I63 PolarHBondContact O-N 2.83Å; K39-I63 HydrophobicContact CB-CG2 4.11Å; I61-I63 PolarHBondContact O-N 3.31Å; I63-I84 HydrophobicContact CD1-CD1 3.86Å
64	F	92.2	Very high	94	Very high	166 Å²	166	60.9 Å²	60.9	73%	0.728	31%	0.31	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.3	-44.9	-179.2	-62.3	-66.2	0	0	0	112.1	P37 D62	P37-F64 HydrophobicContact CG-CD2 3.91Å; P37-F64 HydrophobicContact CG-CE2 3.52Å; D62-F64 PolarHBondContact O-N 2.85Å; D62-F64 PolarHBondContact OD1-N 3.09Å
65	T	93.8	Very high	94	Very high	67 Å²	67	60.9 Å²	60.9	41%	0.411	31%	0.308	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98.4	-10.7	-174.9	71.7	0	0	0	0	114.5	R36 D62 K67	R36-T65 VanDerWaalsContact NH1-CG2 3.28Å; R36-T65 PolarHBondContact NH1-OG1 2.86Å; D62-T65 WeakPolarHBondContact CB-OG1 3.21Å; D62-T65 PolarHBondContact OD1-N 2.91Å; D62-T65 WeakPolarHBondContact OD2-CB 3.3Å; D62-T65 WeakPolarHBondContact OD2-CG2 3.32Å; D62-T65 PolarHBondContact OD2-OG1 3.16Å; T65-K67 PolarHBondContact O-N 3.17Å; T65-K67 VanDerWaalsContact O-N 3.09Å
66	G	93.3	Very high	94	Very high	51 Å²	51	60.3 Å²	60.3	53%	0.526	31%	0.313	S	S	.	.			trans	67.6	3.7	-176.7	0	0	0	0	0	114.2	D62	D62-G66 VanDerWaalsContact O-CA 3.28Å; D62-G66 WeakPolarHBondContact O-CA 3.41Å; D62-G66 PolarHBondContact O-N 3.24Å
67	K	95.3	Very high	93.9	Very high	128 Å²	128	65.6 Å²	65.6	56%	0.557	34%	0.337	S	S	*	.			trans	-74.4	140.7	178.9	-68.2	-177.1	179.1	-176.8	0	110.7	D62 T65 Y69	D62-K67 PolarHBondContact N-O 2.85Å; T65-K67 PolarHBondContact O-N 3.17Å; T65-K67 VanDerWaalsContact O-N 3.09Å; K67-Y69 HydrophobicContact CB-CE2 3.8Å; K67-Y69 WeakPolarHBondContact O-CD2 3.35Å
68	K	95.4	Very high	93.8	Very high	161 Å²	161	68.4 Å²	68.4	70%	0.7	35%	0.354	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.6	136.6	174.8	-69	-176.1	178.7	-174.7	0	110.3	G60 I61	G60-K68 WeakPolarHBondContact O-CA 3.48Å; I61-K68 HydrophobicContact CD1-CG 4.42Å; I61-K68 HydrophobicContact CG1-CG 4.03Å
69	Y	95.6	Very high	93.7	Very high	47 Å²	47	69.6 Å²	69.6	18%	0.184	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	141.3	174.3	-69.3	-79.6	0	0	0	109.5	K34 G60 D62 K67	K34-Y69 HydrophobicContact CD-CD1 4.13Å; G60-Y69 PolarHBondContact N-O 2.81Å; G60-Y69 PolarHBondContact O-N 3.42Å; G60-Y69 VanDerWaalsContact O-O 3.08Å; D62-Y69 HydrophobicContact CB-CD2 4.07Å; D62-Y69 HydrophobicContact CB-CE2 3.84Å; K67-Y69 HydrophobicContact CB-CE2 3.8Å; K67-Y69 WeakPolarHBondContact O-CD2 3.35Å
70	E	94.2	Very high	93.6	Very high	127 Å²	127	72.4 Å²	72.4	59%	0.593	37%	0.374	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.1	147	178.8	61.2	-169.9	-152.7	0	0	110	L58	L58-E70 VanDerWaalsContact O-CA 3.3Å; L58-E70 WeakPolarHBondContact O-CA 3.49Å
