A0A096N2N4_PAPAN Loading...

T-cell leukemia translocation-altered gene protein homolog

May be required for cellular fusion during osteoclastogenesis.

AlphaFold DB (F7DH74), UniProt , Accession A0A096N2N4, Species PAPAN (Papio anubis, Olive baboon), Gene TCTA, Length 106 aa.

						>A0A096N2N4_PAPAN|A0A096N2N4|TCTA
MAEPWSGQALQALPATVLDALGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.5	Very low	54.5	Low	238 Å²	238	123.6 Å²	123.6	100%	1.172	67%	0.674	S	S	*	*				0	108	0	-84	166.2	166.7	0	0	106.7	E3	M1-E3 PolarHBondContact O-N 2.85Å
2	A	51.3	Low	55.1	Low	100 Å²	100	117.5 Å²	117.5	83%	0.826	65%	0.652	S	S	*	*			trans	-73.9	124.2	174.6	0	0	0	0	0	107.9	P4	A2-P4 WeakPolarHBondContact O-CD 3.37Å
3	E	48.3	Very low	56.2	Low	151 Å²	151	116.2 Å²	116.2	71%	0.706	64%	0.643	S	S	*	*			trans	-69.5	119.1	-169.6	-62.1	-174.9	94.1	0	0	110.7	M1 W5 S6	M1-E3 PolarHBondContact O-N 2.85Å; E3-W5 PolarHBondContact O-N 3.5Å; E3-S6 PolarHBondContact O-N 3.1Å; E3-S6 PolarHBondContact O-OG 3.45Å
4	P	54.4	Low	57.2	Low	93 Å²	93	113 Å²	113	60%	0.604	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.8	-9.4	-172.6	21.6	-29.7	0	0	0	114.3	A2	A2-P4 WeakPolarHBondContact O-CD 3.37Å
5	W	56.3	Low	58.2	Low	202 Å²	202	109.5 Å²	109.5	77%	0.765	62%	0.621	S	S	*	*	H	α-helix	trans	-79.2	-26.2	-174.7	-57.8	9.5	0	0	0	112.1	E3 G7 A9	E3-W5 PolarHBondContact O-N 3.5Å; W5-G7 PolarHBondContact O-N 2.85Å; W5-A9 WeakPolarHBondContact O-CB 3.44Å; W5-A9 PolarHBondContact O-N 3.36Å; W5-A9 VanDerWaalsContact O-N 3.1Å
6	S	57.1	Low	59.2	Low	75 Å²	75	108.3 Å²	108.3	52%	0.524	62%	0.617	S	S	.	*	H	α-helix	trans	-62.2	-42.9	178.8	55.9	0	0	0	0	112.1	E3 L10	E3-S6 PolarHBondContact O-N 3.1Å; E3-S6 PolarHBondContact O-OG 3.45Å; S6-L10 WeakPolarHBondContact O-CB 3.43Å; S6-L10 WeakPolarHBondContact O-CD1 3.33Å; S6-L10 WeakPolarHBondContact O-CG 3.42Å; S6-L10 PolarHBondContact O-N 2.99Å
7	G	56.8	Low	60.3	Low	35 Å²	35	106.1 Å²	106.1	36%	0.361	61%	0.606	S	S	.	*	H	α-helix	trans	-70.2	-39.2	-180	0	0	0	0	0	113.6	W5 Q11	W5-G7 PolarHBondContact O-N 2.85Å; G7-Q11 WeakPolarHBondContact O-CB 3.48Å; G7-Q11 WeakPolarHBondContact O-CG 3.41Å; G7-Q11 PolarHBondContact O-N 3.05Å
8	Q	57.8	Low	61.2	Low	131 Å²	131	106.2 Å²	106.2	61%	0.612	60%	0.603	S	S	*	*	H	α-helix	trans	-72.7	-39.4	-179.8	-74.7	168.6	-45	0	0	112.5	Q11 A12	Q8-Q11 PolarHBondContact O-N 2.93Å; Q8-A12 WeakPolarHBondContact O-CB 3.4Å; Q8-A12 PolarHBondContact O-N 3.32Å
9	A	58.1	Low	62.3	Low	59 Å²	59	107.2 Å²	107.2	49%	0.488	61%	0.607	S	S	.	*	H	α-helix	trans	-64.7	-41.2	174.4	0	0	0	0	0	111.7	W5 Q11 A12 L13	W5-A9 WeakPolarHBondContact O-CB 3.44Å; W5-A9 PolarHBondContact O-N 3.36Å; W5-A9 VanDerWaalsContact O-N 3.1Å; A9-Q11 VanDerWaalsContact C-N 3.31Å; A9-Q11 PolarHBondContact O-N 3.44Å; A9-A12 PolarHBondContact O-N 3.1Å; A9-L13 WeakPolarHBondContact O-CG 3.38Å; A9-L13 PolarHBondContact O-N 3.33Å; A9-L13 VanDerWaalsContact O-N 3.1Å
10	L	57.3	Low	63.2	Low	119 Å²	119	104.5 Å²	104.5	62%	0.623	60%	0.598	S	S	*	*	H	α-helix	trans	-65.8	-30.6	175.4	-81.3	163	0	0	0	113.3	S6 L13 P14	S6-L10 WeakPolarHBondContact O-CB 3.43Å; S6-L10 WeakPolarHBondContact O-CD1 3.33Å; S6-L10 WeakPolarHBondContact O-CG 3.42Å; S6-L10 PolarHBondContact O-N 2.99Å; L10-L13 HydrophobicContact CD2-CD1 4.36Å; L10-P14 WeakPolarHBondContact O-CD 3.38Å
11	Q	61.4	Low	63.9	Low	157 Å²	157	101.2 Å²	101.2	73%	0.734	58%	0.579	S	S	*	*	H	α-helix	trans	-82.5	-25.5	175.2	-74.3	-169.1	-41.5	0	0	113.8	G7 Q8 A9 P14	G7-Q11 WeakPolarHBondContact O-CB 3.48Å; G7-Q11 WeakPolarHBondContact O-CG 3.41Å; G7-Q11 PolarHBondContact O-N 3.05Å; Q8-Q11 PolarHBondContact O-N 2.93Å; A9-Q11 VanDerWaalsContact C-N 3.31Å; A9-Q11 PolarHBondContact O-N 3.44Å; Q11-P14 WeakPolarHBondContact O-CD 3.23Å; Q11-P14 WeakPolarHBondContact O-CG 3.5Å
12	A	62.6	Low	65.8	Low	50 Å²	50	92.1 Å²	92.1	41%	0.413	55%	0.546	S	S	.	.	H	α-helix	trans	-76.3	-34	174.8	0	0	0	0	0	112.3	Q8 A9 A15 T16	Q8-A12 WeakPolarHBondContact O-CB 3.4Å; Q8-A12 PolarHBondContact O-N 3.32Å; A9-A12 PolarHBondContact O-N 3.1Å; A12-A15 WeakPolarHBondContact O-CB 3.33Å; A12-A15 PolarHBondContact O-N 3.3Å; A12-A15 VanDerWaalsContact O-N 3.11Å; A12-T16 PolarHBondContact O-N 2.95Å; A12-T16 PolarHBondContact O-OG1 2.92Å; A12-T16 VanDerWaalsContact O-OG1 3.06Å
13	L	68.5	Low	67.2	Low	101 Å²	101	89.7 Å²	89.7	53%	0.529	53%	0.526	S	S	.	.	H	α-helix	trans	-49.8	-50.7	176.9	-83.6	168.5	0	0	0	114.3	A9 L10 A15 T16 V17	A9-L13 WeakPolarHBondContact O-CG 3.38Å; A9-L13 PolarHBondContact O-N 3.33Å; A9-L13 VanDerWaalsContact O-N 3.1Å; L10-L13 HydrophobicContact CD2-CD1 4.36Å; L13-A15 VanDerWaalsContact C-N 3.32Å; L13-A15 PolarHBondContact O-N 3.11Å; L13-T16 PolarHBondContact O-N 3.45Å; L13-V17 WeakPolarHBondContact O-CB 3.38Å; L13-V17 VanDerWaalsContact O-CG2 3.26Å; L13-V17 WeakPolarHBondContact O-CG2 3.35Å; L13-V17 PolarHBondContact O-N 3.5Å
