A0A096N4E8_PAPAN Loading...

Complex III assembly factor LYRM7

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane.

AlphaFold DB (A0A2I3MRM7), UniProt , Accession A0A096N4E8, Species PAPAN (Papio anubis, Olive baboon), Gene LYRM7, Length 104 aa.

						>A0A096N4E8_PAPAN|A0A096N4E8|LYRM7
MAQAAKVLQLFKTLHRTRQQVFKNDVRALEAARIKINEEFKNNKSETSPKKIEELMKIGSDVELLLRTSVIQGIHTDQNTLKLVPRKDLLVENVPYCDAPTQKQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58	Low	90	Very high	221 Å²	221	87.5 Å²	87.5	100%	1.089	48%	0.483	S	S	*	.				0	-58.5	0	-66.1	-71.6	-101.6	0	0	112.4	Q3 A5	M1-Q3 PolarHBondContact O-N 3.05Å; M1-A5 PolarHBondContact O-N 3.05Å
2	A	79.8	Confident	90.7	Very high	72 Å²	72	90.4 Å²	90.4	60%	0.595	49%	0.488	S	S	*	.	H	α-helix	trans	-62.7	-37.2	-175.6	0	0	0	0	0	115.2	A5 K6	A2-A5 PolarHBondContact O-N 3.12Å; A2-K6 WeakPolarHBondContact O-CG 3.48Å; A2-K6 PolarHBondContact O-N 3.49Å
3	Q	84	Confident	91.3	Very high	82 Å²	82	86.1 Å²	86.1	38%	0.383	47%	0.466	S	S	.	.	H	α-helix	trans	-68.7	-45.9	-176.8	-167	178.7	37.5	0	0	112.7	M1 A5 K6 V7 I52	M1-Q3 PolarHBondContact O-N 3.05Å; Q3-A5 VanDerWaalsContact C-N 3.27Å; Q3-A5 PolarHBondContact O-N 2.96Å; Q3-K6 WeakPolarHBondContact O-CB 3.26Å; Q3-K6 PolarHBondContact O-N 2.83Å; Q3-K6 VanDerWaalsContact O-N 3.1Å; Q3-V7 WeakPolarHBondContact O-CG2 3.43Å; Q3-V7 PolarHBondContact O-N 3.02Å; Q3-I52 HydrophobicContact CG-CG2 4.16Å
4	A	88.8	Confident	91.8	Very high	62 Å²	62	80.6 Å²	80.6	51%	0.512	44%	0.436	S	S	.	.	H	α-helix	trans	-60.2	-38.1	176.9	0	0	0	0	0	112.2	V7 L8	A4-V7 PolarHBondContact O-N 3.46Å; A4-L8 WeakPolarHBondContact O-CG 3.27Å; A4-L8 PolarHBondContact O-N 2.84Å
5	A	95	Very high	92.2	Very high	60 Å²	60	77.1 Å²	77.1	50%	0.496	42%	0.416	S	S	.	.	H	α-helix	trans	-62.5	-42.7	174.5	0	0	0	0	0	112.1	M1 A2 Q3 L8 Q9	M1-A5 PolarHBondContact O-N 3.05Å; A2-A5 PolarHBondContact O-N 3.12Å; Q3-A5 VanDerWaalsContact C-N 3.27Å; Q3-A5 PolarHBondContact O-N 2.96Å; A5-L8 PolarHBondContact O-N 3.32Å; A5-Q9 WeakPolarHBondContact O-CB 3.15Å; A5-Q9 PolarHBondContact O-N 2.65Å
6	K	96.1	Very high	92.6	Very high	125 Å²	125	79.8 Å²	79.8	54%	0.543	42%	0.418	S	S	.	.	H	α-helix	trans	-62.9	-42.9	176	-71.2	-179.6	179.7	-173.3	0	112.4	A2 Q3 L8 Q9 L10 M56	A2-K6 WeakPolarHBondContact O-CG 3.48Å; A2-K6 PolarHBondContact O-N 3.49Å; Q3-K6 WeakPolarHBondContact O-CB 3.26Å; Q3-K6 PolarHBondContact O-N 2.83Å; Q3-K6 VanDerWaalsContact O-N 3.1Å; K6-L8 PolarHBondContact O-N 3.25Å; K6-Q9 WeakPolarHBondContact O-CB 3.47Å; K6-Q9 PolarHBondContact O-N 2.98Å; K6-L10 PolarHBondContact O-N 3.16Å; K6-M56 HydrophobicContact CB-SD 4.02Å
7	V	96.9	Very high	92.9	Very high	40 Å²	40	75.3 Å²	75.3	24%	0.242	40%	0.395	C	S	.	.	H	α-helix	trans	-60.4	-47.2	176.5	174.6	0	0	0	0	110.9	Q3 A4 Q9 L10 F11 F40 I52 M56	Q3-V7 WeakPolarHBondContact O-CG2 3.43Å; Q3-V7 PolarHBondContact O-N 3.02Å; A4-V7 PolarHBondContact O-N 3.46Å; V7-Q9 VanDerWaalsContact C-N 3.32Å; V7-Q9 PolarHBondContact O-N 3.37Å; V7-L10 PolarHBondContact O-N 3.39Å; V7-F11 PolarHBondContact O-N 2.99Å; V7-F40 HydrophobicContact CG1-CD1 4.25Å; V7-F40 HydrophobicContact CG1-CE1 3.9Å; V7-I52 HydrophobicContact CG2-CG2 4.16Å; V7-M56 HydrophobicContact CG2-CG 4.01Å; V7-M56 HydrophobicContact CG2-SD 3.65Å
8	L	96.6	Very high	93.2	Very high	102 Å²	102	72.3 Å²	72.3	53%	0.534	38%	0.378	S	S	.	.	H	α-helix	trans	-66.5	-33.9	177.6	-70.3	176.2	0	0	0	112.7	A4 A5 K6 K12	A4-L8 WeakPolarHBondContact O-CG 3.27Å; A4-L8 PolarHBondContact O-N 2.84Å; A5-L8 PolarHBondContact O-N 3.32Å; K6-L8 PolarHBondContact O-N 3.25Å; L8-K12 WeakPolarHBondContact O-CG 3.48Å; L8-K12 PolarHBondContact O-N 3.44Å