71	D	93.3	Very high	93.5	Very high	62 Å²	62	72.7 Å²	72.7	33%	0.332	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.8	155.7	176.9	-160.7	12.1	0	0	0	111.8	L33 L58	L33-D71 HydrophobicContact CD2-CB 3.92Å; L58-D71 PolarHBondContact N-O 2.83Å; L58-D71 PolarHBondContact O-N 3.47Å
72	I	92.9	Very high	93.3	Very high	105 Å²	105	70.9 Å²	70.9	54%	0.538	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	109.6	178	-60.1	173.3	0	0	0	109	K55 V56 H57	K55-I72 HydrophobicContact CB-CG2 4.15Å; K55-I72 HydrophobicContact CD-CG2 4.35Å; V56-I72 WeakPolarHBondContact O-CA 3.28Å; H57-I72 HydrophobicContact CB-CG1 4.31Å
73	C	91.3	Very high	93	Very high	5 Å²	5	75.4 Å²	75.4	3%	0.034	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	147.2	174	43.7	0	0	0	0	112.4	C22 V56 L58 M79	C22-C73 HydrophobicContact CB-CB 4.15Å; C22-C73 WeakPolarHBondContact CB-SG 3.41Å; C22-C73 WeakPolarHBondContact SG-CB 3.24Å; C22-C73 CovalentContact SG-SG 2.08Å; C22-C73 PolarHBondContact SG-SG 2.66Å; V56-C73 PolarHBondContact N-O 3.15Å; V56-C73 PolarHBondContact O-N 3.5Å; L58-C73 VanDerWaalsContact CD1-SG 3.54Å; C73-M79 HydrophobicContact CB-CE 4.09Å; C73-M79 HydrophobicContact CB-SD 4.05Å
74	P	93.5	Very high	92.8	Very high	50 Å²	50	75.2 Å²	75.2	33%	0.325	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.2	141.9	160.1	-19.3	31.1	0	0	0	110.1	T76 H77	P74-T76 PolarHBondContact O-N 3.49Å; P74-T76 VanDerWaalsContact O-N 3.08Å; P74-H77 HydrophobicContact CB-CB 4.42Å; P74-H77 PolarHBondContact O-N 3.04Å; P74-H77 VanDerWaalsContact O-N 3.09Å
75	S	91.5	Very high	92.5	Very high	21 Å²	21	75.2 Å²	75.2	15%	0.147	39%	0.39	C	S	.	.	T	Hydrogen-bonded Turn	trans	-60.7	-24.7	-177.2	63.6	0	0	0	0	113.7	Q21 S23 A54	Q21-S75 WeakPolarHBondContact CG-O 3.36Å; S23-S75 WeakPolarHBondContact CB-O 3.49Å; S23-S75 PolarHBondContact N-O 2.8Å; A54-S75 WeakPolarHBondContact O-CB 3.35Å; A54-S75 PolarHBondContact O-N 2.84Å; A54-S75 PolarHBondContact O-OG 2.92Å
76	T	91.8	Very high	92.1	Very high	79 Å²	79	83.1 Å²	83.1	49%	0.485	41%	0.413	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90	-11.6	-179.1	53.6	0	0	0	0	114.1	Q21 P74	Q21-T76 PolarHBondContact NE2-O 2.95Å; P74-T76 PolarHBondContact O-N 3.49Å; P74-T76 VanDerWaalsContact O-N 3.08Å
77	H	92.6	Very high	91.8	Very high	112 Å²	112	85.6 Å²	85.6	52%	0.519	41%	0.414	S	S	.	.	S	Bend	trans	-68.5	142.9	178.3	-105.5	-158.2	0	0	0	111.2	C22 P74	C22-H77 VanDerWaalsContact CB-O 3.3Å; C22-H77 WeakPolarHBondContact CB-O 3.43Å; C22-H77 PolarHBondContact N-O 2.08Å; P74-H77 HydrophobicContact CB-CB 4.42Å; P74-H77 PolarHBondContact O-N 3.04Å; P74-H77 VanDerWaalsContact O-N 3.09Å
78	N	92	Very high	91.3	Very high	111 Å²	111	85 Å²	85	59%	0.594	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.8	137.6	169	-68.1	-32.9	0	0	0	109.4	P19 M20	P19-N78 HydrophobicContact CB-CB 4.39Å; M20-N78 WeakPolarHBondContact O-CA 3.45Å