14	P	70.6	Confident	68.6	Low	71 Å²	71	86.7 Å²	86.7	46%	0.461	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-37.3	178.4	12.5	-21.4	0	0	0	112.9	L10 Q11 V17 L18	L10-P14 WeakPolarHBondContact O-CD 3.38Å; Q11-P14 WeakPolarHBondContact O-CD 3.23Å; Q11-P14 WeakPolarHBondContact O-CG 3.5Å; P14-V17 PolarHBondContact O-N 3.06Å; P14-L18 WeakPolarHBondContact O-CB 3.45Å; P14-L18 VanDerWaalsContact O-CG 3.23Å; P14-L18 WeakPolarHBondContact O-CG 3.42Å; P14-L18 PolarHBondContact O-N 2.96Å
15	A	72.1	Confident	69.7	Low	60 Å²	60	83.2 Å²	83.2	50%	0.496	50%	0.495	S	S	.	.	H	α-helix	trans	-65.9	-44	176.7	0	0	0	0	0	111.4	A12 L13 V17 L18 D19	A12-A15 WeakPolarHBondContact O-CB 3.33Å; A12-A15 PolarHBondContact O-N 3.3Å; A12-A15 VanDerWaalsContact O-N 3.11Å; L13-A15 VanDerWaalsContact C-N 3.32Å; L13-A15 PolarHBondContact O-N 3.11Å; A15-V17 PolarHBondContact O-N 2.96Å; A15-L18 PolarHBondContact O-N 2.92Å; A15-D19 WeakPolarHBondContact O-CB 3.48Å; A15-D19 PolarHBondContact O-N 3.4Å
16	T	74.9	Confident	70.6	Confident	91 Å²	91	76.9 Å²	76.9	56%	0.558	48%	0.482	S	S	*	.	H	α-helix	trans	-64.2	-38.8	176.6	-50.4	0	0	0	0	112.3	A12 L13 D19 A20	A12-T16 PolarHBondContact O-N 2.95Å; A12-T16 PolarHBondContact O-OG1 2.92Å; A12-T16 VanDerWaalsContact O-OG1 3.06Å; L13-T16 PolarHBondContact O-N 3.45Å; T16-D19 PolarHBondContact O-N 3.36Å; T16-A20 WeakPolarHBondContact O-CB 3.44Å; T16-A20 PolarHBondContact O-N 3.48Å
17	V	76.4	Confident	71.5	Confident	70 Å²	70	77.1 Å²	77.1	42%	0.424	48%	0.475	S	S	.	.	H	α-helix	trans	-67.8	-41.4	176.9	170.4	0	0	0	0	111.3	L13 P14 A15 L21	L13-V17 WeakPolarHBondContact O-CB 3.38Å; L13-V17 VanDerWaalsContact O-CG2 3.26Å; L13-V17 WeakPolarHBondContact O-CG2 3.35Å; L13-V17 PolarHBondContact O-N 3.5Å; P14-V17 PolarHBondContact O-N 3.06Å; A15-V17 PolarHBondContact O-N 2.96Å; V17-L21 VanDerWaalsContact O-CB 3.31Å; V17-L21 WeakPolarHBondContact O-CB 3.31Å; V17-L21 PolarHBondContact O-N 3.49Å
18	L	77.8	Confident	72.2	Confident	108 Å²	108	77.2 Å²	77.2	57%	0.565	47%	0.465	S	S	*	.	H	α-helix	trans	-64.9	-41.2	175.9	-75.1	169.3	0	0	0	112	P14 A15 L21 G22	P14-L18 WeakPolarHBondContact O-CB 3.45Å; P14-L18 VanDerWaalsContact O-CG 3.23Å; P14-L18 WeakPolarHBondContact O-CG 3.42Å; P14-L18 PolarHBondContact O-N 2.96Å; A15-L18 PolarHBondContact O-N 2.92Å; L18-L21 PolarHBondContact O-N 3Å; L18-G22 PolarHBondContact O-N 3.37Å
19	D	80.8	Confident	72.9	Confident	125 Å²	125	76.6 Å²	76.6	67%	0.668	47%	0.466	S	S	*	.	H	α-helix	trans	-63.3	-47.4	176.3	-170.8	-103.1	0	0	0	111.4	A15 T16 L21 G22 A23	A15-D19 WeakPolarHBondContact O-CB 3.48Å; A15-D19 PolarHBondContact O-N 3.4Å; T16-D19 PolarHBondContact O-N 3.36Å; D19-L21 VanDerWaalsContact C-N 3.32Å; D19-L21 PolarHBondContact O-N 2.89Å; D19-G22 PolarHBondContact O-N 3.18Å; D19-A23 PolarHBondContact O-N 3.37Å
20	A	80.3	Confident	73.6	Confident	53 Å²	53	80.8 Å²	80.8	44%	0.438	47%	0.469	S	S	.	.	H	α-helix	trans	-61.8	-38.3	175.7	0	0	0	0	0	112.6	T16 A23 L24	T16-A20 WeakPolarHBondContact O-CB 3.44Å; T16-A20 PolarHBondContact O-N 3.48Å; A20-A23 PolarHBondContact O-N 2.93Å; A20-L24 WeakPolarHBondContact O-CB 3.36Å; A20-L24 PolarHBondContact O-N 3.37Å
21	L	79.8	Confident	74.3	Confident	37 Å²	37	77.1 Å²	77.1	19%	0.194	45%	0.448	C	S	.	.	H	α-helix	trans	-67.3	-40.2	175.7	-170.7	67.7	0	0	0	111.5	V17 L18 D19 L24 G25 L47 V50	V17-L21 VanDerWaalsContact O-CB 3.31Å; V17-L21 WeakPolarHBondContact O-CB 3.31Å; V17-L21 PolarHBondContact O-N 3.49Å; L18-L21 PolarHBondContact O-N 3Å; D19-L21 VanDerWaalsContact C-N 3.32Å; D19-L21 PolarHBondContact O-N 2.89Å; L21-L24 PolarHBondContact O-N 2.9Å; L21-G25 PolarHBondContact O-N 2.91Å; L21-L47 HydrophobicContact CD1-CD1 4.2Å; L21-L47 HydrophobicContact CD1-CG 4.18Å; L21-V50 HydrophobicContact CD1-CG1 4.1Å
22	G	78.6	Confident	74.5	Confident	46 Å²	46	76.9 Å²	76.9	47%	0.474	44%	0.441	S	S	.	.	H	α-helix	trans	-61.2	-45.8	174.1	0	0	0	0	0	112.2	L18 D19 L24 G25 S26	L18-G22 PolarHBondContact O-N 3.37Å; D19-G22 PolarHBondContact O-N 3.18Å; G22-L24 PolarHBondContact O-N 3.48Å; G22-G25 PolarHBondContact O-N 3.17Å; G22-S26 PolarHBondContact O-N 2.94Å; G22-S26 PolarHBondContact O-OG 2.6Å
23	A	82.3	Confident	74.9	Confident	49 Å²	49	82.3 Å²	82.3	41%	0.405	46%	0.458	S	S	.	.	H	α-helix	trans	-62.3	-41.2	175.8	0	0	0	0	0	112.2	D19 A20 G25 S26 E27	D19-A23 PolarHBondContact O-N 3.37Å; A20-A23 PolarHBondContact O-N 2.93Å; A23-G25 VanDerWaalsContact C-N 3.31Å; A23-G25 PolarHBondContact O-N 3.35Å; A23-S26 WeakPolarHBondContact CA-OG 3.02Å; A23-S26 PolarHBondContact O-N 3Å; A23-S26 PolarHBondContact O-OG 3.49Å; A23-E27 WeakPolarHBondContact O-CG 3.38Å; A23-E27 PolarHBondContact O-N 3.38Å
24	L	76.3	Confident	75.2	Confident	89 Å²	89	81 Å²	81	47%	0.466	46%	0.461	S	S	.	.	H	α-helix	trans	-63	-38.5	174.3	-113.9	144.8	0	0	0	112.2	A20 L21 G22 F28	A20-L24 WeakPolarHBondContact O-CB 3.36Å; A20-L24 PolarHBondContact O-N 3.37Å; L21-L24 PolarHBondContact O-N 2.9Å; G22-L24 PolarHBondContact O-N 3.48Å; L24-F28 WeakPolarHBondContact O-CB 3.37Å; L24-F28 PolarHBondContact O-N 3.02Å