9	Q	97.9	Very high	93.4	Very high	124 Å²	124	74.2 Å²	74.2	58%	0.579	38%	0.384	S	S	*	.	H	α-helix	trans	-62.8	-47.4	173.9	-177.7	179.6	-6.1	0	0	110.7	A5 K6 V7 K12 T13	A5-Q9 WeakPolarHBondContact O-CB 3.15Å; A5-Q9 PolarHBondContact O-N 2.65Å; K6-Q9 WeakPolarHBondContact O-CB 3.47Å; K6-Q9 PolarHBondContact O-N 2.98Å; V7-Q9 VanDerWaalsContact C-N 3.32Å; V7-Q9 PolarHBondContact O-N 3.37Å; Q9-K12 PolarHBondContact O-N 3.42Å; Q9-T13 PolarHBondContact O-N 2.86Å; Q9-T13 PolarHBondContact O-OG1 3.19Å
10	L	98.3	Very high	93.6	Very high	19 Å²	19	76.6 Å²	76.6	10%	0.099	39%	0.393	C	S	.	.	H	α-helix	trans	-60.5	-45.8	177	179	58.6	0	0	0	111.8	K6 V7 K12 T13 L14 F40 M56	K6-L10 PolarHBondContact O-N 3.16Å; V7-L10 PolarHBondContact O-N 3.39Å; L10-K12 VanDerWaalsContact C-N 3.33Å; L10-K12 PolarHBondContact O-N 2.9Å; L10-T13 PolarHBondContact O-N 3.43Å; L10-T13 VanDerWaalsContact O-N 3.11Å; L10-L14 HydrophobicContact CD1-CD1 4.29Å; L10-L14 HydrophobicContact CD1-CG 4.31Å; L10-L14 HydrophobicContact CG-CD1 4.21Å; L10-L14 PolarHBondContact O-N 3.5Å; L10-F40 HydrophobicContact CG-CZ 4.41Å; L10-M56 HydrophobicContact CD2-CB 4.26Å; L10-M56 HydrophobicContact CD2-CG 4.45Å; L10-M56 WeakPolarHBondContact CD2-O 3.31Å
11	F	98.3	Very high	93.7	Very high	55 Å²	55	73 Å²	73	24%	0.241	38%	0.375	C	S	.	.	H	α-helix	trans	-53.6	-48.6	174.6	-179.8	-104	0	0	0	112.2	V7 H15 I36 N37 F40	V7-F11 PolarHBondContact O-N 2.99Å; F11-H15 AromaticContact CE1-CD2 3.6Å; F11-H15 AromaticContact CE1-NE2 3.85Å; F11-H15 AromaticContact CE2-CD2 3.92Å; F11-H15 AromaticContact CE2-NE2 3.61Å; F11-H15 AromaticContact CZ-CD2 3.5Å; F11-H15 AromaticContact CZ-NE2 3.25Å; F11-H15 VanDerWaalsContact CZ-NE2 3.25Å; F11-H15 WeakPolarHBondContact CZ-NE2 3.38Å; F11-H15 PolarHBondContact O-N 3.36Å; F11-H15 VanDerWaalsContact O-N 3.17Å; F11-I36 HydrophobicContact CD2-CG2 3.94Å; F11-I36 HydrophobicContact CE2-CG2 3.81Å; F11-N37 WeakPolarHBondContact CE2-OD1 3.27Å; F11-N37 VanDerWaalsContact CZ-OD1 3.3Å; F11-N37 WeakPolarHBondContact CZ-OD1 3.32Å; F11-F40 HydrophobicContact CB-CD1 4.11Å; F11-F40 HydrophobicContact CB-CE1 3.61Å; F11-F40 HydrophobicContact CB-CE2 4.48Å; F11-F40 HydrophobicContact CB-CZ 3.81Å; F11-F40 HydrophobicContact CD2-CB 4.2Å; F11-F40 AromaticContact CD2-CD1 3.76Å; F11-F40 HydrophobicContact CD2-CD1 3.76Å; F11-F40 AromaticContact CD2-CD2 3.72Å; F11-F40 HydrophobicContact CD2-CD2 3.72Å; F11-F40 AromaticContact CD2-CE1 3.99Å; F11-F40 HydrophobicContact CD2-CE1 3.99Å; F11-F40 AromaticContact CD2-CE2 3.93Å; F11-F40 HydrophobicContact CD2-CE2 3.93Å; F11-F40 AromaticContact CD2-CG 3.61Å; F11-F40 HydrophobicContact CD2-CG 3.61Å; F11-F40 HydrophobicContact CD2-CZ 4.05Å; F11-F40 HydrophobicContact CE2-CB 4.34Å; F11-F40 HydrophobicContact CE2-CD2 4.33Å; F11-F40 HydrophobicContact CE2-CG 4.2Å; F11-F40 HydrophobicContact CG-CD1 4.31Å; F11-F40 HydrophobicContact CG-CE1 4.26Å; F11-F40 HydrophobicContact CG-CZ 4.46Å
12	K	98.4	Very high	95.6	Very high	123 Å²	123	64.1 Å²	64.1	54%	0.535	33%	0.331	S	S	.	.	H	α-helix	trans	-65.5	-38.7	177.1	-71.4	175.5	-178	-179.3	0	112.1	L8 Q9 L10 H15 R16	L8-K12 WeakPolarHBondContact O-CG 3.48Å; L8-K12 PolarHBondContact O-N 3.44Å; Q9-K12 PolarHBondContact O-N 3.42Å; L10-K12 VanDerWaalsContact C-N 3.33Å; L10-K12 PolarHBondContact O-N 2.9Å; K12-H15 PolarHBondContact O-N 3.18Å; K12-R16 WeakPolarHBondContact O-CG 3.46Å; K12-R16 PolarHBondContact O-N 3.49Å
13	T	98.5	Very high	96.3	Very high	34 Å²	34	67 Å²	67	21%	0.209	33%	0.33	C	S	.	.	H	α-helix	trans	-64.1	-50.4	178.4	-60.8	0	0	0	0	110.7	Q9 L10 H15 R16 T17 E63	Q9-T13 PolarHBondContact O-N 2.86Å; Q9-T13 PolarHBondContact O-OG1 3.19Å; L10-T13 PolarHBondContact O-N 3.43Å; L10-T13 VanDerWaalsContact O-N 3.11Å; T13-H15 PolarHBondContact O-N 3.05Å; T13-R16 WeakPolarHBondContact O-CA 3.46Å; T13-R16 WeakPolarHBondContact O-CB 3.48Å; T13-R16 PolarHBondContact O-N 2.72Å; T13-R16 PolarHBondContact OG1-NH2 3.11Å; T13-T17 PolarHBondContact O-N 3.5Å; T13-T17 PolarHBondContact O-OG1 2.86Å; T13-E63 HydrophobicContact CG2-CG 3.63Å
