A0A096MZU8_PAPAN Loading...

Mitotic spindle organizing protein 1

AlphaFold DB (A0A2K5VQF6), UniProt , Accession A0A096MZU8, Species PAPAN (Papio anubis, Olive baboon), Gene MZT1, Length 82 aa.

						>A0A096MZU8_PAPAN|A0A096MZU8|MZT1
MASSSGAGGAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.4	Low	63.7	Low	251 Å²	251	101.4 Å²	101.4	100%	1.236	75%	0.752	S	S	*	*				0	96.8	0	-64.8	-170.8	-158.9	0	0	108.5
2	A	53	Low	65.5	Low	97 Å²	97	98.3 Å²	98.3	80%	0.802	73%	0.734	S	S	*	*			trans	-162	86.5	168.7	0	0	0	0	0	108.6
3	S	62.3	Low	67.1	Low	125 Å²	125	95.5 Å²	95.5	87%	0.874	72%	0.716	S	S	*	*			trans	-150.1	94.5	172.1	-57.9	0	0	0	0	108.2
4	S	60.8	Low	68.7	Low	120 Å²	120	92.6 Å²	92.6	84%	0.839	70%	0.698	S	S	*	*			trans	-162.5	21.1	168.7	66	0	0	0	0	115.7
5	S	62.8	Low	70.2	Confident	122 Å²	122	89.6 Å²	89.6	85%	0.853	68%	0.678	S	S	*	*			trans	-91.5	3.5	-178.2	55.3	0	0	0	0	115.8
6	G	59.1	Low	71.6	Confident	67 Å²	67	87.8 Å²	87.8	69%	0.691	67%	0.667	S	S	*	*	S	Bend	trans	-77.8	-18.4	-174.5	0	0	0	0	0	116.6
7	A	59.3	Low	72.9	Confident	86 Å²	86	88.8 Å²	88.8	71%	0.711	66%	0.66	S	S	*	*	H	α-helix	trans	-80.8	-26.9	-170.6	0	0	0	0	0	114.4
8	G	62.3	Low	74	Confident	57 Å²	57	90.6 Å²	90.6	59%	0.588	66%	0.659	S	S	*	*	H	α-helix	trans	-74	-29.9	-177	0	0	0	0	0	114.5
9	G	70.1	Confident	75.2	Confident	52 Å²	52	90.9 Å²	90.9	54%	0.536	65%	0.652	S	S	.	*	H	α-helix	trans	-73.9	-37.2	-177.3	0	0	0	0	0	113.9	A12 A13	G9-A12 PolarHBondContact O-N 3.27Å; G9-A13 WeakPolarHBondContact O-CB 3.32Å; G9-A13 PolarHBondContact O-N 2.97Å
10	A	74.7	Confident	76.2	Confident	70 Å²	70	88.6 Å²	88.6	58%	0.579	64%	0.637	S	S	*	*	H	α-helix	trans	-68.6	-40.3	-177.5	0	0	0	0	0	112.6	A13 A14	A10-A13 PolarHBondContact O-N 3.46Å; A10-A14 WeakPolarHBondContact O-CB 3.48Å; A10-A14 PolarHBondContact O-N 3.05Å
11	A	80.5	Confident	77.1	Confident	68 Å²	68	88.1 Å²	88.1	56%	0.562	63%	0.629	S	S	*	*	H	α-helix	trans	-67.1	-40.4	177.6	0	0	0	0	0	112.2	A14 A15	A11-A14 PolarHBondContact O-N 2.96Å; A11-A15 PolarHBondContact O-N 3.31Å
12	A	85.5	Confident	79	Confident	65 Å²	65	84.3 Å²	84.3	54%	0.537	60%	0.601	S	S	.	*	H	α-helix	trans	-64.9	-42.2	176.4	0	0	0	0	0	112	G9 A15 A16	G9-A12 PolarHBondContact O-N 3.27Å; A12-A15 PolarHBondContact O-N 3.38Å; A12-A16 PolarHBondContact O-N 3.07Å
13	A	86.6	Confident	81.1	Confident	61 Å²	61	86 Å²	86	50%	0.504	59%	0.592	S	S	.	*	H	α-helix	trans	-63.7	-41.6	176.3	0	0	0	0	0	112.3	G9 A10 A16 N17	G9-A13 WeakPolarHBondContact O-CB 3.32Å; G9-A13 PolarHBondContact O-N 2.97Å; A10-A13 PolarHBondContact O-N 3.46Å; A13-A16 PolarHBondContact O-N 3.34Å; A13-N17 PolarHBondContact O-N 2.98Å
14	A	89.2	Confident	82.8	Confident	55 Å²	55	83.9 Å²	83.9	46%	0.455	58%	0.575	S	S	.	*	H	α-helix	trans	-62.4	-42.8	176	0	0	0	0	0	112	A10 A11 N17 L18	A10-A14 WeakPolarHBondContact O-CB 3.48Å; A10-A14 PolarHBondContact O-N 3.05Å; A11-A14 PolarHBondContact O-N 2.96Å; A14-N17 PolarHBondContact O-N 3.44Å; A14-L18 WeakPolarHBondContact O-CG 3.46Å; A14-L18 PolarHBondContact O-N 3.34Å
15	A	90.6	Very high	84.5	Confident	48 Å²	48	79.7 Å²	79.7	40%	0.397	54%	0.542	S	S	.	.	H	α-helix	trans	-63.8	-42.2	176.3	0	0	0	0	0	112.4	A11 A12 N17 L18 N19	A11-A15 PolarHBondContact O-N 3.31Å; A12-A15 PolarHBondContact O-N 3.38Å; A15-N17 VanDerWaalsContact C-N 3.32Å; A15-N17 PolarHBondContact O-N 3.06Å; A15-L18 PolarHBondContact O-N 3.35Å; A15-N19 PolarHBondContact O-N 3.14Å; A15-N19 VanDerWaalsContact O-N 3.07Å
16	A	93.2	Very high	86.2	Confident	61 Å²	61	77.3 Å²	77.3	50%	0.504	52%	0.52	S	S	.	.	H	α-helix	trans	-61.2	-42	175.8	0	0	0	0	0	111.6	A12 A13 N19 A20	A12-A16 PolarHBondContact O-N 3.07Å; A13-A16 PolarHBondContact O-N 3.34Å; A16-N19 PolarHBondContact O-N 3.49Å; A16-A20 PolarHBondContact O-N 3.29Å
17	N	94.4	Very high	88	Confident	105 Å²	105	78.1 Å²	78.1	56%	0.561	51%	0.511	S	S	*	.	H	α-helix	trans	-64.7	-42.2	177.9	-170.6	56.5	0	0	0	112.3	A13 A14 A15 N19 A20 V21	A13-N17 PolarHBondContact O-N 2.98Å; A14-N17 PolarHBondContact O-N 3.44Å; A15-N17 VanDerWaalsContact C-N 3.32Å; A15-N17 PolarHBondContact O-N 3.06Å; N17-N19 VanDerWaalsContact C-N 3.31Å; N17-N19 PolarHBondContact O-N 3.12Å; N17-A20 PolarHBondContact O-N 3.01Å; N17-V21 WeakPolarHBondContact O-CG2 3.43Å; N17-V21 PolarHBondContact O-N 2.95Å
18	L	92.9	Very high	89.8	Confident	121 Å²	121	76.9 Å²	76.9	63%	0.634	49%	0.492	S	S	*	.	H	α-helix	trans	-61.8	-39.5	176.1	-71.3	173.3	0	0	0	112.1	A14 A15 V21 R22	A14-L18 WeakPolarHBondContact O-CG 3.46Å; A14-L18 PolarHBondContact O-N 3.34Å; A15-L18 PolarHBondContact O-N 3.35Å; L18-V21 PolarHBondContact O-N 3.29Å; L18-R22 WeakPolarHBondContact O-CB 3.43Å; L18-R22 PolarHBondContact O-N 3.36Å