25	G	77.5	Confident	74.7	Confident	20 Å²	20	85 Å²	85	21%	0.206	47%	0.474	C	S	.	.	H	α-helix	trans	-67.3	-39.7	175.3	0	0	0	0	0	113.3	L21 G22 A23 F28 L29	L21-G25 PolarHBondContact O-N 2.91Å; G22-G25 PolarHBondContact O-N 3.17Å; A23-G25 VanDerWaalsContact C-N 3.31Å; A23-G25 PolarHBondContact O-N 3.35Å; G25-F28 WeakPolarHBondContact O-CB 3.48Å; G25-F28 PolarHBondContact O-N 2.99Å; G25-L29 PolarHBondContact O-N 3.45Å
26	S	75.1	Confident	74.7	Confident	68 Å²	68	86 Å²	86	48%	0.476	47%	0.471	S	S	.	.	H	α-helix	trans	-68.7	-40.9	176.4	57	0	0	0	0	112.3	G22 A23 F28 L29 R30	G22-S26 PolarHBondContact O-N 2.94Å; G22-S26 PolarHBondContact O-OG 2.6Å; A23-S26 WeakPolarHBondContact CA-OG 3.02Å; A23-S26 PolarHBondContact O-N 3Å; A23-S26 PolarHBondContact O-OG 3.49Å; S26-F28 VanDerWaalsContact C-N 3.31Å; S26-F28 PolarHBondContact O-N 3.36Å; S26-L29 WeakPolarHBondContact O-CB 3.31Å; S26-L29 PolarHBondContact O-N 3.21Å; S26-R30 PolarHBondContact O-N 3.3Å
27	E	77.4	Confident	74.5	Confident	80 Å²	80	87.7 Å²	87.7	37%	0.374	47%	0.474	S	S	.	.	H	α-helix	trans	-62.5	-41.4	173.6	-70.1	-70.4	133.1	0	0	110.4	A23 L29 R30 E31	A23-E27 WeakPolarHBondContact O-CG 3.38Å; A23-E27 PolarHBondContact O-N 3.38Å; E27-L29 PolarHBondContact O-N 3.16Å; E27-R30 WeakPolarHBondContact O-CB 3.26Å; E27-R30 PolarHBondContact O-N 3.43Å; E27-R30 VanDerWaalsContact O-N 3.16Å; E27-R30 IonicContact OE2-NH2 2.6Å; E27-E31 PolarHBondContact O-N 2.86Å
28	F	71.1	Confident	74.4	Confident	37 Å²	37	94 Å²	94	16%	0.162	49%	0.49	C	S	.	.	H	α-helix	trans	-57.4	-44.8	172.2	170.1	-90.7	0	0	0	112.9	L24 G25 S26 R30 E31 W32 T40 K43 L44	L24-F28 WeakPolarHBondContact O-CB 3.37Å; L24-F28 PolarHBondContact O-N 3.02Å; G25-F28 WeakPolarHBondContact O-CB 3.48Å; G25-F28 PolarHBondContact O-N 2.99Å; S26-F28 VanDerWaalsContact C-N 3.31Å; S26-F28 PolarHBondContact O-N 3.36Å; F28-R30 PolarHBondContact O-N 3.41Å; F28-E31 PolarHBondContact O-N 3.04Å; F28-W32 VanDerWaalsContact O-CB 3.31Å; F28-W32 WeakPolarHBondContact O-CB 3.39Å; F28-W32 PolarHBondContact O-N 3.1Å; F28-T40 HydrophobicContact CD2-CG2 4.17Å; F28-T40 HydrophobicContact CE2-CG2 3.2Å; F28-T40 WeakPolarHBondContact CE2-O 3.34Å; F28-T40 HydrophobicContact CZ-CG2 3.45Å; F28-T40 VanDerWaalsContact CZ-CG2 3.45Å; F28-K43 HydrophobicContact CB-CD 4.24Å; F28-K43 HydrophobicContact CD2-CB 3.7Å; F28-K43 HydrophobicContact CD2-CD 4.47Å; F28-K43 HydrophobicContact CE2-CB 4.47Å; F28-L44 HydrophobicContact CE2-CB 3.84Å; F28-L44 HydrophobicContact CZ-CB 4.21Å; F28-L44 HydrophobicContact CZ-CD1 4.22Å
29	L	72.6	Confident	74	Confident	119 Å²	119	91.7 Å²	91.7	62%	0.623	48%	0.48	S	S	*	.	H	α-helix	trans	-61.4	-36.6	177.8	-137.4	75.4	0	0	0	111.4	G25 S26 E27 E33	G25-L29 PolarHBondContact O-N 3.45Å; S26-L29 WeakPolarHBondContact O-CB 3.31Å; S26-L29 PolarHBondContact O-N 3.21Å; E27-L29 PolarHBondContact O-N 3.16Å; L29-E33 PolarHBondContact O-N 2.82Å; L29-E33 VanDerWaalsContact O-N 3.1Å
30	R	73.1	Confident	73.8	Confident	147 Å²	147	86 Å²	86	56%	0.555	45%	0.45	S	S	*	.	H	α-helix	trans	-71.1	-41.2	176.8	-159.2	176	79.9	155.3	-0.1	112.7	S26 E27 F28 E33 A34	S26-R30 PolarHBondContact O-N 3.3Å; E27-R30 WeakPolarHBondContact O-CB 3.26Å; E27-R30 PolarHBondContact O-N 3.43Å; E27-R30 VanDerWaalsContact O-N 3.16Å; E27-R30 IonicContact OE2-NH2 2.6Å; F28-R30 PolarHBondContact O-N 3.41Å; R30-E33 PolarHBondContact O-N 3.41Å; R30-A34 PolarHBondContact O-N 3.34Å; R30-A34 VanDerWaalsContact O-N 3.09Å
31	E	71.4	Confident	73.6	Confident	41 Å²	41	88.9 Å²	88.9	19%	0.192	46%	0.458	C	S	.	.	H	α-helix	trans	-72.4	-28.6	174.6	-95.1	81.3	-123.1	0	0	113.3	E27 F28 A34 Q35 D36 V39 K43	E27-E31 PolarHBondContact O-N 2.86Å; F28-E31 PolarHBondContact O-N 3.04Å; E31-A34 PolarHBondContact O-N 3.35Å; E31-Q35 PolarHBondContact O-N 3.35Å; E31-D36 PolarHBondContact O-N 3.09Å; E31-V39 HydrophobicContact CG-CG1 4.31Å; E31-K43 IonicContact OE2-NZ 3.73Å; E31-K43 PolarHBondContact OE2-NZ 3.36Å
32	W	65.3	Low	73.5	Confident	152 Å²	152	94.2 Å²	94.2	58%	0.576	48%	0.479	S	S	*	.	H	α-helix	trans	-64.1	-44.6	170.2	173.8	-99.9	0	0	0	111	F28 A34 Q35 T40	F28-W32 VanDerWaalsContact O-CB 3.31Å; F28-W32 WeakPolarHBondContact O-CB 3.39Å; F28-W32 PolarHBondContact O-N 3.1Å; W32-A34 VanDerWaalsContact C-N 3.26Å; W32-A34 PolarHBondContact O-N 3.32Å; W32-Q35 PolarHBondContact O-N 3.2Å; W32-T40 HydrophobicContact CD2-CG2 4.47Å; W32-T40 HydrophobicContact CE3-CG2 3.36Å; W32-T40 HydrophobicContact CZ3-CG2 3.8Å
33	E	71.2	Confident	73.4	Confident	165 Å²	165	94 Å²	94	77%	0.771	47%	0.466	S	S	*	.	H	α-helix	trans	-61.5	-35.8	174.1	-172	178.3	-166.2	0	0	111.8	L29 R30 Q35	L29-E33 PolarHBondContact O-N 2.82Å; L29-E33 VanDerWaalsContact O-N 3.1Å; R30-E33 PolarHBondContact O-N 3.41Å; E33-Q35 PolarHBondContact O-N 3.03Å
34	A	75.7	Confident	73.3	Confident	73 Å²	73	95.8 Å²	95.8	60%	0.603	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.8	2.3	174.1	0	0	0	0	0	114.6	R30 E31 W32 D36	R30-A34 PolarHBondContact O-N 3.34Å; R30-A34 VanDerWaalsContact O-N 3.09Å; E31-A34 PolarHBondContact O-N 3.35Å; W32-A34 VanDerWaalsContact C-N 3.26Å; W32-A34 PolarHBondContact O-N 3.32Å; A34-D36 VanDerWaalsContact C-N 3.29Å; A34-D36 PolarHBondContact O-N 3.5Å