14	L	98.5	Very high	96.9	Very high	9 Å²	9	69.9 Å²	69.9	5%	0.047	35%	0.348	C	S	.	.	H	α-helix	trans	-54.1	-41	175.3	-77.8	166.5	0	0	0	112.4	L10 T17 R18 I36 F40 V62 E63	L10-L14 HydrophobicContact CD1-CD1 4.29Å; L10-L14 HydrophobicContact CD1-CG 4.31Å; L10-L14 HydrophobicContact CG-CD1 4.21Å; L10-L14 PolarHBondContact O-N 3.5Å; L14-T17 PolarHBondContact O-N 3.03Å; L14-R18 WeakPolarHBondContact O-CG 3.45Å; L14-R18 PolarHBondContact O-N 3.47Å; L14-I36 HydrophobicContact CB-CD1 4.02Å; L14-I36 HydrophobicContact CB-CG1 4.41Å; L14-I36 HydrophobicContact CB-CG2 4.46Å; L14-F40 HydrophobicContact CD1-CE2 3.87Å; L14-F40 HydrophobicContact CD1-CZ 4.18Å; L14-V62 HydrophobicContact CD2-CG1 4.16Å; L14-E63 HydrophobicContact CD2-CB 3.79Å; L14-E63 HydrophobicContact CD2-CG 4.36Å; L14-E63 HydrophobicContact CG-CB 4.41Å
15	H	98.6	Very high	97.2	Very high	29 Å²	29	70 Å²	70	13%	0.134	34%	0.339	C	S	.	.	H	α-helix	trans	-67.7	-33.2	175.9	-87.6	-44.8	0	0	0	114.6	F11 K12 T13 R18 Q19 N37	F11-H15 AromaticContact CE1-CD2 3.6Å; F11-H15 AromaticContact CE1-NE2 3.85Å; F11-H15 AromaticContact CE2-CD2 3.92Å; F11-H15 AromaticContact CE2-NE2 3.61Å; F11-H15 AromaticContact CZ-CD2 3.5Å; F11-H15 AromaticContact CZ-NE2 3.25Å; F11-H15 VanDerWaalsContact CZ-NE2 3.25Å; F11-H15 WeakPolarHBondContact CZ-NE2 3.38Å; F11-H15 PolarHBondContact O-N 3.36Å; F11-H15 VanDerWaalsContact O-N 3.17Å; K12-H15 PolarHBondContact O-N 3.18Å; T13-H15 PolarHBondContact O-N 3.05Å; H15-R18 PolarHBondContact ND1-NE 3.41Å; H15-R18 VanDerWaalsContact O-CG 3.25Å; H15-R18 WeakPolarHBondContact O-CG 3.35Å; H15-Q19 WeakPolarHBondContact O-CG 3.33Å; H15-N37 PolarHBondContact NE2-OD1 3.11Å
16	R	98.4	Very high	97.3	Very high	119 Å²	119	72.6 Å²	72.6	45%	0.449	35%	0.349	S	S	.	.	H	α-helix	trans	-71.2	-43.5	171.4	-72.5	-178.3	-68.1	-106	-1.8	110.9	K12 T13 R18 Q19 Q20	K12-R16 WeakPolarHBondContact O-CG 3.46Å; K12-R16 PolarHBondContact O-N 3.49Å; T13-R16 WeakPolarHBondContact O-CA 3.46Å; T13-R16 WeakPolarHBondContact O-CB 3.48Å; T13-R16 PolarHBondContact O-N 2.72Å; T13-R16 PolarHBondContact OG1-NH2 3.11Å; R16-R18 PolarHBondContact O-N 3.01Å; R16-Q19 WeakPolarHBondContact O-CB 3.4Å; R16-Q19 PolarHBondContact O-N 3.43Å; R16-Q19 VanDerWaalsContact O-N 3.13Å; R16-Q20 PolarHBondContact O-N 2.98Å; R16-Q20 VanDerWaalsContact O-N 3.11Å
17	T	97.9	Very high	97.4	Very high	4 Å²	4	77 Å²	77	3%	0.025	36%	0.363	C	S	.	.	H	α-helix	trans	-60	-47	179.8	-55.5	0	0	0	0	110.5	T13 L14 Q19 Q20 V21 E63 L66 R67	T13-T17 PolarHBondContact O-N 3.5Å; T13-T17 PolarHBondContact O-OG1 2.86Å; L14-T17 PolarHBondContact O-N 3.03Å; T17-Q19 VanDerWaalsContact C-N 3.29Å; T17-Q19 PolarHBondContact O-N 2.94Å; T17-Q20 PolarHBondContact O-N 3.47Å; T17-Q20 VanDerWaalsContact O-N 3.15Å; T17-V21 HydrophobicContact CG2-CG2 3.89Å; T17-V21 WeakPolarHBondContact O-CB 3.37Å; T17-V21 WeakPolarHBondContact O-CG2 3.23Å; T17-V21 PolarHBondContact O-N 3.1Å; T17-E63 HydrophobicContact CG2-CG 4.42Å; T17-E63 PolarHBondContact OG1-OE1 3.24Å; T17-L66 HydrophobicContact CG2-CB 3.84Å; T17-R67 HydrophobicContact CG2-CB 4.21Å
18	R	97.8	Very high	97.4	Very high	22 Å²	22	76.2 Å²	76.2	8%	0.083	36%	0.36	C	S	.	.	H	α-helix	trans	-60.4	-35.3	176	67.2	129.5	-166.1	155.4	1	113.6	L14 H15 R16 Q20 F22 L29 A32 I36	L14-R18 WeakPolarHBondContact O-CG 3.45Å; L14-R18 PolarHBondContact O-N 3.47Å; H15-R18 PolarHBondContact ND1-NE 3.41Å; H15-R18 VanDerWaalsContact O-CG 3.25Å; H15-R18 WeakPolarHBondContact O-CG 3.35Å; R16-R18 PolarHBondContact O-N 3.01Å; R18-Q20 VanDerWaalsContact C-N 3.33Å; R18-F22 HydrophobicContact CB-CD2 4Å; R18-F22 HydrophobicContact CB-CE2 4.3Å; R18-F22 WeakPolarHBondContact O-CB 3.37Å; R18-F22 WeakPolarHBondContact O-CD2 3.45Å; R18-F22 PolarHBondContact O-N 3.36Å; R18-L29 PolarHBondContact NH1-O 3.37Å; R18-L29 WeakPolarHBondContact O-CD2 3.37Å; R18-A32 HydrophobicContact CB-CB 3.95Å; R18-A32 HydrophobicContact CG-CB 4.47Å; R18-I36 HydrophobicContact CB-CD1 4.43Å; R18-I36 HydrophobicContact CG-CD1 4.09Å