19	N	95.4	Very high	91.5	Very high	97 Å²	97	74.7 Å²	74.7	52%	0.519	47%	0.467	S	S	.	.	H	α-helix	trans	-63.9	-45.2	175.3	-70.7	-16.9	0	0	0	111.5	A15 A16 N17 V21 R22 E23	A15-N19 PolarHBondContact O-N 3.14Å; A15-N19 VanDerWaalsContact O-N 3.07Å; A16-N19 PolarHBondContact O-N 3.49Å; N17-N19 VanDerWaalsContact C-N 3.31Å; N17-N19 PolarHBondContact O-N 3.12Å; N19-V21 PolarHBondContact O-N 3.4Å; N19-R22 WeakPolarHBondContact O-CB 3.5Å; N19-R22 PolarHBondContact O-N 2.99Å; N19-E23 WeakPolarHBondContact O-CG 3.46Å; N19-E23 PolarHBondContact O-N 3.15Å
20	A	95.7	Very high	92.8	Very high	44 Å²	44	78.1 Å²	78.1	36%	0.364	47%	0.469	S	S	.	.	H	α-helix	trans	-61.9	-40.7	177.9	0	0	0	0	0	112.7	A16 N17 R22 E23 T24	A16-A20 PolarHBondContact O-N 3.29Å; N17-A20 PolarHBondContact O-N 3.01Å; A20-R22 VanDerWaalsContact C-N 3.35Å; A20-E23 PolarHBondContact O-N 3.45Å; A20-T24 WeakPolarHBondContact O-CB 3.35Å; A20-T24 PolarHBondContact O-N 3.44Å; A20-T24 PolarHBondContact O-OG1 3.48Å
21	V	95.3	Very high	93.9	Very high	78 Å²	78	78.6 Å²	78.6	47%	0.473	46%	0.461	S	S	.	.	H	α-helix	trans	-62	-44.4	174.7	170.7	0	0	0	0	110.7	N17 L18 N19 T24 M25	N17-V21 WeakPolarHBondContact O-CG2 3.43Å; N17-V21 PolarHBondContact O-N 2.95Å; L18-V21 PolarHBondContact O-N 3.29Å; N19-V21 PolarHBondContact O-N 3.4Å; V21-T24 PolarHBondContact O-N 3.04Å; V21-M25 WeakPolarHBondContact O-CG 3.38Å; V21-M25 PolarHBondContact O-N 3.23Å
22	R	95.4	Very high	94.7	Very high	172 Å²	172	75.7 Å²	75.7	65%	0.649	44%	0.437	S	S	*	.	H	α-helix	trans	-61.8	-49.1	178.3	-178	179.3	175.8	174.2	1.2	111.7	L18 N19 A20 T24 M25 D26	L18-R22 WeakPolarHBondContact O-CB 3.43Å; L18-R22 PolarHBondContact O-N 3.36Å; N19-R22 WeakPolarHBondContact O-CB 3.5Å; N19-R22 PolarHBondContact O-N 2.99Å; A20-R22 VanDerWaalsContact C-N 3.35Å; R22-T24 VanDerWaalsContact C-N 3.29Å; R22-T24 PolarHBondContact O-N 3.45Å; R22-M25 PolarHBondContact O-N 3.3Å; R22-D26 IonicContact NE-OD2 2.96Å; R22-D26 VanDerWaalsContact O-CG 3.32Å; R22-D26 PolarHBondContact O-N 3.46Å
23	E	97	Very high	95.2	Very high	131 Å²	131	80.9 Å²	80.9	61%	0.612	44%	0.442	S	S	*	.	H	α-helix	trans	-59.2	-42.2	177.7	-73.8	174.5	-175.6	0	0	111.5	N19 A20 M25 D26 V27	N19-E23 WeakPolarHBondContact O-CG 3.46Å; N19-E23 PolarHBondContact O-N 3.15Å; A20-E23 PolarHBondContact O-N 3.45Å; E23-M25 PolarHBondContact O-N 2.95Å; E23-D26 PolarHBondContact O-N 3.35Å; E23-V27 WeakPolarHBondContact O-CG2 3.47Å; E23-V27 PolarHBondContact O-N 2.9Å
24	T	96.9	Very high	95.8	Very high	82 Å²	82	84.2 Å²	84.2	50%	0.503	45%	0.45	S	S	.	.	H	α-helix	trans	-61.4	-45	176.7	-57.1	0	0	0	0	111.3	A20 V21 R22 V27 L28	A20-T24 WeakPolarHBondContact O-CB 3.35Å; A20-T24 PolarHBondContact O-N 3.44Å; A20-T24 PolarHBondContact O-OG1 3.48Å; V21-T24 PolarHBondContact O-N 3.04Å; R22-T24 VanDerWaalsContact C-N 3.29Å; R22-T24 PolarHBondContact O-N 3.45Å; T24-V27 PolarHBondContact O-N 3.05Å; T24-L28 HydrophobicContact CG2-CD1 4.25Å; T24-L28 WeakPolarHBondContact O-CG 3.39Å; T24-L28 PolarHBondContact O-N 3.5Å
25	M	97.8	Very high	96.1	Very high	32 Å²	32	87.4 Å²	87.4	16%	0.158	46%	0.459	C	S	.	.	H	α-helix	trans	-66.5	-37.7	178.1	-75	-57.8	-56.9	0	0	112.7	V21 R22 E23 L28 L29 L44 V48	V21-M25 WeakPolarHBondContact O-CG 3.38Å; V21-M25 PolarHBondContact O-N 3.23Å; R22-M25 PolarHBondContact O-N 3.3Å; E23-M25 PolarHBondContact O-N 2.95Å; M25-L28 PolarHBondContact O-N 3.49Å; M25-L28 HydrophobicContact SD-CD1 4.21Å; M25-L29 PolarHBondContact O-N 3.26Å; M25-L44 HydrophobicContact CE-CB 4.47Å; M25-L44 HydrophobicContact CE-CD2 4.26Å; M25-L44 HydrophobicContact CE-CG 4.11Å; M25-V48 HydrophobicContact SD-CG2 4.18Å
26	D	97.4	Very high	96.3	Very high	71 Å²	71	91.9 Å²	91.9	38%	0.38	48%	0.477	S	S	.	.	H	α-helix	trans	-63.2	-44.2	176.3	-72	-23.3	0	0	0	110.9	R22 E23 L29 E30 M41	R22-D26 IonicContact NE-OD2 2.96Å; R22-D26 VanDerWaalsContact O-CG 3.32Å; R22-D26 PolarHBondContact O-N 3.46Å; E23-D26 PolarHBondContact O-N 3.35Å; D26-L29 PolarHBondContact O-N 3.48Å; D26-E30 PolarHBondContact O-N 3.49Å; D26-M41 WeakPolarHBondContact OD1-CE 3.46Å
27	V	98	Very high	96.4	Very high	85 Å²	85	91.5 Å²	91.5	52%	0.515	47%	0.468	S	S	.	.	H	α-helix	trans	-62.4	-44.8	174.7	171.9	0	0	0	0	111.5	E23 T24 L29 E30 I31	E23-V27 WeakPolarHBondContact O-CG2 3.47Å; E23-V27 PolarHBondContact O-N 2.9Å; T24-V27 PolarHBondContact O-N 3.05Å; V27-L29 VanDerWaalsContact C-N 3.31Å; V27-L29 PolarHBondContact O-N 3.48Å; V27-E30 PolarHBondContact O-N 3.03Å; V27-I31 HydrophobicContact CG1-CD1 4.01Å; V27-I31 WeakPolarHBondContact O-CG1 3.48Å; V27-I31 PolarHBondContact O-N 3.04Å
28	L	97.6	Very high	96.3	Very high	59 Å²	59	89.1 Å²	89.1	31%	0.309	47%	0.468	S	S	.	.	H	α-helix	trans	-62.9	-37.8	177.8	-72.5	173.7	0	0	0	112.1	T24 M25 I31 S32 L44 V48	T24-L28 HydrophobicContact CG2-CD1 4.25Å; T24-L28 WeakPolarHBondContact O-CG 3.39Å; T24-L28 PolarHBondContact O-N 3.5Å; M25-L28 PolarHBondContact O-N 3.49Å; M25-L28 HydrophobicContact SD-CD1 4.21Å; L28-I31 PolarHBondContact O-N 3Å; L28-S32 WeakPolarHBondContact O-CB 3.48Å; L28-S32 PolarHBondContact O-N 3.23Å; L28-L44 HydrophobicContact CB-CD2 4Å; L28-V48 HydrophobicContact CD1-CG2 3.83Å