35	Q	58.4	Low	73.6	Confident	154 Å²	154	97.5 Å²	97.5	72%	0.72	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.3	23.5	174.7	-136.8	-137.3	-93.6	0	0	115.3	E31 W32 E33 M37	E31-Q35 PolarHBondContact O-N 3.35Å; W32-Q35 PolarHBondContact O-N 3.2Å; E33-Q35 PolarHBondContact O-N 3.03Å; Q35-M37 PolarHBondContact O-N 3.18Å
36	D	72.8	Confident	73.8	Confident	83 Å²	83	101.2 Å²	101.2	44%	0.444	49%	0.491	S	S	.	.			trans	-88	82.9	179.4	-149.1	-40.3	0	0	0	111	E31 A34 R38 V39 T40	E31-D36 PolarHBondContact O-N 3.09Å; A34-D36 VanDerWaalsContact C-N 3.29Å; A34-D36 PolarHBondContact O-N 3.5Å; D36-R38 VanDerWaalsContact C-N 3.26Å; D36-R38 PolarHBondContact O-N 3.49Å; D36-V39 HydrophobicContact CB-CB 4.44Å; D36-V39 PolarHBondContact O-N 2.98Å; D36-T40 WeakPolarHBondContact O-CB 3.41Å; D36-T40 PolarHBondContact O-N 2.81Å; D36-T40 VanDerWaalsContact O-N 3.08Å; D36-T40 PolarHBondContact O-OG1 2.86Å
37	M	70.6	Confident	74.2	Confident	125 Å²	125	100.6 Å²	100.6	62%	0.616	48%	0.482	S	S	*	.	H	α-helix	trans	-61.6	-29.4	-170.6	-76.2	-162.5	152.2	0	0	114.2	Q35 L41	Q35-M37 PolarHBondContact O-N 3.18Å; M37-L41 WeakPolarHBondContact O-CB 3.41Å; M37-L41 WeakPolarHBondContact O-CD1 3.41Å; M37-L41 WeakPolarHBondContact O-CG 3.4Å; M37-L41 PolarHBondContact O-N 3.26Å; M37-L41 VanDerWaalsContact O-N 3.14Å
38	R	74.9	Confident	74.5	Confident	204 Å²	204	105.1 Å²	105.1	77%	0.77	50%	0.496	S	S	*	.	H	α-helix	trans	-75.5	-47.8	-178.4	-69.2	-179.2	-179.8	-111.5	0.6	111.1	D36 T40 L41 F42	D36-R38 VanDerWaalsContact C-N 3.26Å; D36-R38 PolarHBondContact O-N 3.49Å; R38-T40 VanDerWaalsContact C-N 3.31Å; R38-T40 PolarHBondContact O-N 3.18Å; R38-L41 PolarHBondContact O-N 3.08Å; R38-F42 VanDerWaalsContact O-CD2 3.3Å; R38-F42 WeakPolarHBondContact O-CD2 3.36Å; R38-F42 PolarHBondContact O-N 3.49Å; R38-F42 VanDerWaalsContact O-N 3.14Å
39	V	69.5	Low	75.2	Confident	59 Å²	59	108.4 Å²	108.4	36%	0.358	52%	0.515	S	S	.	.	H	α-helix	trans	-65.5	-39.6	-179.9	178.3	0	0	0	0	110.7	E31 D36 F42 K43	E31-V39 HydrophobicContact CG-CG1 4.31Å; D36-V39 HydrophobicContact CB-CB 4.44Å; D36-V39 PolarHBondContact O-N 2.98Å; V39-F42 PolarHBondContact O-N 3.48Å; V39-K43 HydrophobicContact CG1-CD 4.26Å; V39-K43 WeakPolarHBondContact O-CB 3.43Å; V39-K43 PolarHBondContact O-N 3.42Å
40	T	75.9	Confident	75.7	Confident	5 Å²	5	105.5 Å²	105.5	3%	0.031	50%	0.502	C	S	.	.	H	α-helix	trans	-53.8	-59.2	170.4	-63	0	0	0	0	110.9	F28 W32 D36 R38 F42 K43 L44	F28-T40 HydrophobicContact CD2-CG2 4.17Å; F28-T40 HydrophobicContact CE2-CG2 3.2Å; F28-T40 WeakPolarHBondContact CE2-O 3.34Å; F28-T40 HydrophobicContact CZ-CG2 3.45Å; F28-T40 VanDerWaalsContact CZ-CG2 3.45Å; W32-T40 HydrophobicContact CD2-CG2 4.47Å; W32-T40 HydrophobicContact CE3-CG2 3.36Å; W32-T40 HydrophobicContact CZ3-CG2 3.8Å; D36-T40 WeakPolarHBondContact O-CB 3.41Å; D36-T40 PolarHBondContact O-N 2.81Å; D36-T40 VanDerWaalsContact O-N 3.08Å; D36-T40 PolarHBondContact O-OG1 2.86Å; R38-T40 VanDerWaalsContact C-N 3.31Å; R38-T40 PolarHBondContact O-N 3.18Å; T40-F42 VanDerWaalsContact C-N 3.3Å; T40-F42 PolarHBondContact O-N 2.92Å; T40-K43 PolarHBondContact O-N 3.49Å; T40-K43 VanDerWaalsContact O-N 3.12Å; T40-L44 WeakPolarHBondContact O-CB 3.37Å; T40-L44 PolarHBondContact O-N 3.32Å
41	L	76.9	Confident	76.3	Confident	114 Å²	114	102.5 Å²	102.5	60%	0.597	50%	0.496	S	S	*	.	H	α-helix	trans	-56.1	-43.5	-177	-82.4	165	0	0	0	112.6	M37 R38 L44 L45	M37-L41 WeakPolarHBondContact O-CB 3.41Å; M37-L41 WeakPolarHBondContact O-CD1 3.41Å; M37-L41 WeakPolarHBondContact O-CG 3.4Å; M37-L41 PolarHBondContact O-N 3.26Å; M37-L41 VanDerWaalsContact O-N 3.14Å; R38-L41 PolarHBondContact O-N 3.08Å; L41-L44 PolarHBondContact O-N 2.94Å; L41-L45 WeakPolarHBondContact O-CB 3.3Å; L41-L45 PolarHBondContact O-N 3.48Å
42	F	76.4	Confident	76.9	Confident	148 Å²	148	103.3 Å²	103.3	65%	0.649	51%	0.507	S	S	*	.	H	α-helix	trans	-64.4	-43.8	177.2	-85.1	-71.2	0	0	0	112.8	R38 V39 T40 L45 L46	R38-F42 VanDerWaalsContact O-CD2 3.3Å; R38-F42 WeakPolarHBondContact O-CD2 3.36Å; R38-F42 PolarHBondContact O-N 3.49Å; R38-F42 VanDerWaalsContact O-N 3.14Å; V39-F42 PolarHBondContact O-N 3.48Å; T40-F42 VanDerWaalsContact C-N 3.3Å; T40-F42 PolarHBondContact O-N 2.92Å; F42-L45 PolarHBondContact O-N 3.49Å; F42-L46 WeakPolarHBondContact O-CB 3.37Å; F42-L46 PolarHBondContact O-N 2.87Å
43	K	76.2	Confident	77.8	Confident	43 Å²	43	101.2 Å²	101.2	19%	0.187	51%	0.506	C	S	.	.	H	α-helix	trans	-65.1	-40.5	177	-83.5	-177.2	168.1	-172.5	0	112.2	F28 E31 V39 T40 L46 L47	F28-K43 HydrophobicContact CB-CD 4.24Å; F28-K43 HydrophobicContact CD2-CB 3.7Å; F28-K43 HydrophobicContact CD2-CD 4.47Å; F28-K43 HydrophobicContact CE2-CB 4.47Å; E31-K43 IonicContact OE2-NZ 3.73Å; E31-K43 PolarHBondContact OE2-NZ 3.36Å; V39-K43 HydrophobicContact CG1-CD 4.26Å; V39-K43 WeakPolarHBondContact O-CB 3.43Å; V39-K43 PolarHBondContact O-N 3.42Å; T40-K43 PolarHBondContact O-N 3.49Å; T40-K43 VanDerWaalsContact O-N 3.12Å; K43-L46 PolarHBondContact O-N 3.48Å; K43-L47 WeakPolarHBondContact O-CB 3.21Å; K43-L47 PolarHBondContact O-N 2.85Å