19	Q	97.8	Very high	97.5	Very high	107 Å²	107	73 Å²	73	50%	0.5	34%	0.343	S	S	.	.	H	α-helix	trans	-67.6	-35.9	178.4	-74.8	176.1	-3.9	0	0	112	H15 R16 T17	H15-Q19 WeakPolarHBondContact O-CG 3.33Å; R16-Q19 WeakPolarHBondContact O-CB 3.4Å; R16-Q19 PolarHBondContact O-N 3.43Å; R16-Q19 VanDerWaalsContact O-N 3.13Å; T17-Q19 VanDerWaalsContact C-N 3.29Å; T17-Q19 PolarHBondContact O-N 2.94Å
20	Q	96	Very high	97.5	Very high	122 Å²	122	71.2 Å²	71.2	57%	0.57	33%	0.334	S	S	*	.	H	α-helix	trans	-76.5	-42.9	176.8	-66.6	177.1	-2.3	0	0	111.6	R16 T17 R18	R16-Q20 PolarHBondContact O-N 2.98Å; R16-Q20 VanDerWaalsContact O-N 3.11Å; T17-Q20 PolarHBondContact O-N 3.47Å; T17-Q20 VanDerWaalsContact O-N 3.15Å; R18-Q20 VanDerWaalsContact C-N 3.33Å
21	V	96.3	Very high	97.5	Very high	2 Å²	2	73.1 Å²	73.1	1%	0.012	35%	0.353	C	S	.	.	H	α-helix	trans	-70.9	-44.9	-174.5	171.8	0	0	0	0	111.9	T17 L66 V70 Q72	T17-V21 HydrophobicContact CG2-CG2 3.89Å; T17-V21 WeakPolarHBondContact O-CB 3.37Å; T17-V21 WeakPolarHBondContact O-CG2 3.23Å; T17-V21 PolarHBondContact O-N 3.1Å; V21-L66 HydrophobicContact CG2-CB 4.25Å; V21-L66 VanDerWaalsContact CG2-O 3.29Å; V21-L66 WeakPolarHBondContact CG2-O 3.27Å; V21-V70 HydrophobicContact CG1-CB 3.81Å; V21-V70 HydrophobicContact CG1-CG1 3.56Å; V21-Q72 VanDerWaalsContact O-CG 3.27Å; V21-Q72 WeakPolarHBondContact O-CG 3.5Å; V21-Q72 PolarHBondContact O-NE2 3.38Å; V21-Q72 VanDerWaalsContact O-NE2 3.11Å
22	F	96.8	Very high	97.5	Very high	35 Å²	35	71.4 Å²	71.4	15%	0.154	35%	0.349	C	S	.	.	T	Hydrogen-bonded Turn	trans	-103.2	31.4	-177.4	-54.1	-60.5	0	0	0	112.4	R18 N24 D25 A28 L29 A32 L66 V70	R18-F22 HydrophobicContact CB-CD2 4Å; R18-F22 HydrophobicContact CB-CE2 4.3Å; R18-F22 WeakPolarHBondContact O-CB 3.37Å; R18-F22 WeakPolarHBondContact O-CD2 3.45Å; R18-F22 PolarHBondContact O-N 3.36Å; F22-N24 PolarHBondContact O-N 3.13Å; F22-D25 HydrophobicContact CB-CB 4.46Å; F22-D25 PolarHBondContact O-N 3.46Å; F22-A28 HydrophobicContact CB-CB 3.95Å; F22-A28 HydrophobicContact CD1-CB 3.68Å; F22-A28 HydrophobicContact CD2-CB 4.45Å; F22-A28 HydrophobicContact CE1-CB 4.3Å; F22-A28 HydrophobicContact CG-CB 3.78Å; F22-L29 HydrophobicContact CB-CD2 3.95Å; F22-L29 HydrophobicContact CB-CG 3.97Å; F22-L29 WeakPolarHBondContact O-CD1 3.47Å; F22-L29 VanDerWaalsContact O-CG 3.26Å; F22-L29 WeakPolarHBondContact O-CG 3.25Å; F22-A32 HydrophobicContact CD2-CB 4.13Å; F22-A32 HydrophobicContact CE2-CB 3.96Å; F22-L66 HydrophobicContact CE2-CD2 4.31Å; F22-L66 HydrophobicContact CZ-CD2 4Å; F22-V70 HydrophobicContact CE1-CG1 4.04Å
23	K	95.5	Very high	97.5	Very high	133 Å²	133	71.1 Å²	71.1	58%	0.578	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56	126.8	-176.4	-174.5	179.6	-179.8	-178.9	0	110.3	D25 Q72	K23-D25 PolarHBondContact O-N 3.11Å; K23-Q72 PolarHBondContact O-NE2 2.9Å; K23-Q72 VanDerWaalsContact O-NE2 3.16Å; K23-Q72 PolarHBondContact O-OE1 2.8Å
24	N	95.8	Very high	97.5	Very high	142 Å²	142	74 Å²	74	76%	0.759	36%	0.358	S	S	*	.	T	Hydrogen-bonded Turn	trans	69.8	1.1	-177.2	-52.5	-28.6	0	0	0	116	F22 V26	F22-N24 PolarHBondContact O-N 3.13Å; N24-V26 PolarHBondContact O-N 3.17Å