29	L	97.8	Very high	96.4	Very high	12 Å²	12	85 Å²	85	6%	0.063	45%	0.446	C	S	.	.	H	α-helix	trans	-66.1	-40.6	175.3	-175.2	73.6	0	0	0	111.4	M25 D26 V27 S32 R33 M41 L44	M25-L29 PolarHBondContact O-N 3.26Å; D26-L29 PolarHBondContact O-N 3.48Å; V27-L29 VanDerWaalsContact C-N 3.31Å; V27-L29 PolarHBondContact O-N 3.48Å; L29-S32 WeakPolarHBondContact O-CB 3.43Å; L29-S32 PolarHBondContact O-N 2.69Å; L29-R33 WeakPolarHBondContact O-CG 3.32Å; L29-R33 PolarHBondContact O-N 3.32Å; L29-M41 HydrophobicContact CB-CE 3.71Å; L29-M41 HydrophobicContact CB-SD 3.76Å; L29-M41 HydrophobicContact CD1-CG 4.23Å; L29-M41 HydrophobicContact CD1-SD 3.99Å; L29-M41 HydrophobicContact CD2-CE 3.43Å; L29-M41 VanDerWaalsContact CD2-CE 3.43Å; L29-M41 HydrophobicContact CD2-CG 3.75Å; L29-M41 HydrophobicContact CD2-SD 3.67Å; L29-M41 HydrophobicContact CG-CE 4.1Å; L29-M41 HydrophobicContact CG-CG 4.47Å; L29-M41 HydrophobicContact CG-SD 3.98Å; L29-L44 HydrophobicContact CB-CD2 4.03Å; L29-L44 HydrophobicContact CD1-CD2 4.14Å
30	E	97.9	Very high	96.4	Very high	124 Å²	124	84.4 Å²	84.4	58%	0.579	44%	0.443	S	S	*	.	H	α-helix	trans	-63.1	-43.2	177.4	-172	152.7	-161.8	0	0	111.6	D26 V27 S32 R33 I34	D26-E30 PolarHBondContact O-N 3.49Å; V27-E30 PolarHBondContact O-N 3.03Å; E30-S32 VanDerWaalsContact C-N 3.33Å; E30-S32 PolarHBondContact O-N 3.22Å; E30-R33 WeakPolarHBondContact O-CB 3.45Å; E30-R33 PolarHBondContact O-N 3.09Å; E30-I34 HydrophobicContact CG-CD1 4.24Å; E30-I34 WeakPolarHBondContact O-CG1 3.42Å; E30-I34 PolarHBondContact O-N 2.95Å
31	I	97.8	Very high	96.3	Very high	80 Å²	80	85.7 Å²	85.7	41%	0.41	44%	0.443	S	S	.	.	H	α-helix	trans	-58.3	-46.3	171.6	-66.1	165.7	0	0	0	110.8	V27 L28 R33 I34 L35	V27-I31 HydrophobicContact CG1-CD1 4.01Å; V27-I31 WeakPolarHBondContact O-CG1 3.48Å; V27-I31 PolarHBondContact O-N 3.04Å; L28-I31 PolarHBondContact O-N 3Å; I31-R33 VanDerWaalsContact C-N 3.28Å; I31-R33 PolarHBondContact O-N 3.1Å; I31-I34 PolarHBondContact O-N 3.47Å; I31-L35 HydrophobicContact CG2-CD1 3.9Å; I31-L35 HydrophobicContact CG2-CG 4.41Å; I31-L35 WeakPolarHBondContact O-CB 3.45Å; I31-L35 WeakPolarHBondContact O-CG 3.31Å; I31-L35 PolarHBondContact O-N 3.03Å
32	S	96.4	Very high	96.3	Very high	7 Å²	7	88.8 Å²	88.8	5%	0.049	45%	0.452	C	S	.	.	H	α-helix	trans	-57.6	-39.4	177.7	172.3	0	0	0	0	112.6	L28 L29 E30 N36 T37	L28-S32 WeakPolarHBondContact O-CB 3.48Å; L28-S32 PolarHBondContact O-N 3.23Å; L29-S32 WeakPolarHBondContact O-CB 3.43Å; L29-S32 PolarHBondContact O-N 2.69Å; E30-S32 VanDerWaalsContact C-N 3.33Å; E30-S32 PolarHBondContact O-N 3.22Å; S32-N36 PolarHBondContact O-N 3.19Å; S32-T37 PolarHBondContact O-N 3.05Å; S32-T37 PolarHBondContact OG-OG1 3.31Å
33	R	96.7	Very high	96.2	Very high	173 Å²	173	82.9 Å²	82.9	65%	0.653	44%	0.435	S	S	*	.	H	α-helix	trans	-68.9	-44.7	176.3	-72.8	171.3	175.1	172.2	-2	111.9	L29 E30 I31 L35 N36	L29-R33 WeakPolarHBondContact O-CG 3.32Å; L29-R33 PolarHBondContact O-N 3.32Å; E30-R33 WeakPolarHBondContact O-CB 3.45Å; E30-R33 PolarHBondContact O-N 3.09Å; I31-R33 VanDerWaalsContact C-N 3.28Å; I31-R33 PolarHBondContact O-N 3.1Å; R33-L35 VanDerWaalsContact C-N 3.29Å; R33-L35 PolarHBondContact O-N 3.24Å; R33-N36 WeakPolarHBondContact O-CA 3.35Å; R33-N36 PolarHBondContact O-N 3.4Å
34	I	98.1	Very high	96.2	Very high	131 Å²	131	77.5 Å²	77.5	67%	0.672	41%	0.41	S	S	*	.	H	α-helix	trans	-60.4	-41.9	177.1	-68.1	166.1	0	0	0	110.8	E30 I31 N36	E30-I34 HydrophobicContact CG-CD1 4.24Å; E30-I34 WeakPolarHBondContact O-CG1 3.42Å; E30-I34 PolarHBondContact O-N 2.95Å; I31-I34 PolarHBondContact O-N 3.47Å; I34-N36 PolarHBondContact O-N 3.02Å
35	L	96.6	Very high	96.2	Very high	122 Å²	122	76.6 Å²	76.6	64%	0.639	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.6	-0.9	177	-64.1	178.9	0	0	0	113.6	I31 R33 T37	I31-L35 HydrophobicContact CG2-CD1 3.9Å; I31-L35 HydrophobicContact CG2-CG 4.41Å; I31-L35 WeakPolarHBondContact O-CB 3.45Å; I31-L35 WeakPolarHBondContact O-CG 3.31Å; I31-L35 PolarHBondContact O-N 3.03Å; R33-L35 VanDerWaalsContact C-N 3.29Å; R33-L35 PolarHBondContact O-N 3.24Å; L35-T37 HydrophobicContact CB-CG2 3.9Å; L35-T37 PolarHBondContact O-N 2.95Å
36	N	94.9	Very high	96.1	Very high	143 Å²	143	79.4 Å²	79.4	77%	0.765	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	50	41.8	178.7	-152.3	65.3	0	0	0	113.3	S32 R33 I34 G38	S32-N36 PolarHBondContact O-N 3.19Å; R33-N36 WeakPolarHBondContact O-CA 3.35Å; R33-N36 PolarHBondContact O-N 3.4Å; I34-N36 PolarHBondContact O-N 3.02Å; N36-G38 PolarHBondContact O-N 3.41Å