44	L	80.9	Confident	78.4	Confident	86 Å²	86	96.4 Å²	96.4	45%	0.45	49%	0.485	S	S	.	.	H	α-helix	trans	-63.2	-43.6	175.5	-174.9	68.8	0	0	0	111	F28 T40 L41 L46 L47 W48	F28-L44 HydrophobicContact CE2-CB 3.84Å; F28-L44 HydrophobicContact CZ-CB 4.21Å; F28-L44 HydrophobicContact CZ-CD1 4.22Å; T40-L44 WeakPolarHBondContact O-CB 3.37Å; T40-L44 PolarHBondContact O-N 3.32Å; L41-L44 PolarHBondContact O-N 2.94Å; L44-L46 VanDerWaalsContact C-N 3.35Å; L44-L47 PolarHBondContact O-N 3.24Å; L44-W48 VanDerWaalsContact O-CB 3.3Å; L44-W48 WeakPolarHBondContact O-CB 3.3Å; L44-W48 PolarHBondContact O-N 2.94Å
45	L	82.8	Confident	78.7	Confident	125 Å²	125	94.8 Å²	94.8	65%	0.654	48%	0.476	S	S	*	.	H	α-helix	trans	-63.6	-41.5	177.6	-145.9	80.6	0	0	0	111.5	L41 F42 W48 L49	L41-L45 WeakPolarHBondContact O-CB 3.3Å; L41-L45 PolarHBondContact O-N 3.48Å; F42-L45 PolarHBondContact O-N 3.49Å; L45-W48 PolarHBondContact O-N 3.38Å; L45-L49 WeakPolarHBondContact O-CB 3.3Å; L45-L49 PolarHBondContact O-N 3.47Å
46	L	81.9	Confident	79.7	Confident	98 Å²	98	91.3 Å²	91.3	51%	0.513	46%	0.461	S	S	.	.	H	α-helix	trans	-63.8	-46	174.7	-95.4	152.6	0	0	0	112	F42 K43 L44 W48 L49 V50	F42-L46 WeakPolarHBondContact O-CB 3.37Å; F42-L46 PolarHBondContact O-N 2.87Å; K43-L46 PolarHBondContact O-N 3.48Å; L44-L46 VanDerWaalsContact C-N 3.35Å; L46-W48 VanDerWaalsContact C-N 3.33Å; L46-W48 PolarHBondContact O-N 2.98Å; L46-L49 WeakPolarHBondContact O-CB 3.49Å; L46-L49 PolarHBondContact O-N 3.37Å; L46-V50 WeakPolarHBondContact O-CG2 3.49Å; L46-V50 PolarHBondContact O-N 2.85Å
47	L	82.6	Confident	79.9	Confident	54 Å²	54	93.5 Å²	93.5	28%	0.283	47%	0.469	S	S	.	.	H	α-helix	trans	-62	-43.8	176.9	-176.8	141	0	0	0	110.9	L21 K43 L44 L49 V50 L51	L21-L47 HydrophobicContact CD1-CD1 4.2Å; L21-L47 HydrophobicContact CD1-CG 4.18Å; K43-L47 WeakPolarHBondContact O-CB 3.21Å; K43-L47 PolarHBondContact O-N 2.85Å; L44-L47 PolarHBondContact O-N 3.24Å; L47-L49 VanDerWaalsContact C-N 3.34Å; L47-L49 PolarHBondContact O-N 3.36Å; L47-V50 PolarHBondContact O-N 3.12Å; L47-L51 WeakPolarHBondContact O-CB 3.39Å; L47-L51 PolarHBondContact O-N 3.23Å
48	W	84.4	Confident	80.2	Confident	176 Å²	176	92 Å²	92	67%	0.667	46%	0.463	S	S	*	.	H	α-helix	trans	-62	-41	175.1	-171.2	-98.9	0	0	0	112.3	L44 L45 L46 L51 S52	L44-W48 VanDerWaalsContact O-CB 3.3Å; L44-W48 WeakPolarHBondContact O-CB 3.3Å; L44-W48 PolarHBondContact O-N 2.94Å; L45-W48 PolarHBondContact O-N 3.38Å; L46-W48 VanDerWaalsContact C-N 3.33Å; L46-W48 PolarHBondContact O-N 2.98Å; W48-L51 PolarHBondContact O-N 3.14Å; W48-S52 WeakPolarHBondContact O-CB 3.5Å; W48-S52 PolarHBondContact O-N 2.97Å
49	L	85.6	Confident	80.3	Confident	106 Å²	106	85 Å²	85	56%	0.555	45%	0.449	S	S	*	.	H	α-helix	trans	-61.1	-47.1	175.4	-179.2	68.9	0	0	0	111.3	L45 L46 L47 L51 S52 L53	L45-L49 WeakPolarHBondContact O-CB 3.3Å; L45-L49 PolarHBondContact O-N 3.47Å; L46-L49 WeakPolarHBondContact O-CB 3.49Å; L46-L49 PolarHBondContact O-N 3.37Å; L47-L49 VanDerWaalsContact C-N 3.34Å; L47-L49 PolarHBondContact O-N 3.36Å; L49-L51 VanDerWaalsContact C-N 3.34Å; L49-L51 PolarHBondContact O-N 2.9Å; L49-S52 PolarHBondContact O-N 3.31Å; L49-L53 WeakPolarHBondContact O-CB 2.98Å; L49-L53 PolarHBondContact O-N 2.74Å
50	V	84.1	Confident	80.4	Confident	58 Å²	58	91.2 Å²	91.2	35%	0.352	47%	0.466	S	S	.	.	H	α-helix	trans	-61.8	-43.7	177.2	172.5	0	0	0	0	110.7	L21 L46 L47 S52 L53 L54	L21-V50 HydrophobicContact CD1-CG1 4.1Å; L46-V50 WeakPolarHBondContact O-CG2 3.49Å; L46-V50 PolarHBondContact O-N 2.85Å; L47-V50 PolarHBondContact O-N 3.12Å; V50-S52 PolarHBondContact O-N 3.25Å; V50-L53 PolarHBondContact O-N 3.14Å; V50-L54 WeakPolarHBondContact O-CB 3.41Å; V50-L54 PolarHBondContact O-N 3.32Å
51	L	84.4	Confident	80	Confident	84 Å²	84	92.9 Å²	92.9	44%	0.44	48%	0.484	S	S	.	.	H	α-helix	trans	-63.7	-41.3	178.8	-161.3	69.3	0	0	0	112	L47 W48 L49 L54 G55	L47-L51 WeakPolarHBondContact O-CB 3.39Å; L47-L51 PolarHBondContact O-N 3.23Å; W48-L51 PolarHBondContact O-N 3.14Å; L49-L51 VanDerWaalsContact C-N 3.34Å; L49-L51 PolarHBondContact O-N 2.9Å; L51-L54 PolarHBondContact O-N 2.85Å; L51-G55 PolarHBondContact O-N 3.39Å
52	S	84.7	Confident	79.3	Confident	58 Å²	58	95.1 Å²	95.1	41%	0.406	49%	0.489	S	S	.	.	H	α-helix	trans	-61.4	-46.6	173.7	-177.1	0	0	0	0	111.3	W48 L49 V50 L54 G55 I56	W48-S52 WeakPolarHBondContact O-CB 3.5Å; W48-S52 PolarHBondContact O-N 2.97Å; L49-S52 PolarHBondContact O-N 3.31Å; V50-S52 PolarHBondContact O-N 3.25Å; S52-L54 VanDerWaalsContact C-N 3.3Å; S52-L54 PolarHBondContact O-N 3.37Å; S52-G55 PolarHBondContact O-N 2.8Å; S52-I56 VanDerWaalsContact O-CG1 3.3Å; S52-I56 WeakPolarHBondContact O-CG1 3.07Å; S52-I56 PolarHBondContact O-N 3.04Å
53	L	83.6	Confident	78.4	Confident	107 Å²	107	96.8 Å²	96.8	56%	0.56	49%	0.492	S	S	*	.	H	α-helix	trans	-62.5	-39.3	177.5	-143.9	74.3	0	0	0	111.6	L49 V50 I56 Q57	L49-L53 WeakPolarHBondContact O-CB 2.98Å; L49-L53 PolarHBondContact O-N 2.74Å; V50-L53 PolarHBondContact O-N 3.14Å; L53-I56 PolarHBondContact O-N 3.28Å; L53-Q57 WeakPolarHBondContact O-CB 3.36Å; L53-Q57 WeakPolarHBondContact O-CG 3.37Å; L53-Q57 PolarHBondContact O-N 3.3Å