25	D	96.6	Very high	97.5	Very high	63 Å²	63	78.6 Å²	78.6	34%	0.337	38%	0.377	S	S	.	.			trans	-94.8	88.8	169.5	-174.9	-19	0	0	0	109.5	F22 K23 R27 A28 L29	F22-D25 HydrophobicContact CB-CB 4.46Å; F22-D25 PolarHBondContact O-N 3.46Å; K23-D25 PolarHBondContact O-N 3.11Å; D25-R27 PolarHBondContact O-N 2.97Å; D25-R27 PolarHBondContact OD1-N 3.27Å; D25-A28 HydrophobicContact CB-CB 4.02Å; D25-A28 PolarHBondContact O-N 3.03Å; D25-A28 PolarHBondContact OD1-N 2.93Å; D25-A28 VanDerWaalsContact OD2-CB 3.31Å; D25-A28 WeakPolarHBondContact OD2-CB 3.47Å; D25-L29 VanDerWaalsContact O-CB 3.27Å; D25-L29 WeakPolarHBondContact O-CB 3.49Å; D25-L29 WeakPolarHBondContact O-CD1 3.25Å; D25-L29 WeakPolarHBondContact O-CG 3.3Å; D25-L29 PolarHBondContact O-N 3.32Å
26	V	97.4	Very high	97.5	Very high	116 Å²	116	78.1 Å²	78.1	70%	0.703	38%	0.376	S	S	*	.	H	α-helix	trans	-57.6	-37.4	-177.1	178.7	0	0	0	0	111.7	N24 E30	N24-V26 PolarHBondContact O-N 3.17Å; V26-E30 WeakPolarHBondContact O-CB 3.46Å; V26-E30 PolarHBondContact O-N 3.21Å
27	R	97.1	Very high	97.5	Very high	218 Å²	218	75.4 Å²	75.4	82%	0.823	37%	0.37	S	S	*	.	H	α-helix	trans	-68.5	-49.1	-178.5	-177.5	-178.6	172.9	-164.3	-2.6	110.7	D25 E30 A31	D25-R27 PolarHBondContact O-N 2.97Å; D25-R27 PolarHBondContact OD1-N 3.27Å; R27-E30 PolarHBondContact O-N 2.84Å; R27-A31 WeakPolarHBondContact O-CB 3.37Å; R27-A31 PolarHBondContact O-N 2.96Å
28	A	97	Very high	97.5	Very high	22 Å²	22	79.4 Å²	79.4	18%	0.182	39%	0.388	C	S	.	.	H	α-helix	trans	-67.2	-37.9	177.6	0	0	0	0	0	111.9	F22 D25 E30 A31 A32	F22-A28 HydrophobicContact CB-CB 3.95Å; F22-A28 HydrophobicContact CD1-CB 3.68Å; F22-A28 HydrophobicContact CD2-CB 4.45Å; F22-A28 HydrophobicContact CE1-CB 4.3Å; F22-A28 HydrophobicContact CG-CB 3.78Å; D25-A28 HydrophobicContact CB-CB 4.02Å; D25-A28 PolarHBondContact O-N 3.03Å; D25-A28 PolarHBondContact OD1-N 2.93Å; D25-A28 VanDerWaalsContact OD2-CB 3.31Å; D25-A28 WeakPolarHBondContact OD2-CB 3.47Å; A28-E30 VanDerWaalsContact C-N 3.34Å; A28-E30 PolarHBondContact O-N 3.15Å; A28-A31 PolarHBondContact O-N 3.22Å; A28-A32 VanDerWaalsContact O-CB 3.23Å; A28-A32 WeakPolarHBondContact O-CB 3.2Å; A28-A32 PolarHBondContact O-N 2.84Å
29	L	98.3	Very high	97.5	Very high	34 Å²	34	82 Å²	82	18%	0.178	40%	0.402	C	S	.	.	H	α-helix	trans	-57.6	-47.1	174.7	-77	168	0	0	0	111.5	R18 F22 D25 R33	R18-L29 PolarHBondContact NH1-O 3.37Å; R18-L29 WeakPolarHBondContact O-CD2 3.37Å; F22-L29 HydrophobicContact CB-CD2 3.95Å; F22-L29 HydrophobicContact CB-CG 3.97Å; F22-L29 WeakPolarHBondContact O-CD1 3.47Å; F22-L29 VanDerWaalsContact O-CG 3.26Å; F22-L29 WeakPolarHBondContact O-CG 3.25Å; D25-L29 VanDerWaalsContact O-CB 3.27Å; D25-L29 WeakPolarHBondContact O-CB 3.49Å; D25-L29 WeakPolarHBondContact O-CD1 3.25Å; D25-L29 WeakPolarHBondContact O-CG 3.3Å; D25-L29 PolarHBondContact O-N 3.32Å; L29-R33 WeakPolarHBondContact O-CB 3.29Å; L29-R33 PolarHBondContact O-N 2.82Å
30	E	98.5	Very high	97.5	Very high	87 Å²	87	79.9 Å²	79.9	41%	0.407	39%	0.391	S	S	.	.	H	α-helix	trans	-72.5	-43.3	-178.2	-168.3	55.2	-153.6	0	0	112	V26 R27 A28 A32 R33 I34	V26-E30 WeakPolarHBondContact O-CB 3.46Å; V26-E30 PolarHBondContact O-N 3.21Å; R27-E30 PolarHBondContact O-N 2.84Å; A28-E30 VanDerWaalsContact C-N 3.34Å; A28-E30 PolarHBondContact O-N 3.15Å; E30-A32 VanDerWaalsContact C-N 3.32Å; E30-A32 PolarHBondContact O-N 3.14Å; E30-R33 WeakPolarHBondContact O-CB 3.35Å; E30-R33 PolarHBondContact O-N 3.41Å; E30-R33 VanDerWaalsContact O-N 3.1Å; E30-I34 HydrophobicContact CG-CD1 4.11Å; E30-I34 WeakPolarHBondContact O-CG1 3.2Å; E30-I34 PolarHBondContact O-N 3.04Å
31	A	98.3	Very high	97.6	Very high	59 Å²	59	81.8 Å²	81.8	49%	0.488	40%	0.397	S	S	.	.	H	α-helix	trans	-57	-45.8	174.6	0	0	0	0	0	111.7	R27 A28 R33 I34 K35	R27-A31 WeakPolarHBondContact O-CB 3.37Å; R27-A31 PolarHBondContact O-N 2.96Å; A28-A31 PolarHBondContact O-N 3.22Å; A31-R33 VanDerWaalsContact C-N 3.35Å; A31-R33 PolarHBondContact O-N 3.48Å; A31-I34 PolarHBondContact O-N 3.49Å; A31-K35 WeakPolarHBondContact O-CB 3.48Å; A31-K35 PolarHBondContact O-N 2.99Å