79	M	92.3	Very high	90.7	Very high	25 Å²	25	83.3 Å²	83.3	12%	0.123	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	147.9	174.6	-63.5	-68.6	-97.2	0	0	108.5	M20 C22 L25 V31 L33 L58 C73	M20-M79 PolarHBondContact N-O 2.81Å; M20-M79 PolarHBondContact O-N 2.8Å; C22-M79 HydrophobicContact CB-CG 3.96Å; L25-M79 HydrophobicContact CD1-CB 4.44Å; V31-M79 HydrophobicContact CG2-CB 3.93Å; L33-M79 HydrophobicContact CD2-CE 4.35Å; L58-M79 HydrophobicContact CD1-CE 4.26Å; C73-M79 HydrophobicContact CB-CE 4.09Å; C73-M79 HydrophobicContact CB-SD 4.05Å
80	D	93.2	Very high	90	Very high	79 Å²	79	85.2 Å²	85.2	42%	0.422	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.7	129.5	174.2	-76.3	-72.2	0	0	0	111	T17 V31 V32	T17-D80 HydrophobicContact CG2-CB 4.19Å; T17-D80 PolarHBondContact OG1-OD1 2.81Å; V31-D80 WeakPolarHBondContact CG2-O 3.44Å; V32-D80 HydrophobicContact CB-CB 3.95Å; V32-D80 HydrophobicContact CG2-CB 3.95Å; V32-D80 PolarHBondContact N-O 2.95Å
81	V	93.3	Very high	89.3	Confident	6 Å²	6	83.2 Å²	83.2	4%	0.036	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	125.1	173	178.9	0	0	0	0	108.7	T17 Y18 M20 L25 F30	T17-V81 CarbonylContact C-O 3.57Å; T17-V81 WeakPolarHBondContact CA-O 3.38Å; T17-V81 WeakPolarHBondContact CB-O 3.44Å; Y18-V81 HydrophobicContact CD1-CB 4.37Å; Y18-V81 WeakPolarHBondContact CD1-O 3.49Å; Y18-V81 HydrophobicContact CD2-CB 4.17Å; Y18-V81 HydrophobicContact CE1-CB 3.96Å; Y18-V81 HydrophobicContact CE1-CG1 3.69Å; Y18-V81 HydrophobicContact CE2-CB 3.72Å; Y18-V81 HydrophobicContact CE2-CG1 3.93Å; Y18-V81 HydrophobicContact CE2-CG2 4.29Å; Y18-V81 HydrophobicContact CG-CB 4.48Å; Y18-V81 PolarHBondContact N-O 2.91Å; Y18-V81 PolarHBondContact O-N 3.11Å; Y18-V81 WeakPolarHBondContact OH-CG1 3.32Å; M20-V81 HydrophobicContact CB-CG2 3.63Å; M20-V81 HydrophobicContact CG-CG2 4.46Å; M20-V81 HydrophobicContact SD-CG2 4.28Å; L25-V81 HydrophobicContact CD2-CG2 3.77Å; F30-V81 WeakPolarHBondContact O-CG1 3.44Å
82	P	93.5	Very high	88.6	Confident	15 Å²	15	82.5 Å²	82.5	10%	0.097	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.7	143.8	179.1	31.3	-34.3	0	0	0	111.1	F30 V32 P37 I84	F30-P82 HydrophobicContact CB-CG 3.86Å; V32-P82 HydrophobicContact CG2-CB 4.26Å; V32-P82 HydrophobicContact CG2-CG 4.31Å; P37-P82 HydrophobicContact CB-CB 4.07Å; P37-P82 HydrophobicContact CB-CG 3.87Å; P82-I84 HydrophobicContact CB-CG1 4.27Å; P82-I84 HydrophobicContact CG-CD1 4.09Å; P82-I84 HydrophobicContact CG-CG1 4.18Å; P82-I84 PolarHBondContact O-N 3.08Å
83	N	89.9	Confident	87.9	Confident	98 Å²	98	81 Å²	81	52%	0.524	41%	0.41	S	S	.	.			trans	-81.5	105.9	171.1	-165.8	-19.2	0	0	0	109.9	S16	S16-N83 PolarHBondContact O-N 3.09Å; S16-N83 VanDerWaalsContact O-N 3.12Å