54	L	83.3	Confident	77.3	Confident	65 Å²	65	95.8 Å²	95.8	34%	0.34	49%	0.494	S	S	.	.	H	α-helix	trans	-66.5	-41.2	176.6	-150.8	74.8	0	0	0	111.5	V50 L51 S52 I56 Q57 L58	V50-L54 WeakPolarHBondContact O-CB 3.41Å; V50-L54 PolarHBondContact O-N 3.32Å; L51-L54 PolarHBondContact O-N 2.85Å; S52-L54 VanDerWaalsContact C-N 3.3Å; S52-L54 PolarHBondContact O-N 3.37Å; L54-I56 VanDerWaalsContact C-N 3.33Å; L54-I56 PolarHBondContact O-N 2.83Å; L54-Q57 PolarHBondContact O-N 3.47Å; L54-L58 WeakPolarHBondContact O-CB 3.42Å; L54-L58 VanDerWaalsContact O-CG 3.3Å; L54-L58 WeakPolarHBondContact O-CG 3.49Å; L54-L58 PolarHBondContact O-N 2.81Å
55	G	81.9	Confident	76	Confident	39 Å²	39	97.3 Å²	97.3	40%	0.402	50%	0.503	S	S	.	.	H	α-helix	trans	-61.5	-40.9	174.2	0	0	0	0	0	112.2	L51 S52 L58 A59	L51-G55 PolarHBondContact O-N 3.39Å; S52-G55 PolarHBondContact O-N 2.8Å; G55-L58 PolarHBondContact O-N 2.84Å; G55-A59 WeakPolarHBondContact O-CB 3.21Å; G55-A59 PolarHBondContact O-N 2.95Å
56	I	80.9	Confident	74.5	Confident	80 Å²	80	96 Å²	96	41%	0.41	50%	0.5	S	S	.	.	H	α-helix	trans	-64.5	-49.5	173.4	-64.9	163	0	0	0	109.7	S52 L53 L54 L58 A59 W60	S52-I56 VanDerWaalsContact O-CG1 3.3Å; S52-I56 WeakPolarHBondContact O-CG1 3.07Å; S52-I56 PolarHBondContact O-N 3.04Å; L53-I56 PolarHBondContact O-N 3.28Å; L54-I56 VanDerWaalsContact C-N 3.33Å; L54-I56 PolarHBondContact O-N 2.83Å; I56-L58 VanDerWaalsContact C-N 3.28Å; I56-L58 PolarHBondContact O-N 3.48Å; I56-A59 CarbonylContact O-C 3.6Å; I56-A59 WeakPolarHBondContact O-CA 3.46Å; I56-A59 WeakPolarHBondContact O-CB 3.45Å; I56-A59 PolarHBondContact O-N 3.23Å; I56-W60 VanDerWaalsContact CG2-CD1 3.46Å; I56-W60 PolarHBondContact O-N 2.87Å
57	Q	75.9	Confident	72.9	Confident	130 Å²	130	94.2 Å²	94.2	61%	0.607	49%	0.493	S	S	*	.	H	α-helix	trans	-59.5	-37.4	178.2	-70.9	-76.9	65.7	0	0	112.6	L53 L54 G61	L53-Q57 WeakPolarHBondContact O-CB 3.36Å; L53-Q57 WeakPolarHBondContact O-CG 3.37Å; L53-Q57 PolarHBondContact O-N 3.3Å; L54-Q57 PolarHBondContact O-N 3.47Å; Q57-G61 WeakPolarHBondContact O-CA 3.35Å; Q57-G61 PolarHBondContact O-N 2.91Å
58	L	77.4	Confident	71.3	Confident	93 Å²	93	95.1 Å²	95.1	49%	0.487	50%	0.501	S	S	.	.	H	α-helix	trans	-68.8	-40.1	173.2	-75.5	164.3	0	0	0	111.6	L54 G55 I56 G61 F62	L54-L58 WeakPolarHBondContact O-CB 3.42Å; L54-L58 VanDerWaalsContact O-CG 3.3Å; L54-L58 WeakPolarHBondContact O-CG 3.49Å; L54-L58 PolarHBondContact O-N 2.81Å; G55-L58 PolarHBondContact O-N 2.84Å; I56-L58 VanDerWaalsContact C-N 3.28Å; I56-L58 PolarHBondContact O-N 3.48Å; L58-G61 PolarHBondContact O-N 3.4Å; L58-F62 HydrophobicContact CD2-CD2 4.39Å; L58-F62 HydrophobicContact CD2-CE2 4.23Å; L58-F62 WeakPolarHBondContact O-CB 3.3Å; L58-F62 PolarHBondContact O-N 2.91Å
59	A	76.4	Confident	69.8	Low	58 Å²	58	88.9 Å²	88.9	48%	0.479	49%	0.492	S	S	.	.	H	α-helix	trans	-62.8	-46.5	175.3	0	0	0	0	0	111.1	G55 I56 Y63	G55-A59 WeakPolarHBondContact O-CB 3.21Å; G55-A59 PolarHBondContact O-N 2.95Å; I56-A59 CarbonylContact O-C 3.6Å; I56-A59 WeakPolarHBondContact O-CA 3.46Å; I56-A59 WeakPolarHBondContact O-CB 3.45Å; I56-A59 PolarHBondContact O-N 3.23Å; A59-Y63 WeakPolarHBondContact O-CA 3.34Å; A59-Y63 WeakPolarHBondContact O-CB 3.33Å; A59-Y63 PolarHBondContact O-N 2.88Å
60	W	72.6	Confident	68.3	Low	189 Å²	189	90.3 Å²	90.3	72%	0.716	50%	0.499	S	S	*	.	H	α-helix	trans	-68.3	-34.4	173.4	-75	91.9	0	0	0	112.5	I56 G64	I56-W60 VanDerWaalsContact CG2-CD1 3.46Å; I56-W60 PolarHBondContact O-N 2.87Å; W60-G64 WeakPolarHBondContact O-CA 3.34Å; W60-G64 PolarHBondContact O-N 3.02Å
61	G	67.1	Low	66.6	Low	40 Å²	40	96.9 Å²	96.9	41%	0.412	52%	0.519	S	S	.	.	H	α-helix	trans	-68.8	-48.7	178.1	0	0	0	0	0	112.4	Q57 L58 N65	Q57-G61 WeakPolarHBondContact O-CA 3.35Å; Q57-G61 PolarHBondContact O-N 2.91Å; L58-G61 PolarHBondContact O-N 3.4Å; G61-N65 WeakPolarHBondContact O-CB 3Å; G61-N65 PolarHBondContact O-N 3.35Å
62	F	62	Low	64.9	Low	160 Å²	160	100.1 Å²	100.1	70%	0.702	53%	0.532	S	S	*	.	H	α-helix	trans	-73.3	-45.2	177.8	-90.5	-90.2	0	0	0	112.4	L58 T66	L58-F62 HydrophobicContact CD2-CD2 4.39Å; L58-F62 HydrophobicContact CD2-CE2 4.23Å; L58-F62 WeakPolarHBondContact O-CB 3.3Å; L58-F62 PolarHBondContact O-N 2.91Å; F62-T66 PolarHBondContact O-N 3.35Å; F62-T66 PolarHBondContact O-OG1 2.88Å
63	Y	56.9	Low	63	Low	183 Å²	183	106.9 Å²	106.9	72%	0.718	55%	0.548	S	S	*	.	H	α-helix	trans	-73.9	-44.1	-179.8	-151.9	-98.1	0	0	0	110.5	A59 T66 V67	A59-Y63 WeakPolarHBondContact O-CA 3.34Å; A59-Y63 WeakPolarHBondContact O-CB 3.33Å; A59-Y63 PolarHBondContact O-N 2.88Å; Y63-T66 WeakPolarHBondContact O-CB 3.39Å; Y63-T66 PolarHBondContact O-N 3.48Å; Y63-V67 WeakPolarHBondContact O-CG2 2.95Å; Y63-V67 PolarHBondContact O-N 2.84Å
64	G	54	Low	61.4	Low	22 Å²	22	107 Å²	107	23%	0.227	56%	0.556	C	S	.	*	H	α-helix	trans	-65.6	-41	176.9	0	0	0	0	0	113.7	W60 T66 V67 T68	W60-G64 WeakPolarHBondContact O-CA 3.34Å; W60-G64 PolarHBondContact O-N 3.02Å; G64-T66 PolarHBondContact O-N 2.86Å; G64-V67 CarbonylContact O-C 3.53Å; G64-V67 PolarHBondContact O-N 3.17Å; G64-T68 PolarHBondContact O-N 3.27Å; G64-T68 PolarHBondContact O-OG1 2.96Å