32	A	98.1	Very high	97.7	Very high	19 Å²	19	86.6 Å²	86.6	16%	0.157	42%	0.423	C	S	.	.	H	α-helix	trans	-64.1	-38.8	176.3	0	0	0	0	0	112.1	R18 F22 A28 E30 K35 I36	R18-A32 HydrophobicContact CB-CB 3.95Å; R18-A32 HydrophobicContact CG-CB 4.47Å; F22-A32 HydrophobicContact CD2-CB 4.13Å; F22-A32 HydrophobicContact CE2-CB 3.96Å; A28-A32 VanDerWaalsContact O-CB 3.23Å; A28-A32 WeakPolarHBondContact O-CB 3.2Å; A28-A32 PolarHBondContact O-N 2.84Å; E30-A32 VanDerWaalsContact C-N 3.32Å; E30-A32 PolarHBondContact O-N 3.14Å; A32-K35 PolarHBondContact O-N 2.86Å; A32-I36 WeakPolarHBondContact O-CB 3.43Å; A32-I36 WeakPolarHBondContact O-CD1 3.45Å; A32-I36 WeakPolarHBondContact O-CG1 3.2Å; A32-I36 PolarHBondContact O-N 2.81Å
33	R	98.5	Very high	97.7	Very high	118 Å²	118	87.3 Å²	87.3	45%	0.445	43%	0.428	S	S	.	.	H	α-helix	trans	-60.5	-50.4	176.3	-176.4	-175	-176.4	152.8	1.5	111.4	L29 E30 A31 K35 I36 N37	L29-R33 WeakPolarHBondContact O-CB 3.29Å; L29-R33 PolarHBondContact O-N 2.82Å; E30-R33 WeakPolarHBondContact O-CB 3.35Å; E30-R33 PolarHBondContact O-N 3.41Å; E30-R33 VanDerWaalsContact O-N 3.1Å; A31-R33 VanDerWaalsContact C-N 3.35Å; A31-R33 PolarHBondContact O-N 3.48Å; R33-K35 VanDerWaalsContact C-N 3.33Å; R33-I36 PolarHBondContact O-N 3.39Å; R33-N37 WeakPolarHBondContact O-CB 3.4Å; R33-N37 PolarHBondContact O-N 2.95Å; R33-N37 PolarHBondContact O-ND2 2.86Å
34	I	98.6	Very high	97.6	Very high	95 Å²	95	89.3 Å²	89.3	49%	0.487	44%	0.437	S	S	.	.	H	α-helix	trans	-59	-49.4	-179.1	-68.9	168.2	0	0	0	109.1	E30 A31 I36 N37 E38	E30-I34 HydrophobicContact CG-CD1 4.11Å; E30-I34 WeakPolarHBondContact O-CG1 3.2Å; E30-I34 PolarHBondContact O-N 3.04Å; A31-I34 PolarHBondContact O-N 3.49Å; I34-I36 PolarHBondContact O-N 3.38Å; I34-N37 PolarHBondContact O-N 3.46Å; I34-E38 WeakPolarHBondContact O-CB 2.93Å; I34-E38 PolarHBondContact O-N 3.24Å
35	K	98.4	Very high	97.6	Very high	104 Å²	104	87.9 Å²	87.9	45%	0.452	44%	0.438	S	S	.	.	H	α-helix	trans	-63.3	-44.1	-177.8	-170.6	52.2	166.5	170.6	0	113.1	A31 A32 R33 N37 E38 E39	A31-K35 WeakPolarHBondContact O-CB 3.48Å; A31-K35 PolarHBondContact O-N 2.99Å; A32-K35 PolarHBondContact O-N 2.86Å; R33-K35 VanDerWaalsContact C-N 3.33Å; K35-N37 VanDerWaalsContact C-N 3.35Å; K35-N37 PolarHBondContact O-N 2.84Å; K35-E38 IonicContact NZ-OE2 3.59Å; K35-E38 PolarHBondContact O-N 3.39Å; K35-E39 HydrophobicContact CD-CG 4.26Å; K35-E39 VanDerWaalsContact CE-OE1 3.27Å; K35-E39 WeakPolarHBondContact CE-OE1 3.29Å; K35-E39 IonicContact NZ-OE1 2.67Å; K35-E39 PolarHBondContact NZ-OE1 3.31Å; K35-E39 WeakPolarHBondContact O-CG 3.41Å; K35-E39 PolarHBondContact O-N 3.03Å
36	I	98.3	Very high	97.6	Very high	20 Å²	20	88.2 Å²	88.2	10%	0.103	44%	0.438	C	S	.	.	H	α-helix	trans	-59.2	-47.3	175.6	-68.7	162.7	0	0	0	110.3	F11 L14 R18 A32 R33 I34 E38 F40	F11-I36 HydrophobicContact CD2-CG2 3.94Å; F11-I36 HydrophobicContact CE2-CG2 3.81Å; L14-I36 HydrophobicContact CB-CD1 4.02Å; L14-I36 HydrophobicContact CB-CG1 4.41Å; L14-I36 HydrophobicContact CB-CG2 4.46Å; R18-I36 HydrophobicContact CB-CD1 4.43Å; R18-I36 HydrophobicContact CG-CD1 4.09Å; A32-I36 WeakPolarHBondContact O-CB 3.43Å; A32-I36 WeakPolarHBondContact O-CD1 3.45Å; A32-I36 WeakPolarHBondContact O-CG1 3.2Å; A32-I36 PolarHBondContact O-N 2.81Å; R33-I36 PolarHBondContact O-N 3.39Å; I34-I36 PolarHBondContact O-N 3.38Å; I36-E38 PolarHBondContact O-N 3.05Å; I36-F40 HydrophobicContact CG2-CD2 4.23Å; I36-F40 HydrophobicContact CG2-CE2 4.28Å; I36-F40 VanDerWaalsContact O-CD2 3.24Å; I36-F40 WeakPolarHBondContact O-CD2 3.24Å; I36-F40 PolarHBondContact O-N 3.08Å