84	I	88.1	Confident	86.7	Confident	64 Å²	64	87 Å²	87	33%	0.328	44%	0.439	S	S	.	.			trans	-107.4	119.6	-177.4	-60.4	-177.6	0	0	0	109.9	F30 I63 P82	F30-I84 HydrophobicContact CB-CD1 3.93Å; F30-I84 HydrophobicContact CD1-CD1 3.28Å; F30-I84 HydrophobicContact CD2-CD1 3.78Å; F30-I84 HydrophobicContact CE1-CD1 3.57Å; F30-I84 HydrophobicContact CE2-CD1 4.05Å; F30-I84 HydrophobicContact CG-CD1 3.38Å; F30-I84 HydrophobicContact CG-CG1 4.44Å; F30-I84 HydrophobicContact CZ-CD1 3.94Å; I63-I84 HydrophobicContact CD1-CD1 3.86Å; P82-I84 HydrophobicContact CB-CG1 4.27Å; P82-I84 HydrophobicContact CG-CD1 4.09Å; P82-I84 HydrophobicContact CG-CG1 4.18Å; P82-I84 PolarHBondContact O-N 3.08Å
85	K	86.3	Confident	85.3	Confident	166 Å²	166	89.7 Å²	89.7	72%	0.722	46%	0.457	S	S	*	.			trans	-111.8	129.9	171.6	-63.7	179.5	-177	175.9	0	109.2
86	R	85.6	Confident	83.7	Confident	233 Å²	233	91.9 Å²	91.9	88%	0.879	48%	0.477	S	S	*	.			trans	-98.5	121.6	169.2	-112.9	-178.5	-179.9	173.3	-3	107.9
87	N	86.1	Confident	82.5	Confident	103 Å²	103	96.9 Å²	96.9	55%	0.551	50%	0.497	S	S	*	.			trans	-114.3	123.7	172.4	-64.4	-23	0	0	0	107.1	Y89	N87-Y89 HydrophobicContact CB-CD2 4.28Å; N87-Y89 HydrophobicContact CB-CE2 3.45Å; N87-Y89 VanDerWaalsContact CB-CE2 3.45Å; N87-Y89 VanDerWaalsContact O-CD2 3.32Å; N87-Y89 WeakPolarHBondContact O-CD2 3.35Å; N87-Y89 WeakPolarHBondContact O-CE2 3.3Å
88	D	84.6	Confident	81.3	Confident	115 Å²	115	97.5 Å²	97.5	62%	0.615	51%	0.514	S	S	*	.			trans	-84.2	136	175.5	-66.6	-79.4	0	0	0	109.3	P107 C108	D88-P107 CarbonylContact O-C 3.52Å; D88-P107 WeakPolarHBondContact O-CA 3.31Å; D88-C108 HydrophobicContact CB-CB 3.97Å; D88-C108 PolarHBondContact O-N 2.79Å
89	Y	82.9	Confident	80	Confident	127 Å²	127	97.5 Å²	97.5	50%	0.498	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	137.6	179.3	-66.1	-88.4	0	0	0	110.1	N87 I105 K106 P107	N87-Y89 HydrophobicContact CB-CD2 4.28Å; N87-Y89 HydrophobicContact CB-CE2 3.45Å; N87-Y89 VanDerWaalsContact CB-CE2 3.45Å; N87-Y89 VanDerWaalsContact O-CD2 3.32Å; N87-Y89 WeakPolarHBondContact O-CD2 3.35Å; N87-Y89 WeakPolarHBondContact O-CE2 3.3Å; Y89-I105 HydrophobicContact CD1-CG2 3.68Å; Y89-I105 HydrophobicContact CG-CG2 4.04Å; Y89-K106 CarbonylContact C-O 3.6Å; Y89-K106 WeakPolarHBondContact CA-O 3.37Å; Y89-P107 HydrophobicContact CD1-CB 4.17Å; Y89-P107 HydrophobicContact CE1-CB 4.05Å
90	Q	81.5	Confident	78.7	Confident	86 Å²	86	104.1 Å²	104.1	40%	0.402	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.9	120.5	168.8	-174.6	174.7	-1.4	0	0	108.9	K106	Q90-K106 HydrophobicContact CB-CG 3.93Å; Q90-K106 PolarHBondContact N-O 3.5Å; Q90-K106 PolarHBondContact O-N 2.78Å; Q90-K106 VanDerWaalsContact O-N 3.07Å
91	V	79.1	Confident	77.2	Confident	85 Å²	85	107.1 Å²	107.1	52%	0.515	55%	0.547	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	121.3	172.9	-175.5	0	0	0	0	108.4	V93 A102	V91-V93 HydrophobicContact CG1-CG2 4.1Å; V91-A102 HydrophobicContact CG1-CB 4.44Å