37	T	94.4	Very high	96.1	Very high	53 Å²	53	76.8 Å²	76.8	33%	0.325	41%	0.409	S	S	.	.			trans	-70.9	-18.4	-178.4	76	0	0	0	0	112.5	S32 L35 L39 R68	S32-T37 PolarHBondContact O-N 3.05Å; S32-T37 PolarHBondContact OG-OG1 3.31Å; L35-T37 HydrophobicContact CB-CG2 3.9Å; L35-T37 PolarHBondContact O-N 2.95Å; T37-L39 VanDerWaalsContact C-N 3.26Å; T37-L39 PolarHBondContact O-N 3.22Å; T37-L39 WeakPolarHBondContact OG1-CG 3.34Å; T37-L39 PolarHBondContact OG1-N 2.8Å; T37-R68 PolarHBondContact O-NH1 2.99Å
38	G	93.2	Very high	96	Very high	55 Å²	55	74.5 Å²	74.5	57%	0.567	40%	0.396	S	S	*	.			trans	68.3	21.4	-177	0	0	0	0	0	113.5	N36 R68	N36-G38 PolarHBondContact O-N 3.41Å; G38-R68 PolarHBondContact O-NH2 2.91Å
39	L	94.7	Very high	95.9	Very high	33 Å²	33	79.2 Å²	79.2	17%	0.173	41%	0.409	C	S	.	.			trans	-84.9	132	172.1	-60.9	170.4	0	0	0	109.9	T37 T43 L44 I64	T37-L39 VanDerWaalsContact C-N 3.26Å; T37-L39 PolarHBondContact O-N 3.22Å; T37-L39 WeakPolarHBondContact OG1-CG 3.34Å; T37-L39 PolarHBondContact OG1-N 2.8Å; L39-T43 HydrophobicContact CD2-CG2 3.6Å; L39-L44 HydrophobicContact CD1-CD1 4.28Å; L39-I64 HydrophobicContact CD2-CG2 4.45Å
40	D	94.4	Very high	95.9	Very high	85 Å²	85	80.9 Å²	80.9	46%	0.455	42%	0.418	S	S	.	.			trans	-85.9	172.8	170.1	64.9	-12.7	0	0	0	111.2	E42 T43 L44	D40-E42 VanDerWaalsContact C-N 3.27Å; D40-E42 PolarHBondContact O-N 2.94Å; D40-T43 PolarHBondContact O-N 2.93Å; D40-T43 WeakPolarHBondContact OD1-CB 3.4Å; D40-T43 PolarHBondContact OD1-N 3.41Å; D40-T43 PolarHBondContact OD1-OG1 3.22Å; D40-L44 VanDerWaalsContact O-CB 3.23Å; D40-L44 WeakPolarHBondContact O-CB 3.28Å; D40-L44 PolarHBondContact O-N 3.29Å
41	M	93.6	Very high	95.8	Very high	72 Å²	72	77.6 Å²	77.6	36%	0.355	41%	0.408	S	S	.	.	H	α-helix	trans	-57	-41	-177	-87.5	-58.1	-157.8	0	0	113	D26 L29 S45	D26-M41 WeakPolarHBondContact OD1-CE 3.46Å; L29-M41 HydrophobicContact CB-CE 3.71Å; L29-M41 HydrophobicContact CB-SD 3.76Å; L29-M41 HydrophobicContact CD1-CG 4.23Å; L29-M41 HydrophobicContact CD1-SD 3.99Å; L29-M41 HydrophobicContact CD2-CE 3.43Å; L29-M41 VanDerWaalsContact CD2-CE 3.43Å; L29-M41 HydrophobicContact CD2-CG 3.75Å; L29-M41 HydrophobicContact CD2-SD 3.67Å; L29-M41 HydrophobicContact CG-CE 4.1Å; L29-M41 HydrophobicContact CG-CG 4.47Å; L29-M41 HydrophobicContact CG-SD 3.98Å; M41-S45 WeakPolarHBondContact O-CB 3.38Å; M41-S45 PolarHBondContact O-N 3.16Å
42	E	95.3	Very high	95.7	Very high	142 Å²	142	79.9 Å²	79.9	66%	0.664	42%	0.417	S	S	*	.	H	α-helix	trans	-67.1	-51.1	-178.1	-172.6	171.9	-172.8	0	0	111	D40 L44 S45 I46	D40-E42 VanDerWaalsContact C-N 3.27Å; D40-E42 PolarHBondContact O-N 2.94Å; E42-L44 VanDerWaalsContact C-N 3.32Å; E42-L44 PolarHBondContact O-N 3.27Å; E42-S45 WeakPolarHBondContact O-CB 3.3Å; E42-S45 PolarHBondContact O-N 3.46Å; E42-I46 HydrophobicContact CG-CD1 4.48Å; E42-I46 WeakPolarHBondContact O-CG1 3.41Å; E42-I46 PolarHBondContact O-N 3.37Å; E42-I46 VanDerWaalsContact O-N 3.15Å
43	T	94.5	Very high	95.8	Very high	48 Å²	48	86.1 Å²	86.1	29%	0.294	45%	0.446	S	S	.	.	H	α-helix	trans	-63.6	-39.9	178.7	-51	0	0	0	0	111.5	L39 D40 S45 I46 C47	L39-T43 HydrophobicContact CD2-CG2 3.6Å; D40-T43 PolarHBondContact O-N 2.93Å; D40-T43 WeakPolarHBondContact OD1-CB 3.4Å; D40-T43 PolarHBondContact OD1-N 3.41Å; D40-T43 PolarHBondContact OD1-OG1 3.22Å; T43-S45 PolarHBondContact O-N 2.97Å; T43-I46 PolarHBondContact O-N 3.2Å; T43-C47 PolarHBondContact O-N 3.41Å; T43-C47 PolarHBondContact O-SG 3.44Å
44	L	96.4	Very high	95.8	Very high	18 Å²	18	81.2 Å²	81.2	9%	0.094	45%	0.448	C	S	.	.	H	α-helix	trans	-62.2	-43.2	178.4	-175.8	64	0	0	0	111.7	M25 L28 L29 L39 D40 E42 I46 C47 V48	M25-L44 HydrophobicContact CE-CB 4.47Å; M25-L44 HydrophobicContact CE-CD2 4.26Å; M25-L44 HydrophobicContact CE-CG 4.11Å; L28-L44 HydrophobicContact CB-CD2 4Å; L29-L44 HydrophobicContact CB-CD2 4.03Å; L29-L44 HydrophobicContact CD1-CD2 4.14Å; L39-L44 HydrophobicContact CD1-CD1 4.28Å; D40-L44 VanDerWaalsContact O-CB 3.23Å; D40-L44 WeakPolarHBondContact O-CB 3.28Å; D40-L44 PolarHBondContact O-N 3.29Å; E42-L44 VanDerWaalsContact C-N 3.32Å; E42-L44 PolarHBondContact O-N 3.27Å; L44-I46 VanDerWaalsContact C-N 3.32Å; L44-I46 PolarHBondContact O-N 3.03Å; L44-C47 WeakPolarHBondContact O-CB 3.49Å; L44-C47 PolarHBondContact O-N 3.15Å; L44-V48 WeakPolarHBondContact O-CG2 3.47Å; L44-V48 PolarHBondContact O-N 3.28Å
45	S	96.6	Very high	95.7	Very high	63 Å²	63	78.1 Å²	78.1	44%	0.441	43%	0.433	S	S	.	.	H	α-helix	trans	-59.2	-42.5	175.8	-179.1	0	0	0	0	112	M41 E42 T43 V48 R49	M41-S45 WeakPolarHBondContact O-CB 3.38Å; M41-S45 PolarHBondContact O-N 3.16Å; E42-S45 WeakPolarHBondContact O-CB 3.3Å; E42-S45 PolarHBondContact O-N 3.46Å; T43-S45 PolarHBondContact O-N 2.97Å; S45-V48 PolarHBondContact O-N 3.32Å; S45-R49 PolarHBondContact O-N 2.57Å