37	N	98.4	Very high	97.5	Very high	61 Å²	61	88.5 Å²	88.5	33%	0.326	44%	0.44	S	S	.	.	H	α-helix	trans	-65.3	-40.6	-179.5	-73.9	-23.9	0	0	0	112.7	F11 H15 R33 I34 K35 K41	F11-N37 WeakPolarHBondContact CE2-OD1 3.27Å; F11-N37 VanDerWaalsContact CZ-OD1 3.3Å; F11-N37 WeakPolarHBondContact CZ-OD1 3.32Å; H15-N37 PolarHBondContact NE2-OD1 3.11Å; R33-N37 WeakPolarHBondContact O-CB 3.4Å; R33-N37 PolarHBondContact O-N 2.95Å; R33-N37 PolarHBondContact O-ND2 2.86Å; I34-N37 PolarHBondContact O-N 3.46Å; K35-N37 VanDerWaalsContact C-N 3.35Å; K35-N37 PolarHBondContact O-N 2.84Å; N37-K41 WeakPolarHBondContact O-CB 3.46Å; N37-K41 PolarHBondContact O-N 2.67Å
38	E	98.4	Very high	97.4	Very high	88 Å²	88	80.4 Å²	80.4	41%	0.411	42%	0.417	S	S	.	.	H	α-helix	trans	-59.9	-51.1	177.6	-176.8	-177.2	-157.3	0	0	111.1	I34 K35 I36 F40 K41 N42	I34-E38 WeakPolarHBondContact O-CB 2.93Å; I34-E38 PolarHBondContact O-N 3.24Å; K35-E38 IonicContact NZ-OE2 3.59Å; K35-E38 PolarHBondContact O-N 3.39Å; I36-E38 PolarHBondContact O-N 3.05Å; E38-F40 PolarHBondContact O-N 3.27Å; E38-K41 PolarHBondContact O-N 3.37Å; E38-K41 VanDerWaalsContact O-N 3.14Å; E38-N42 WeakPolarHBondContact O-CB 3.48Å; E38-N42 PolarHBondContact O-N 2.94Å; E38-N42 PolarHBondContact O-ND2 2.98Å; E38-N42 PolarHBondContact O-OD1 2.89Å
39	E	97.8	Very high	97.3	Very high	78 Å²	78	83.5 Å²	83.5	36%	0.364	44%	0.435	S	S	.	.	H	α-helix	trans	-61.2	-42.9	-178.8	-70.6	-56.1	146	0	0	112.6	K35 K41 N43	K35-E39 HydrophobicContact CD-CG 4.26Å; K35-E39 VanDerWaalsContact CE-OE1 3.27Å; K35-E39 WeakPolarHBondContact CE-OE1 3.29Å; K35-E39 IonicContact NZ-OE1 2.67Å; K35-E39 PolarHBondContact NZ-OE1 3.31Å; K35-E39 WeakPolarHBondContact O-CG 3.41Å; K35-E39 PolarHBondContact O-N 3.03Å; E39-K41 VanDerWaalsContact C-N 3.35Å; E39-N43 PolarHBondContact O-N 3.32Å; E39-N43 PolarHBondContact O-ND2 2.8Å
40	F	97.7	Very high	97.2	Very high	61 Å²	61	88.8 Å²	88.8	27%	0.268	46%	0.457	S	S	.	.	H	α-helix	trans	-70	-33	177.1	-82	-103.2	0	0	0	112.3	V7 L10 F11 L14 I36 E38 K44	V7-F40 HydrophobicContact CG1-CD1 4.25Å; V7-F40 HydrophobicContact CG1-CE1 3.9Å; L10-F40 HydrophobicContact CG-CZ 4.41Å; F11-F40 HydrophobicContact CB-CD1 4.11Å; F11-F40 HydrophobicContact CB-CE1 3.61Å; F11-F40 HydrophobicContact CB-CE2 4.48Å; F11-F40 HydrophobicContact CB-CZ 3.81Å; F11-F40 HydrophobicContact CD2-CB 4.2Å; F11-F40 AromaticContact CD2-CD1 3.76Å; F11-F40 HydrophobicContact CD2-CD1 3.76Å; F11-F40 AromaticContact CD2-CD2 3.72Å; F11-F40 HydrophobicContact CD2-CD2 3.72Å; F11-F40 AromaticContact CD2-CE1 3.99Å; F11-F40 HydrophobicContact CD2-CE1 3.99Å; F11-F40 AromaticContact CD2-CE2 3.93Å; F11-F40 HydrophobicContact CD2-CE2 3.93Å; F11-F40 AromaticContact CD2-CG 3.61Å; F11-F40 HydrophobicContact CD2-CG 3.61Å; F11-F40 HydrophobicContact CD2-CZ 4.05Å; F11-F40 HydrophobicContact CE2-CB 4.34Å; F11-F40 HydrophobicContact CE2-CD2 4.33Å; F11-F40 HydrophobicContact CE2-CG 4.2Å; F11-F40 HydrophobicContact CG-CD1 4.31Å; F11-F40 HydrophobicContact CG-CE1 4.26Å; F11-F40 HydrophobicContact CG-CZ 4.46Å; L14-F40 HydrophobicContact CD1-CE2 3.87Å; L14-F40 HydrophobicContact CD1-CZ 4.18Å; I36-F40 HydrophobicContact CG2-CD2 4.23Å; I36-F40 HydrophobicContact CG2-CE2 4.28Å; I36-F40 VanDerWaalsContact O-CD2 3.24Å; I36-F40 WeakPolarHBondContact O-CD2 3.24Å; I36-F40 PolarHBondContact O-N 3.08Å; E38-F40 PolarHBondContact O-N 3.27Å; F40-K44 PolarHBondContact O-N 3.2Å
41	K	98	Very high	97.1	Very high	162 Å²	162	88.4 Å²	88.4	70%	0.704	45%	0.453	S	S	*	.	H	α-helix	trans	-70.1	-42.6	176.3	-173.2	178.7	178	-174.2	0	111.5	N37 E38 E39 N43 K44	N37-K41 WeakPolarHBondContact O-CB 3.46Å; N37-K41 PolarHBondContact O-N 2.67Å; E38-K41 PolarHBondContact O-N 3.37Å; E38-K41 VanDerWaalsContact O-N 3.14Å; E39-K41 VanDerWaalsContact C-N 3.35Å; K41-N43 PolarHBondContact O-N 3.25Å; K41-K44 VanDerWaalsContact O-CB 3.29Å; K41-K44 WeakPolarHBondContact O-CB 3.29Å; K41-K44 PolarHBondContact O-N 3.2Å