65	N	53.5	Low	59.8	Low	118 Å²	118	107.6 Å²	107.6	63%	0.631	58%	0.577	S	S	*	*	H	α-helix	trans	-62.8	-30.7	174.1	-175.2	63.7	0	0	0	112.4	G61 V67 G69	G61-N65 WeakPolarHBondContact O-CB 3Å; G61-N65 PolarHBondContact O-N 3.35Å; N65-V67 VanDerWaalsContact C-N 3.34Å; N65-G69 PolarHBondContact O-N 3.26Å
66	T	51.7	Low	58.2	Low	97 Å²	97	113.5 Å²	113.5	60%	0.595	60%	0.599	S	S	*	*	H	α-helix	trans	-68.2	-33.7	173.4	-53.4	0	0	0	0	111.5	F62 Y63 G64	F62-T66 PolarHBondContact O-N 3.35Å; F62-T66 PolarHBondContact O-OG1 2.88Å; Y63-T66 WeakPolarHBondContact O-CB 3.39Å; Y63-T66 PolarHBondContact O-N 3.48Å; G64-T66 PolarHBondContact O-N 2.86Å
67	V	47.7	Very low	56.6	Low	61 Å²	61	112.8 Å²	112.8	37%	0.37	61%	0.611	S	S	.	*	H	α-helix	trans	-82	-34.4	174.2	-163.1	0	0	0	0	112.1	Y63 G64 N65 G69 L70 Y71	Y63-V67 WeakPolarHBondContact O-CG2 2.95Å; Y63-V67 PolarHBondContact O-N 2.84Å; G64-V67 CarbonylContact O-C 3.53Å; G64-V67 PolarHBondContact O-N 3.17Å; N65-V67 VanDerWaalsContact C-N 3.34Å; V67-G69 VanDerWaalsContact C-N 3.32Å; V67-G69 PolarHBondContact O-N 3.08Å; V67-L70 WeakPolarHBondContact O-CB 3.46Å; V67-L70 PolarHBondContact O-N 3.47Å; V67-L70 VanDerWaalsContact O-N 3.08Å; V67-Y71 HydrophobicContact CG1-CD2 4.3Å; V67-Y71 HydrophobicContact CG1-CE2 3.75Å; V67-Y71 WeakPolarHBondContact O-CD2 3.15Å; V67-Y71 PolarHBondContact O-N 2.75Å
68	T	50	Low	55.4	Low	73 Å²	73	110.3 Å²	110.3	45%	0.448	62%	0.62	S	S	.	*	H	α-helix	trans	-68.8	-30.4	174.2	-48.2	0	0	0	0	111.7	G64 L70 Y71 H72	G64-T68 PolarHBondContact O-N 3.27Å; G64-T68 PolarHBondContact O-OG1 2.96Å; T68-L70 VanDerWaalsContact C-N 3.26Å; T68-L70 PolarHBondContact O-N 3.42Å; T68-Y71 PolarHBondContact O-N 3.01Å; T68-Y71 VanDerWaalsContact O-N 3.17Å; T68-H72 PolarHBondContact O-N 3.24Å
69	G	52.2	Low	54.1	Low	46 Å²	46	113.2 Å²	113.2	47%	0.474	63%	0.631	S	S	.	*	H	α-helix	trans	-65.8	-24.5	168.5	0	0	0	0	0	114	N65 V67 H72	N65-G69 PolarHBondContact O-N 3.26Å; V67-G69 VanDerWaalsContact C-N 3.32Å; V67-G69 PolarHBondContact O-N 3.08Å; G69-H72 CarbonylContact O-C 3.56Å
70	L	53.7	Low	52.8	Low	135 Å²	135	118.3 Å²	118.3	71%	0.707	65%	0.651	S	S	*	*	H	α-helix	trans	-76.8	-28.3	170.9	-80.4	156.7	0	0	0	112.3	V67 T68	V67-L70 WeakPolarHBondContact O-CB 3.46Å; V67-L70 PolarHBondContact O-N 3.47Å; V67-L70 VanDerWaalsContact O-N 3.08Å; T68-L70 VanDerWaalsContact C-N 3.26Å; T68-L70 PolarHBondContact O-N 3.42Å
71	Y	49.1	Very low	51.9	Low	197 Å²	197	113 Å²	113	77%	0.773	65%	0.654	S	S	*	*	H	α-helix	trans	-85.5	-29.8	174.6	-68.7	-69.9	0	0	0	113.4	V67 T68 R73	V67-Y71 HydrophobicContact CG1-CD2 4.3Å; V67-Y71 HydrophobicContact CG1-CE2 3.75Å; V67-Y71 WeakPolarHBondContact O-CD2 3.15Å; V67-Y71 PolarHBondContact O-N 2.75Å; T68-Y71 PolarHBondContact O-N 3.01Å; T68-Y71 VanDerWaalsContact O-N 3.17Å; Y71-R73 PolarHBondContact O-N 3.29Å
72	H	47.4	Very low	50.8	Low	151 Å²	151	115.1 Å²	115.1	70%	0.699	66%	0.663	S	S	*	*			trans	-97.9	60.6	170.6	-89.5	-55.5	0	0	0	110.9	T68 G69 P74	T68-H72 PolarHBondContact O-N 3.24Å; G69-H72 CarbonylContact O-C 3.56Å; H72-P74 WeakPolarHBondContact O-CD 3.41Å
73	R	46.6	Very low	50.1	Low	200 Å²	200	112.4 Å²	112.4	76%	0.755	66%	0.66	S	S	*	*			trans	-65.4	109.7	156.5	-173.5	178	-173.6	-165.3	1.2	106.7	Y71 G75	Y71-R73 PolarHBondContact O-N 3.29Å; R73-G75 PolarHBondContact O-N 2.72Å
74	P	50.2	Low	49.5	Very low	111 Å²	111	109.9 Å²	109.9	72%	0.721	67%	0.666	S	S	*	*			trans	-63.4	126.5	165.7	-9	28.2	0	0	0	105.3	H72 L76	H72-P74 WeakPolarHBondContact O-CD 3.41Å; P74-L76 PolarHBondContact O-N 3.25Å
75	G	49.5	Very low	49.4	Very low	77 Å²	77	115.5 Å²	115.5	79%	0.794	69%	0.69	S	S	*	*			trans	-55.2	104.6	-179.2	0	0	0	0	0	111	R73	R73-G75 PolarHBondContact O-N 2.72Å
76	L	48.2	Very low	49.2	Very low	163 Å²	163	113.1 Å²	113.1	85%	0.853	69%	0.694	S	S	*	*	S	Bend	trans	-92.6	84.3	155.3	-160.3	84	0	0	0	106.1	P74	P74-L76 PolarHBondContact O-N 3.25Å
77	G	47.3	Very low	49.1	Very low	65 Å²	65	113.8 Å²	113.8	67%	0.67	70%	0.702	S	S	*	*			trans	150.8	66.7	-179.7	0	0	0	0	0	112.4	Q79	G77-Q79 PolarHBondContact O-N 2.88Å
78	G	49.3	Very low	49.2	Very low	77 Å²	77	117.3 Å²	117.3	79%	0.794	72%	0.724	S	S	*	*			trans	-59.4	105.6	155.5	0	0	0	0	0	108.4
79	Q	51.8	Low	49.3	Very low	155 Å²	155	121.5 Å²	121.5	72%	0.724	74%	0.738	S	S	*	*			trans	-139.2	73.6	158.5	-165.5	175.4	87.1	0	0	107.4	G77 G81	G77-Q79 PolarHBondContact O-N 2.88Å; Q79-G81 PolarHBondContact O-N 3.47Å
80	N	48.5	Very low	49	Very low	165 Å²	165	127.3 Å²	127.3	88%	0.882	75%	0.751	S	S	*	*			trans	-70.8	119.9	161.3	-45.4	-31.8	0	0	0	106
81	G	52.7	Low	48.7	Very low	76 Å²	76	126.6 Å²	126.6	78%	0.784	75%	0.754	S	S	*	*			trans	104.7	48.8	158.4	0	0	0	0	0	118.2	Q79	Q79-G81 PolarHBondContact O-N 3.47Å
82	S	43.8	Very low	48.5	Very low	86 Å²	86	119.8 Å²	119.8	60%	0.601	74%	0.735	S	S	*	*			trans	-121	107.1	155.3	-56.6	0	0	0	0	108.5