46	I	96.3	Very high	95.7	Very high	91 Å²	91	76.3 Å²	76.3	47%	0.467	42%	0.423	S	S	.	.	H	α-helix	trans	-62.2	-47	175.4	-64.1	165.7	0	0	0	110.4	E42 T43 L44 V48 R49 L50	E42-I46 HydrophobicContact CG-CD1 4.48Å; E42-I46 WeakPolarHBondContact O-CG1 3.41Å; E42-I46 PolarHBondContact O-N 3.37Å; E42-I46 VanDerWaalsContact O-N 3.15Å; T43-I46 PolarHBondContact O-N 3.2Å; L44-I46 VanDerWaalsContact C-N 3.32Å; L44-I46 PolarHBondContact O-N 3.03Å; I46-V48 VanDerWaalsContact C-N 3.34Å; I46-V48 PolarHBondContact O-N 3.48Å; I46-R49 PolarHBondContact O-N 2.86Å; I46-L50 HydrophobicContact CG2-CD1 3.93Å; I46-L50 HydrophobicContact CG2-CG 4.34Å; I46-L50 VanDerWaalsContact O-CG 3.32Å; I46-L50 WeakPolarHBondContact O-CG 3.41Å; I46-L50 PolarHBondContact O-N 3.28Å
47	C	96.5	Very high	95.7	Very high	16 Å²	16	73.4 Å²	73.4	11%	0.108	41%	0.413	C	S	.	.	H	α-helix	trans	-59.1	-43.9	178.2	-68.5	0	0	0	0	112.3	T43 L44 R49 L50 C51 L60 I64	T43-C47 PolarHBondContact O-N 3.41Å; T43-C47 PolarHBondContact O-SG 3.44Å; L44-C47 WeakPolarHBondContact O-CB 3.49Å; L44-C47 PolarHBondContact O-N 3.15Å; C47-R49 VanDerWaalsContact C-N 3.34Å; C47-R49 PolarHBondContact O-N 3.19Å; C47-L50 PolarHBondContact O-N 2.94Å; C47-C51 WeakPolarHBondContact O-CB 3.49Å; C47-C51 PolarHBondContact O-N 2.97Å; C47-C51 PolarHBondContact O-SG 2.76Å; C47-L60 HydrophobicContact CB-CD2 4.08Å; C47-I64 VanDerWaalsContact SG-CD1 3.52Å
48	V	96.1	Very high	95.8	Very high	38 Å²	38	77.6 Å²	77.6	23%	0.23	43%	0.429	C	S	.	.	H	α-helix	trans	-59.3	-47.2	176.3	171.5	0	0	0	0	110.3	M25 L28 L44 S45 I46 L50 C51 E52	M25-V48 HydrophobicContact SD-CG2 4.18Å; L28-V48 HydrophobicContact CD1-CG2 3.83Å; L44-V48 WeakPolarHBondContact O-CG2 3.47Å; L44-V48 PolarHBondContact O-N 3.28Å; S45-V48 PolarHBondContact O-N 3.32Å; I46-V48 VanDerWaalsContact C-N 3.34Å; I46-V48 PolarHBondContact O-N 3.48Å; V48-L50 VanDerWaalsContact C-N 3.32Å; V48-L50 PolarHBondContact O-N 3.25Å; V48-C51 PolarHBondContact O-N 3.21Å; V48-E52 HydrophobicContact CG1-CG 4.41Å; V48-E52 WeakPolarHBondContact O-CG 3.37Å; V48-E52 PolarHBondContact O-N 2.89Å
49	R	96.8	Very high	95.9	Very high	157 Å²	157	77.4 Å²	77.4	59%	0.592	42%	0.421	S	S	*	.	H	α-helix	trans	-62.2	-38.2	179.4	-168.3	58.5	132.1	-161.8	-5.9	113.2	S45 I46 C47 E52 Q53	S45-R49 PolarHBondContact O-N 2.57Å; I46-R49 PolarHBondContact O-N 2.86Å; C47-R49 VanDerWaalsContact C-N 3.34Å; C47-R49 PolarHBondContact O-N 3.19Å; R49-E52 VanDerWaalsContact CD-OE2 3.3Å; R49-E52 WeakPolarHBondContact CD-OE2 3.05Å; R49-E52 IonicContact CZ-OE2 3.93Å; R49-E52 IonicContact NH1-OE2 3.97Å; R49-E52 PolarHBondContact NH1-OE2 3.41Å; R49-E52 PolarHBondContact O-N 2.95Å; R49-Q53 WeakPolarHBondContact O-CG 3.36Å; R49-Q53 PolarHBondContact O-N 2.96Å
50	L	96.8	Very high	95.9	Very high	47 Å²	47	77 Å²	77	25%	0.246	42%	0.419	C	S	.	.	H	α-helix	trans	-67.9	-42.1	176.1	-68.9	173.8	0	0	0	111.1	I46 C47 V48 Q53 I55 L60	I46-L50 HydrophobicContact CG2-CD1 3.93Å; I46-L50 HydrophobicContact CG2-CG 4.34Å; I46-L50 VanDerWaalsContact O-CG 3.32Å; I46-L50 WeakPolarHBondContact O-CG 3.41Å; I46-L50 PolarHBondContact O-N 3.28Å; C47-L50 PolarHBondContact O-N 2.94Å; V48-L50 VanDerWaalsContact C-N 3.32Å; V48-L50 PolarHBondContact O-N 3.25Å; L50-Q53 WeakPolarHBondContact O-CB 3.37Å; L50-Q53 PolarHBondContact O-N 3.38Å; L50-Q53 VanDerWaalsContact O-N 3.16Å; L50-I55 HydrophobicContact CB-CB 4.47Å; L50-I55 HydrophobicContact CB-CD1 3.72Å; L50-I55 HydrophobicContact CD2-CD1 3.5Å; L50-I55 HydrophobicContact CG-CD1 4.13Å; L50-I55 VanDerWaalsContact O-CB 3.31Å; L50-I55 WeakPolarHBondContact O-CB 3.23Å; L50-I55 PolarHBondContact O-N 3.48Å; L50-L60 HydrophobicContact CB-CD2 4.15Å; L50-L60 HydrophobicContact CD1-CD1 3.74Å; L50-L60 HydrophobicContact CD1-CD2 4.26Å
51	C	96.2	Very high	95.9	Very high	55 Å²	55	75 Å²	75	37%	0.372	41%	0.412	S	S	.	.	H	α-helix	trans	-63.2	-39.7	174.1	-69.9	0	0	0	0	112.1	C47 V48 Q53 G54	C47-C51 WeakPolarHBondContact O-CB 3.49Å; C47-C51 PolarHBondContact O-N 2.97Å; C47-C51 PolarHBondContact O-SG 2.76Å; V48-C51 PolarHBondContact O-N 3.21Å; C51-Q53 PolarHBondContact O-N 3.29Å; C51-G54 PolarHBondContact O-N 3.02Å
52	E	96.1	Very high	96.1	Very high	128 Å²	128	74.5 Å²	74.5	60%	0.598	42%	0.416	S	S	*	.	H	α-helix	trans	-60.1	-29.5	173.6	-73.9	176.4	168.9	0	0	112.7	V48 R49 G54	V48-E52 HydrophobicContact CG1-CG 4.41Å; V48-E52 WeakPolarHBondContact O-CG 3.37Å; V48-E52 PolarHBondContact O-N 2.89Å; R49-E52 VanDerWaalsContact CD-OE2 3.3Å; R49-E52 WeakPolarHBondContact CD-OE2 3.05Å; R49-E52 IonicContact CZ-OE2 3.93Å; R49-E52 IonicContact NH1-OE2 3.97Å; R49-E52 PolarHBondContact NH1-OE2 3.41Å; R49-E52 PolarHBondContact O-N 2.95Å; E52-G54 PolarHBondContact O-N 3.3Å