92	S	79.6	Confident	75.8	Confident	48 Å²	48	110.4 Å²	110.4	34%	0.336	57%	0.574	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.4	113.2	170.9	-69.1	0	0	0	0	109.2	V103 A104	S92-V103 PolarHBondContact O-N 2.87Å; S92-V103 VanDerWaalsContact O-N 3.14Å; S92-A104 PolarHBondContact N-O 2.78Å
93	V	77.4	Confident	74.5	Confident	74 Å²	74	113.9 Å²	113.9	45%	0.448	60%	0.596	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.1	126.5	174.9	-169.7	0	0	0	0	107.5	V91 E100	V91-V93 HydrophobicContact CG1-CG2 4.1Å; V93-E100 HydrophobicContact CG1-CB 4.01Å; V93-E100 HydrophobicContact CG1-CG 4.27Å
94	M	65.5	Low	73.2	Confident	131 Å²	131	111.6 Å²	111.6	65%	0.645	59%	0.59	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-98.3	126.5	165.3	-70.5	-177.2	133.6	0	0	107.8	V103	M94-V103 HydrophobicContact CB-CG2 3.76Å; M94-V103 HydrophobicContact CG-CB 4.39Å; M94-V103 HydrophobicContact CG-CG2 3.9Å; M94-V103 HydrophobicContact SD-CG1 4.19Å; M94-V103 HydrophobicContact SD-CG2 4.2Å
95	C	63.7	Low	72.7	Confident	106 Å²	106	114 Å²	114	72%	0.716	60%	0.603	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-89.9	111.8	173.5	-166.8	0	0	0	0	108.1
96	A	59.5	Low	72.3	Confident	67 Å²	67	111.1 Å²	111.1	55%	0.554	59%	0.59	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-126.4	122.2	171.1	0	0	0	0	0	107.9	S98 E99	A96-S98 PolarHBondContact O-N 3.3Å; A96-E99 PolarHBondContact O-N 2.87Å
97	M	65.5	Low	71.8	Confident	184 Å²	184	104.3 Å²	104.3	91%	0.906	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	45.7	56.3	171.4	-67.8	176.3	167	0	0	114.4	E99	M97-E99 PolarHBondContact O-N 2.79Å; M97-E99 VanDerWaalsContact O-N 3.14Å
98	S	67.3	Low	70.8	Confident	125 Å²	125	102.6 Å²	102.6	87%	0.874	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	68.9	5.6	169.5	-43.5	0	0	0	0	117.2	A96	A96-S98 PolarHBondContact O-N 3.3Å
99	E	65.4	Low	69.6	Low	110 Å²	110	110.3 Å²	110.3	51%	0.514	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116.4	132.1	171.1	-71.5	177	79.9	0	0	111	A96 M97 Y101	A96-E99 PolarHBondContact O-N 2.87Å; M97-E99 PolarHBondContact O-N 2.79Å; M97-E99 VanDerWaalsContact O-N 3.14Å; E99-Y101 HydrophobicContact CB-CD2 4.01Å; E99-Y101 HydrophobicContact CB-CE2 3.42Å; E99-Y101 VanDerWaalsContact CB-CE2 3.42Å; E99-Y101 HydrophobicContact CG-CE2 4.3Å; E99-Y101 PolarHBondContact OE1-OH 2.99Å
100	E	65.6	Low	68.9	Low	164 Å²	164	109.5 Å²	109.5	77%	0.766	60%	0.604	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-93.3	111.7	177	-69.1	-177.7	87.7	0	0	109.9	V93	V93-E100 HydrophobicContact CG1-CB 4.01Å; V93-E100 HydrophobicContact CG1-CG 4.27Å