83	T	48.3	Very low	48.6	Very low	103 Å²	103	122.9 Å²	122.9	63%	0.632	74%	0.741	S	S	*	*			trans	-32.1	132.1	156.2	-46.4	0	0	0	0	110	D85	T83-D85 VanDerWaalsContact CG2-OD1 3.31Å; T83-D85 WeakPolarHBondContact CG2-OD1 3.31Å; T83-D85 PolarHBondContact O-N 3.07Å
84	P	45.1	Very low	48.9	Very low	130 Å²	130	120 Å²	120	84%	0.844	74%	0.736	S	S	*	*			trans	-68.8	84.9	165.7	-7.8	23.3	0	0	0	107.3	G86	P84-G86 PolarHBondContact O-N 2.79Å
85	D	50.7	Low	48.9	Very low	140 Å²	140	123 Å²	123	75%	0.749	74%	0.743	S	S	*	*			trans	-69.2	104.5	167.3	-64.2	-27.1	0	0	0	106.8	T83	T83-D85 VanDerWaalsContact CG2-OD1 3.31Å; T83-D85 WeakPolarHBondContact CG2-OD1 3.31Å; T83-D85 PolarHBondContact O-N 3.07Å
86	G	50.2	Low	48.7	Very low	68 Å²	68	123.7 Å²	123.7	70%	0.701	74%	0.74	S	S	*	*	S	Bend	trans	45.2	99.4	149.9	0	0	0	0	0	117.6	P84	P84-G86 PolarHBondContact O-N 2.79Å
87	S	49.7	Very low	48.9	Very low	110 Å²	110	120 Å²	120	77%	0.769	73%	0.734	S	S	*	*				179.8	100	113.3	56.8	0	0	0	0	109	H89	S87-H89 PolarHBondContact O-N 2.81Å
88	T	48.8	Very low	49.2	Very low	135 Å²	135	124.3 Å²	124.3	83%	0.828	74%	0.742	S	S	*	*			trans	-64.3	75.9	165	-36.7	0	0	0	0	108.8	F90	T88-F90 VanDerWaalsContact C-N 3.28Å; T88-F90 HydrophobicContact CG2-CD2 4.3Å; T88-F90 PolarHBondContact O-N 3.33Å
89	H	52.7	Low	49	Very low	161 Å²	161	129 Å²	129	75%	0.745	74%	0.743	S	S	*	*			trans	-90.5	77.7	163.9	140.6	-94.9	0	0	0	106.6	S87	S87-H89 PolarHBondContact O-N 2.81Å
90	F	45.4	Very low	49	Very low	169 Å²	169	127.1 Å²	127.1	74%	0.741	74%	0.744	S	S	*	*			trans	-108.8	129.5	150	-76.7	-83.4	0	0	0	104.5	T88 S92	T88-F90 VanDerWaalsContact C-N 3.28Å; T88-F90 HydrophobicContact CG2-CD2 4.3Å; T88-F90 PolarHBondContact O-N 3.33Å; F90-S92 PolarHBondContact O-N 3.22Å
91	P	47.4	Very low	49	Very low	119 Å²	119	126.8 Å²	126.8	77%	0.773	74%	0.741	S	S	*	*			trans	-67.6	92.3	170.5	28.6	-30.5	0	0	0	106.4	W93	P91-W93 PolarHBondContact O-N 2.78Å
92	S	44.8	Very low	49	Very low	55 Å²	55	132.4 Å²	132.4	39%	0.385	74%	0.744	S	S	.	*			trans	-65.5	120.7	172.8	-169.6	0	0	0	0	107.3	F90 E94	F90-S92 PolarHBondContact O-N 3.22Å; S92-E94 VanDerWaalsContact CB-OE2 3.25Å; S92-E94 WeakPolarHBondContact CB-OE2 3.25Å; S92-E94 PolarHBondContact O-N 3.41Å; S92-E94 PolarHBondContact OG-OE2 2.77Å
93	W	50.8	Low	49.3	Very low	216 Å²	216	135.3 Å²	135.3	82%	0.818	76%	0.758	S	S	*	*	G	3₁₀ helix	trans	-47.9	3.7	169.6	69.6	-59.9	0	0	0	116	P91 M95 A96	P91-W93 PolarHBondContact O-N 2.78Å; W93-M95 VanDerWaalsContact C-N 3.31Å; W93-M95 PolarHBondContact O-N 3.48Å; W93-A96 PolarHBondContact O-N 2.5Å
94	E	52.5	Low	49	Very low	140 Å²	140	138.6 Å²	138.6	65%	0.654	77%	0.766	S	S	*	*	G	3₁₀ helix	trans	-76.2	-5.9	179.7	-74.1	158.9	149.4	0	0	114.6	S92	S92-E94 VanDerWaalsContact CB-OE2 3.25Å; S92-E94 WeakPolarHBondContact CB-OE2 3.25Å; S92-E94 PolarHBondContact O-N 3.41Å; S92-E94 PolarHBondContact OG-OE2 2.77Å
95	M	50.3	Low	49	Very low	174 Å²	174	143.7 Å²	143.7	86%	0.857	77%	0.769	S	S	*	*	G	3₁₀ helix	trans	-83.9	-13.7	170.6	-91.2	-159.3	-177.7	0	0	114.5	W93 A97	W93-M95 VanDerWaalsContact C-N 3.31Å; W93-M95 PolarHBondContact O-N 3.48Å; M95-A97 PolarHBondContact O-N 3.33Å
96	A	45.7	Very low	48.7	Very low	90 Å²	90	148.5 Å²	148.5	74%	0.744	79%	0.787	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.7	-8.7	177.6	0	0	0	0	0	113.5	W93	W93-A96 PolarHBondContact O-N 2.5Å
97	A	50.9	Low	48.6	Very low	87 Å²	87	152.5 Å²	152.5	72%	0.719	79%	0.791	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.8	-5.3	179.1	0	0	0	0	0	113.9	M95	M95-A97 PolarHBondContact O-N 3.33Å
98	N	53	Low	48.6	Very low	155 Å²	155	154.7 Å²	154.7	83%	0.829	79%	0.792	S	S	*	*			trans	-124.8	40.9	-171.7	-117.3	30.6	0	0	0	113.4
99	E	45.3	Very low	48.6	Very low	175 Å²	175	155.8 Å²	155.8	82%	0.818	79%	0.79	S	S	*	*			trans	-86.8	134.1	159	-79.2	-155.1	89.9	0	0	111.3	L101	E99-L101 PolarHBondContact O-N 3.48Å
100	P	52.3	Low	48.3	Very low	115 Å²	115	155.5 Å²	155.5	75%	0.747	79%	0.793	S	S	*	*			trans	-87.4	110.8	-168.2	34.1	-31.3	0	0	0	110.7
101	L	48.5	Very low	48.5	Very low	159 Å²	159	154.7 Å²	154.7	83%	0.832	80%	0.796	S	S	*	*			trans	-146.2	81.6	176.2	-149.4	81.5	0	0	0	114	E99	E99-L101 PolarHBondContact O-N 3.48Å
102	K	52.3	Low	48.6	Very low	194 Å²	194	157.1 Å²	157.1	84%	0.843	80%	0.797	S	S	*	*				166.7	107.2	123.2	-95.2	171.1	170.3	168.9	0	110.8	H104	K102-H104 PolarHBondContact O-N 3.17Å
103	T	51.2	Low	48.9	Very low	146 Å²	146	164.4 Å²	164.4	90%	0.896	83%	0.827	S	S	*	*			trans	-59.4	108.2	157.6	36.5	0	0	0	0	109.7
104	H	40.8	Very low	48.7	Very low	173 Å²	173	160.4 Å²	160.4	80%	0.801	83%	0.827	S	S	*	*			trans	-78.3	112.2	161	-167.4	-90.4	0	0	0	106.9	K102	K102-H104 PolarHBondContact O-N 3.17Å
105	R	46.8	Very low	48.4	Very low	237 Å²	237	162.1 Å²	162.1	89%	0.894	84%	0.842	S	S	*	*			trans	-104.1	122.5	171.3	-157.3	-176.5	-170.8	111.8	0.5	107
106	E	43.5	Very low	48.2	Very low	240 Å²	240	161 Å²	161	100%	1.122	84%	0.84	S	S	*	*			trans	-69.4	0	167.9	-55.5	-179.6	178.7	0	0	111

Retrieved 106 of 106 residues in 395.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).