53	Q	97.4	Very high	96.1	Very high	139 Å²	139	71.3 Å²	71.3	65%	0.65	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.4	0.7	174.5	-69.4	176.3	-13.4	0	0	113.5	R49 L50 C51	R49-Q53 WeakPolarHBondContact O-CG 3.36Å; R49-Q53 PolarHBondContact O-N 2.96Å; L50-Q53 WeakPolarHBondContact O-CB 3.37Å; L50-Q53 PolarHBondContact O-N 3.38Å; L50-Q53 VanDerWaalsContact O-N 3.16Å; C51-Q53 PolarHBondContact O-N 3.29Å
54	G	96.3	Very high	96.1	Very high	69 Å²	69	70.7 Å²	70.7	71%	0.711	40%	0.4	S	S	*	.	T	Hydrogen-bonded Turn	trans	86.9	15.2	178.6	0	0	0	0	0	114.4	C51 E52	C51-G54 PolarHBondContact O-N 3.02Å; E52-G54 PolarHBondContact O-N 3.3Å
55	I	97.3	Very high	96	Very high	67 Å²	67	76.6 Å²	76.6	34%	0.344	43%	0.425	S	S	.	.			trans	-69.3	136.2	173.6	-66.3	168.2	0	0	0	109.5	L50 P57 L60	L50-I55 HydrophobicContact CB-CB 4.47Å; L50-I55 HydrophobicContact CB-CD1 3.72Å; L50-I55 HydrophobicContact CD2-CD1 3.5Å; L50-I55 HydrophobicContact CG-CD1 4.13Å; L50-I55 VanDerWaalsContact O-CB 3.31Å; L50-I55 WeakPolarHBondContact O-CB 3.23Å; L50-I55 PolarHBondContact O-N 3.48Å; I55-P57 WeakPolarHBondContact O-CD 3.38Å; I55-L60 HydrophobicContact CG2-CB 4.29Å
56	N	96.3	Very high	96	Very high	83 Å²	83	80.2 Å²	80.2	44%	0.444	44%	0.435	S	S	.	.			trans	-63.8	120.5	177.1	179.9	-6.5	0	0	0	110.4	E58 A59 L60	N56-E58 PolarHBondContact O-N 3.39Å; N56-E58 WeakPolarHBondContact OD1-CB 3.34Å; N56-E58 PolarHBondContact OD1-N 3.4Å; N56-A59 HydrophobicContact CB-CB 4.12Å; N56-A59 PolarHBondContact O-N 3.43Å; N56-L60 PolarHBondContact O-N 2.72Å
57	P	94.9	Very high	96	Very high	83 Å²	83	81.2 Å²	81.2	54%	0.539	44%	0.441	S	S	.	.	H	α-helix	trans	-61	-31.8	-179.6	24.7	-35.1	0	0	0	113	I55 S61	I55-P57 WeakPolarHBondContact O-CD 3.38Å; P57-S61 WeakPolarHBondContact O-CB 3.44Å; P57-S61 PolarHBondContact O-N 3.01Å
58	E	95.8	Very high	95.9	Very high	141 Å²	141	85.2 Å²	85.2	66%	0.659	45%	0.454	S	S	*	.	H	α-helix	trans	-66.7	-46.7	178	-64.1	-177.3	172	0	0	111.1	N56 S61 S62	N56-E58 PolarHBondContact O-N 3.39Å; N56-E58 WeakPolarHBondContact OD1-CB 3.34Å; N56-E58 PolarHBondContact OD1-N 3.4Å; E58-S61 WeakPolarHBondContact O-CB 3.5Å; E58-S61 PolarHBondContact O-N 3.3Å; E58-S61 PolarHBondContact O-OG 2.91Å; E58-S62 PolarHBondContact O-N 2.93Å; E58-S62 VanDerWaalsContact O-N 3.09Å; E58-S62 PolarHBondContact O-OG 3.21Å
59	A	95.9	Very high	95.9	Very high	50 Å²	50	91.3 Å²	91.3	41%	0.413	48%	0.477	S	S	.	.	H	α-helix	trans	-62.8	-43.6	177	0	0	0	0	0	111.4	N56 S61 S62 V63	N56-A59 HydrophobicContact CB-CB 4.12Å; N56-A59 PolarHBondContact O-N 3.43Å; A59-S61 VanDerWaalsContact C-N 3.29Å; A59-S61 PolarHBondContact O-N 3.3Å; A59-S62 WeakPolarHBondContact O-CB 3.36Å; A59-S62 PolarHBondContact O-N 3.19Å; A59-V63 WeakPolarHBondContact O-CG2 3.39Å; A59-V63 PolarHBondContact O-N 3.02Å; A59-V63 VanDerWaalsContact O-N 3.1Å
60	L	95.4	Very high	95.9	Very high	25 Å²	25	86.3 Å²	86.3	13%	0.131	47%	0.469	C	S	.	.	H	α-helix	trans	-58.9	-42.5	175.1	-178.7	60.8	0	0	0	111.4	C47 L50 I55 N56 S62 V63 I64	C47-L60 HydrophobicContact CB-CD2 4.08Å; L50-L60 HydrophobicContact CB-CD2 4.15Å; L50-L60 HydrophobicContact CD1-CD1 3.74Å; L50-L60 HydrophobicContact CD1-CD2 4.26Å; I55-L60 HydrophobicContact CG2-CB 4.29Å; N56-L60 PolarHBondContact O-N 2.72Å; L60-S62 VanDerWaalsContact C-N 3.32Å; L60-S62 PolarHBondContact O-N 3.23Å; L60-V63 PolarHBondContact O-N 2.94Å; L60-I64 HydrophobicContact CD1-CD1 4.28Å; L60-I64 HydrophobicContact CG-CD1 4.02Å; L60-I64 WeakPolarHBondContact O-CG1 3.32Å; L60-I64 PolarHBondContact O-N 3.47Å
61	S	94.4	Very high	95.8	Very high	44 Å²	44	87.2 Å²	87.2	31%	0.308	48%	0.477	S	S	.	.	H	α-helix	trans	-61.9	-38.9	177.6	85.3	0	0	0	0	112.5	P57 E58 A59 I64 K65	P57-S61 WeakPolarHBondContact O-CB 3.44Å; P57-S61 PolarHBondContact O-N 3.01Å; E58-S61 WeakPolarHBondContact O-CB 3.5Å; E58-S61 PolarHBondContact O-N 3.3Å; E58-S61 PolarHBondContact O-OG 2.91Å; A59-S61 VanDerWaalsContact C-N 3.29Å; A59-S61 PolarHBondContact O-N 3.3Å; S61-I64 PolarHBondContact O-N 3.18Å; S61-K65 VanDerWaalsContact O-CG 3.28Å; S61-K65 WeakPolarHBondContact O-CG 3.48Å; S61-K65 PolarHBondContact O-N 2.99Å
62	S	96.4	Very high	95.7	Very high	61 Å²	61	89.9 Å²	89.9	43%	0.427	48%	0.484	S	S	.	.	H	α-helix	trans	-63.8	-46.4	176.9	-63.8	0	0	0	0	111.1	E58 A59 L60 I64 K65 E66	E58-S62 PolarHBondContact O-N 2.93Å; E58-S62 VanDerWaalsContact O-N 3.09Å; E58-S62 PolarHBondContact O-OG 3.21Å; A59-S62 WeakPolarHBondContact O-CB 3.36Å; A59-S62 PolarHBondContact O-N 3.19Å; L60-S62 VanDerWaalsContact C-N 3.32Å; L60-S62 PolarHBondContact O-N 3.23Å; S62-I64 PolarHBondContact O-N 2.96Å; S62-K65 PolarHBondContact O-N 3.06Å; S62-E66 WeakPolarHBondContact O-CG 3.37Å; S62-E66 PolarHBondContact O-N 3.05Å