101	Y	61.4	Low	68.2	Low	143 Å²	143	110.7 Å²	110.7	56%	0.561	62%	0.615	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-111.4	133.6	172.4	-69.2	-86.5	0	0	0	110.3	E99 V103	E99-Y101 HydrophobicContact CB-CD2 4.01Å; E99-Y101 HydrophobicContact CB-CE2 3.42Å; E99-Y101 VanDerWaalsContact CB-CE2 3.42Å; E99-Y101 HydrophobicContact CG-CE2 4.3Å; E99-Y101 PolarHBondContact OE1-OH 2.99Å; Y101-V103 WeakPolarHBondContact O-CG2 3.34Å; Y101-V103 PolarHBondContact O-N 2.99Å
102	A	64	Low	67.6	Low	74 Å²	74	112.2 Å²	112.2	61%	0.612	62%	0.621	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-72.7	112	170.8	0	0	0	0	0	109	V91	V91-A102 HydrophobicContact CG1-CB 4.44Å
103	V	65.7	Low	66.9	Low	89 Å²	89	115.9 Å²	115.9	54%	0.539	64%	0.637	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.6	-29.8	-172.8	-173.4	0	0	0	0	112.1	S92 M94 Y101	S92-V103 PolarHBondContact O-N 2.87Å; S92-V103 VanDerWaalsContact O-N 3.14Å; M94-V103 HydrophobicContact CB-CG2 3.76Å; M94-V103 HydrophobicContact CG-CB 4.39Å; M94-V103 HydrophobicContact CG-CG2 3.9Å; M94-V103 HydrophobicContact SD-CG1 4.19Å; M94-V103 HydrophobicContact SD-CG2 4.2Å; Y101-V103 WeakPolarHBondContact O-CG2 3.34Å; Y101-V103 PolarHBondContact O-N 2.99Å
104	A	63	Low	66.3	Low	49 Å²	49	118.6 Å²	118.6	41%	0.405	65%	0.649	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-151.3	135	176.2	0	0	0	0	0	111.8	S92	S92-A104 PolarHBondContact N-O 2.78Å
105	I	77.8	Confident	66.3	Low	116 Å²	116	117.7 Å²	117.7	60%	0.595	65%	0.649	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-113.7	112.4	168.3	-59.3	171.1	0	0	0	106	Y89	Y89-I105 HydrophobicContact CD1-CG2 3.68Å; Y89-I105 HydrophobicContact CG-CG2 4.04Å
106	K	76.7	Confident	66.5	Low	104 Å²	104	118.6 Å²	118.6	45%	0.452	65%	0.645	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.9	139	174.9	65.7	-179.3	-177.6	174.3	0	110	Y89 Q90 C108	Y89-K106 CarbonylContact C-O 3.6Å; Y89-K106 WeakPolarHBondContact CA-O 3.37Å; Q90-K106 HydrophobicContact CB-CG 3.93Å; Q90-K106 PolarHBondContact N-O 3.5Å; Q90-K106 PolarHBondContact O-N 2.78Å; Q90-K106 VanDerWaalsContact O-N 3.07Å; K106-C108 PolarHBondContact O-N 3.48Å
107	P	74.8	Confident	67.1	Low	90 Å²	90	122.5 Å²	122.5	58%	0.584	65%	0.652	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-64.3	129.8	172.1	26	-31.4	0	0	0	109.4	D88 Y89 K109	D88-P107 CarbonylContact O-C 3.52Å; D88-P107 WeakPolarHBondContact O-CA 3.31Å; Y89-P107 HydrophobicContact CD1-CB 4.17Å; Y89-P107 HydrophobicContact CE1-CB 4.05Å; P107-K109 PolarHBondContact O-N 3.18Å
108	C	65.9	Low	67.2	Low	67 Å²	67	117.4 Å²	117.4	45%	0.453	63%	0.63	S	S	.	*			trans	-72.3	121.8	164.4	-98.7	0	0	0	0	107.3	D88 K106	D88-C108 HydrophobicContact CB-CB 3.97Å; D88-C108 PolarHBondContact O-N 2.79Å; K106-C108 PolarHBondContact O-N 3.48Å
109	K	58.9	Low	67.2	Low	278 Å²	278	116.7 Å²	116.7	100%	1.209	61%	0.608	S	S	*	*			trans	-82.6	0	165.3	-77.7	-172.2	178.4	179.2	0	109.8	P107	P107-K109 PolarHBondContact O-N 3.18Å

Retrieved 109 of 109 residues in 144.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).