63	V	96.3	Very high	95.7	Very high	75 Å²	75	86.8 Å²	86.8	46%	0.455	48%	0.48	S	S	.	.	H	α-helix	trans	-59.3	-46.5	176.9	174.4	0	0	0	0	111.1	A59 L60 K65 E66 L67	A59-V63 WeakPolarHBondContact O-CG2 3.39Å; A59-V63 PolarHBondContact O-N 3.02Å; A59-V63 VanDerWaalsContact O-N 3.1Å; L60-V63 PolarHBondContact O-N 2.94Å; V63-K65 VanDerWaalsContact C-N 3.33Å; V63-K65 PolarHBondContact O-N 3.39Å; V63-E66 PolarHBondContact O-N 3.42Å; V63-L67 HydrophobicContact CG1-CD1 3.98Å; V63-L67 HydrophobicContact CG1-CG 4.33Å; V63-L67 WeakPolarHBondContact O-CG 3.36Å; V63-L67 PolarHBondContact O-N 3.36Å
64	I	94.6	Very high	95.6	Very high	35 Å²	35	85.6 Å²	85.6	18%	0.179	48%	0.477	C	S	.	.	H	α-helix	trans	-60.6	-43.3	178.8	-67.8	167.4	0	0	0	111.3	L39 C47 L60 S61 S62 R68	L39-I64 HydrophobicContact CD2-CG2 4.45Å; C47-I64 VanDerWaalsContact SG-CD1 3.52Å; L60-I64 HydrophobicContact CD1-CD1 4.28Å; L60-I64 HydrophobicContact CG-CD1 4.02Å; L60-I64 WeakPolarHBondContact O-CG1 3.32Å; L60-I64 PolarHBondContact O-N 3.47Å; S61-I64 PolarHBondContact O-N 3.18Å; S62-I64 PolarHBondContact O-N 2.96Å; I64-R68 WeakPolarHBondContact O-CG 3.4Å; I64-R68 PolarHBondContact O-N 3.02Å
65	K	94.3	Very high	95.5	Very high	141 Å²	141	87 Å²	87	61%	0.613	46%	0.464	S	S	*	.	H	α-helix	trans	-63.7	-43.3	178.4	-73.5	169.8	-176.5	172.1	0	111.6	S61 S62 V63 R68 K69	S61-K65 VanDerWaalsContact O-CG 3.28Å; S61-K65 WeakPolarHBondContact O-CG 3.48Å; S61-K65 PolarHBondContact O-N 2.99Å; S62-K65 PolarHBondContact O-N 3.06Å; V63-K65 VanDerWaalsContact C-N 3.33Å; V63-K65 PolarHBondContact O-N 3.39Å; K65-R68 PolarHBondContact O-N 3.42Å; K65-K69 WeakPolarHBondContact O-CB 3.16Å; K65-K69 PolarHBondContact O-N 3.42Å
66	E	96.9	Very high	95.3	Very high	140 Å²	140	86.6 Å²	86.6	65%	0.654	47%	0.47	S	S	*	.	H	α-helix	trans	-64.5	-46	178.4	-74.9	-179.7	178.5	0	0	112	S62 V63 R68 K69 A70	S62-E66 WeakPolarHBondContact O-CG 3.37Å; S62-E66 PolarHBondContact O-N 3.05Å; V63-E66 PolarHBondContact O-N 3.42Å; E66-R68 PolarHBondContact O-N 3.31Å; E66-K69 PolarHBondContact O-N 2.93Å; E66-A70 WeakPolarHBondContact O-CB 3.34Å; E66-A70 PolarHBondContact O-N 3.2Å
67	L	95.8	Very high	95.1	Very high	111 Å²	111	85.3 Å²	85.3	58%	0.581	47%	0.471	S	S	*	.	H	α-helix	trans	-61	-44	177.5	-70.4	177.3	0	0	0	111.9	V63 K69 A70 T71	V63-L67 HydrophobicContact CG1-CD1 3.98Å; V63-L67 HydrophobicContact CG1-CG 4.33Å; V63-L67 WeakPolarHBondContact O-CG 3.36Å; V63-L67 PolarHBondContact O-N 3.36Å; L67-K69 PolarHBondContact O-N 3.22Å; L67-A70 PolarHBondContact O-N 3.34Å; L67-T71 PolarHBondContact O-N 2.98Å; L67-T71 PolarHBondContact O-OG1 3.28Å; L67-T71 VanDerWaalsContact O-OG1 3.06Å
68	R	94.5	Very high	94.9	Very high	101 Å²	101	87.2 Å²	87.2	38%	0.381	47%	0.473	S	S	.	.	H	α-helix	trans	-59.7	-46.5	175.2	-75.1	177	173.5	-164.7	-6.3	111.4	T37 G38 I64 K65 E66 A70 T71 E72	T37-R68 PolarHBondContact O-NH1 2.99Å; G38-R68 PolarHBondContact O-NH2 2.91Å; I64-R68 WeakPolarHBondContact O-CG 3.4Å; I64-R68 PolarHBondContact O-N 3.02Å; K65-R68 PolarHBondContact O-N 3.42Å; E66-R68 PolarHBondContact O-N 3.31Å; R68-A70 PolarHBondContact O-N 2.95Å; R68-T71 PolarHBondContact O-N 3.43Å; R68-E72 WeakPolarHBondContact O-CG 3.49Å; R68-E72 PolarHBondContact O-N 3.47Å
69	K	95.4	Very high	94.4	Very high	166 Å²	166	86.3 Å²	86.3	72%	0.722	47%	0.473	S	S	*	.	H	α-helix	trans	-61.3	-43.1	178.7	-172.5	-177.9	179	-175.3	0	112	K65 E66 L67 E72 A73	K65-K69 WeakPolarHBondContact O-CB 3.16Å; K65-K69 PolarHBondContact O-N 3.42Å; E66-K69 PolarHBondContact O-N 2.93Å; L67-K69 PolarHBondContact O-N 3.22Å; K69-E72 PolarHBondContact O-N 3.03Å; K69-A73 WeakPolarHBondContact O-CB 3.49Å; K69-A73 PolarHBondContact O-N 2.92Å
70	A	96.1	Very high	93.6	Very high	51 Å²	51	92 Å²	92	42%	0.421	49%	0.493	S	S	.	.	H	α-helix	trans	-63.6	-44.9	178.2	0	0	0	0	0	111.8	E66 L67 R68 E72 A73 L74	E66-A70 WeakPolarHBondContact O-CB 3.34Å; E66-A70 PolarHBondContact O-N 3.2Å; L67-A70 PolarHBondContact O-N 3.34Å; R68-A70 PolarHBondContact O-N 2.95Å; A70-E72 PolarHBondContact O-N 3.44Å; A70-A73 PolarHBondContact O-N 2.76Å; A70-L74 WeakPolarHBondContact O-CG 3.47Å; A70-L74 PolarHBondContact O-N 3.38Å
71	T	95	Very high	92.7	Very high	67 Å²	67	96.7 Å²	96.7	41%	0.411	52%	0.523	S	S	.	.	H	α-helix	trans	-61.1	-44.2	177.3	-61.8	0	0	0	0	112.3	L67 R68 A73 L74 K75	L67-T71 PolarHBondContact O-N 2.98Å; L67-T71 PolarHBondContact O-OG1 3.28Å; L67-T71 VanDerWaalsContact O-OG1 3.06Å; R68-T71 PolarHBondContact O-N 3.43Å; T71-A73 VanDerWaalsContact C-N 3.34Å; T71-A73 PolarHBondContact O-N 2.97Å; T71-L74 PolarHBondContact O-N 3.37Å; T71-K75 HydrophobicContact CG2-CD 4.5Å; T71-K75 WeakPolarHBondContact O-CG 3.35Å; T71-K75 PolarHBondContact O-N 3.49Å
72	E	94.8	Very high	90.9	Very high	111 Å²	111	102.1 Å²	102.1	52%	0.519	56%	0.56	S	S	.	*	H	α-helix	trans	-65.7	-37.6	177.3	-66.7	-55.9	116.8	0	0	112.1	R68 K69 A70 K75 A76	R68-E72 WeakPolarHBondContact O-CG 3.49Å; R68-E72 PolarHBondContact O-N 3.47Å; K69-E72 PolarHBondContact O-N 3.03Å; A70-E72 PolarHBondContact O-N 3.44Å; E72-K75 PolarHBondContact O-N 3.19Å; E72-K75 IonicContact OE1-NZ 2.8Å; E72-K75 PolarHBondContact OE1-NZ 3.43Å; E72-A76 WeakPolarHBondContact O-CB 3.4Å; E72-A76 PolarHBondContact O-N 3.04Å
73	A	95.2	Very high	90.6	Very high	62 Å²	62	104.2 Å²	104.2	51%	0.512	57%	0.567	S	S	.	*	H	α-helix	trans	-64.2	-39.2	174.4	0	0	0	0	0	112.4	K69 A70 T71 A76 A77	K69-A73 WeakPolarHBondContact O-CB 3.49Å; K69-A73 PolarHBondContact O-N 2.92Å; A70-A73 PolarHBondContact O-N 2.76Å; T71-A73 VanDerWaalsContact C-N 3.34Å; T71-A73 PolarHBondContact O-N 2.97Å; A73-A76 PolarHBondContact O-N 3.49Å; A73-A77 WeakPolarHBondContact O-CB 3.49Å; A73-A77 PolarHBondContact O-N 3.05Å
74	L	95.6	Very high	90.4	Very high	115 Å²	115	105.7 Å²	105.7	60%	0.602	57%	0.573	S	S	*	*	H	α-helix	trans	-64.4	-48.7	176.4	-71.3	166.4	0	0	0	111.4	A70 T71 A76 A77 E78	A70-L74 WeakPolarHBondContact O-CG 3.47Å; A70-L74 PolarHBondContact O-N 3.38Å; T71-L74 PolarHBondContact O-N 3.37Å; L74-A76 VanDerWaalsContact C-N 3.29Å; L74-A76 PolarHBondContact O-N 3.01Å; L74-A77 WeakPolarHBondContact O-CB 3.48Å; L74-A77 PolarHBondContact O-N 3.33Å; L74-A77 VanDerWaalsContact O-N 3.14Å; L74-E78 WeakPolarHBondContact O-CG 3.46Å; L74-E78 PolarHBondContact O-N 3.06Å
75	K	94.4	Very high	90.1	Very high	99 Å²	99	109.6 Å²	109.6	43%	0.43	60%	0.595	S	S	.	*	H	α-helix	trans	-57.9	-42	175.6	-69.2	173.3	-174.8	166.6	0	112.2	T71 E72 E78 N79	T71-K75 HydrophobicContact CG2-CD 4.5Å; T71-K75 WeakPolarHBondContact O-CG 3.35Å; T71-K75 PolarHBondContact O-N 3.49Å; E72-K75 PolarHBondContact O-N 3.19Å; E72-K75 IonicContact OE1-NZ 2.8Å; E72-K75 PolarHBondContact OE1-NZ 3.43Å; K75-E78 PolarHBondContact O-N 3.02Å; K75-N79 VanDerWaalsContact O-CG 3.22Å; K75-N79 PolarHBondContact O-N 3Å; K75-N79 VanDerWaalsContact O-N 3.15Å; K75-N79 PolarHBondContact O-ND2 2.88Å; K75-N79 PolarHBondContact O-OD1 3.36Å
76	A	93.1	Very high	89.9	Confident	57 Å²	57	107.8 Å²	107.8	47%	0.471	59%	0.594	S	S	.	*	H	α-helix	trans	-64.7	-40	177.9	0	0	0	0	0	112	E72 A73 L74 M80	E72-A76 WeakPolarHBondContact O-CB 3.4Å; E72-A76 PolarHBondContact O-N 3.04Å; A73-A76 PolarHBondContact O-N 3.49Å; L74-A76 VanDerWaalsContact C-N 3.29Å; L74-A76 PolarHBondContact O-N 3.01Å; A76-M80 PolarHBondContact O-N 3.07Å
77	A	92.1	Very high	89.4	Confident	56 Å²	56	105.8 Å²	105.8	46%	0.463	59%	0.59	S	S	.	*	H	α-helix	trans	-64.7	-45	176.2	0	0	0	0	0	111.8	A73 L74 N79 M80 T81	A73-A77 WeakPolarHBondContact O-CB 3.49Å; A73-A77 PolarHBondContact O-N 3.05Å; L74-A77 WeakPolarHBondContact O-CB 3.48Å; L74-A77 PolarHBondContact O-N 3.33Å; L74-A77 VanDerWaalsContact O-N 3.14Å; A77-N79 VanDerWaalsContact C-N 3.31Å; A77-N79 PolarHBondContact O-N 3.04Å; A77-M80 PolarHBondContact O-N 3.47Å; A77-T81 PolarHBondContact O-N 3.45Å; A77-T81 PolarHBondContact O-OG1 3.33Å; A77-T81 VanDerWaalsContact O-OG1 3.05Å
78	E	91.2	Very high	89	Confident	123 Å²	123	105.4 Å²	105.4	58%	0.575	59%	0.59	S	S	*	*	H	α-helix	trans	-57.8	-43	177.4	-71.9	175.4	155.1	0	0	112.2	L74 K75 M80 T81 S82	L74-E78 WeakPolarHBondContact O-CG 3.46Å; L74-E78 PolarHBondContact O-N 3.06Å; K75-E78 PolarHBondContact O-N 3.02Å; E78-M80 PolarHBondContact O-N 3.36Å; E78-T81 PolarHBondContact O-N 3.34Å; E78-T81 PolarHBondContact O-OG1 3.04Å; E78-S82 PolarHBondContact O-N 3.33Å; E78-S82 PolarHBondContact O-OG 3.5Å; E78-S82 VanDerWaalsContact O-OG 3.12Å
79	N	84.8	Confident	88.6	Confident	123 Å²	123	105.7 Å²	105.7	66%	0.658	61%	0.605	S	S	*	*	H	α-helix	trans	-65.9	-22.4	177.7	-69.6	-10.5	0	0	0	113.6	K75 A77	K75-N79 VanDerWaalsContact O-CG 3.22Å; K75-N79 PolarHBondContact O-N 3Å; K75-N79 VanDerWaalsContact O-N 3.15Å; K75-N79 PolarHBondContact O-ND2 2.88Å; K75-N79 PolarHBondContact O-OD1 3.36Å; A77-N79 VanDerWaalsContact C-N 3.31Å; A77-N79 PolarHBondContact O-N 3.04Å
80	M	79.8	Confident	88.1	Confident	170 Å²	170	101.1 Å²	101.1	84%	0.837	60%	0.596	S	S	*	*	H	α-helix	trans	-89.5	-16.1	-179.6	-141.1	161	76.9	0	0	112.6	A76 A77 E78	A76-M80 PolarHBondContact O-N 3.07Å; A77-M80 PolarHBondContact O-N 3.47Å; E78-M80 PolarHBondContact O-N 3.36Å
81	T	74.9	Confident	87.4	Confident	123 Å²	123	105.3 Å²	105.3	76%	0.755	61%	0.611	S	S	*	*	H	α-helix	trans	-96.4	-6.3	175.1	33.3	0	0	0	0	114.4	A77 E78	A77-T81 PolarHBondContact O-N 3.45Å; A77-T81 PolarHBondContact O-OG1 3.33Å; A77-T81 VanDerWaalsContact O-OG1 3.05Å; E78-T81 PolarHBondContact O-N 3.34Å; E78-T81 PolarHBondContact O-OG1 3.04Å
82	S	58	Low	86.7	Confident	157 Å²	157	108.7 Å²	108.7	100%	1.098	63%	0.629	S	S	*	*			trans	-97.5	0	175.1	-54.8	0	0	0	0	111	E78	E78-S82 PolarHBondContact O-N 3.33Å; E78-S82 PolarHBondContact O-OG 3.5Å; E78-S82 VanDerWaalsContact O-OG 3.12Å

Retrieved 82 of 82 residues in 86.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).