42	N	97.6	Very high	97	Very high	103 Å²	103	87 Å²	87	55%	0.551	44%	0.438	S	S	*	.	H	α-helix	trans	-61.6	-33.4	179.5	-70.9	-10.1	0	0	0	111.9	E38	E38-N42 WeakPolarHBondContact O-CB 3.48Å; E38-N42 PolarHBondContact O-N 2.94Å; E38-N42 PolarHBondContact O-ND2 2.98Å; E38-N42 PolarHBondContact O-OD1 2.89Å
43	N	96.6	Very high	96.9	Very high	51 Å²	51	92.4 Å²	92.4	27%	0.273	46%	0.459	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.7	8.4	-179.5	-63.2	-79.7	0	0	0	113.7	E39 K41 S45 E46 L55	E39-N43 PolarHBondContact O-N 3.32Å; E39-N43 PolarHBondContact O-ND2 2.8Å; K41-N43 PolarHBondContact O-N 3.25Å; N43-S45 PolarHBondContact O-N 3.29Å; N43-E46 WeakPolarHBondContact O-CB 3.47Å; N43-E46 PolarHBondContact O-N 2.82Å; N43-E46 VanDerWaalsContact O-N 3.12Å; N43-L55 HydrophobicContact CB-CD1 3.8Å; N43-L55 WeakPolarHBondContact OD1-CD1 3.33Å
44	K	95.1	Very high	96.9	Very high	174 Å²	174	90.7 Å²	90.7	76%	0.757	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.7	-33.5	-174.2	-179	-179.1	175	-173.7	0	113.6	F40 K41	F40-K44 PolarHBondContact O-N 3.2Å; K41-K44 VanDerWaalsContact O-CB 3.29Å; K41-K44 WeakPolarHBondContact O-CB 3.29Å; K41-K44 PolarHBondContact O-N 3.2Å
45	S	95.6	Very high	96.8	Very high	113 Å²	113	88.4 Å²	88.4	79%	0.79	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.1	6.5	-176.7	-55.1	0	0	0	0	113.4	N43	N43-S45 PolarHBondContact O-N 3.29Å
46	E	95.9	Very high	96.8	Very high	69 Å²	69	85.3 Å²	85.3	32%	0.322	43%	0.433	S	S	.	.			trans	-68.1	130.9	177.2	-178.2	55.3	-103.8	0	0	110.6	N43 S48 K51 I52	N43-E46 WeakPolarHBondContact O-CB 3.47Å; N43-E46 PolarHBondContact O-N 2.82Å; N43-E46 VanDerWaalsContact O-N 3.12Å; E46-S48 WeakPolarHBondContact OE1-CA 3.37Å; E46-S48 WeakPolarHBondContact OE1-CB 3.47Å; E46-S48 PolarHBondContact OE1-N 3.29Å; E46-K51 HydrophobicContact CG-CB 3.96Å; E46-K51 HydrophobicContact CG-CG 3.88Å; E46-K51 WeakPolarHBondContact OE2-CG 3.09Å; E46-I52 HydrophobicContact CB-CG1 4.5Å; E46-I52 HydrophobicContact CG-CG1 3.93Å
47	T	94.6	Very high	96.7	Very high	123 Å²	123	91 Å²	91	76%	0.755	46%	0.457	S	S	*	.			trans	-118.4	-11.9	-178	58.1	0	0	0	0	113	P49	T47-P49 VanDerWaalsContact O-CD 3.29Å; T47-P49 WeakPolarHBondContact O-CD 3.32Å
48	S	96.5	Very high	96.7	Very high	48 Å²	48	92.8 Å²	92.8	34%	0.336	47%	0.465	S	S	.	.			trans	-71.5	117	178.8	176	0	0	0	0	110.7	E46 K50 K51 I52	E46-S48 WeakPolarHBondContact OE1-CA 3.37Å; E46-S48 WeakPolarHBondContact OE1-CB 3.47Å; E46-S48 PolarHBondContact OE1-N 3.29Å; S48-K50 VanDerWaalsContact C-N 3.27Å; S48-K50 PolarHBondContact O-N 3.01Å; S48-K51 PolarHBondContact O-N 3.4Å; S48-K51 VanDerWaalsContact O-N 3.15Å; S48-K51 PolarHBondContact OG-N 3.48Å; S48-I52 WeakPolarHBondContact O-CG1 3.07Å; S48-I52 PolarHBondContact O-N 2.97Å
49	P	94.1	Very high	96.7	Very high	87 Å²	87	89.1 Å²	89.1	57%	0.565	45%	0.451	S	S	*	.	H	α-helix	trans	-58.2	-39.7	-179.6	-25.7	35.4	0	0	0	112.9	T47 I52 E53	T47-P49 VanDerWaalsContact O-CD 3.29Å; T47-P49 WeakPolarHBondContact O-CD 3.32Å; P49-I52 PolarHBondContact O-N 3.39Å; P49-E53 PolarHBondContact O-N 3.07Å
50	K	96.1	Very high	96.7	Very high	145 Å²	145	88 Å²	88	63%	0.63	45%	0.452	S	S	*	.	H	α-helix	trans	-64.1	-43.7	178.3	-172.9	-177.6	176.5	-176.1	0	111.4	S48 E53 E54	S48-K50 VanDerWaalsContact C-N 3.27Å; S48-K50 PolarHBondContact O-N 3.01Å; K50-E53 PolarHBondContact O-N 3.42Å; K50-E54 WeakPolarHBondContact CE-OE1 3.37Å; K50-E54 WeakPolarHBondContact O-CG 3.42Å; K50-E54 PolarHBondContact O-N 2.96Å
51	K	96.6	Very high	96.8	Very high	78 Å²	78	89.2 Å²	89.2	34%	0.339	46%	0.462	S	S	.	.	H	α-helix	trans	-67.6	-39.8	180	-171.7	57	175	179.9	0	111.8	E46 S48 E53 E54 L55	E46-K51 HydrophobicContact CG-CB 3.96Å; E46-K51 HydrophobicContact CG-CG 3.88Å; E46-K51 WeakPolarHBondContact OE2-CG 3.09Å; S48-K51 PolarHBondContact O-N 3.4Å; S48-K51 VanDerWaalsContact O-N 3.15Å; S48-K51 PolarHBondContact OG-N 3.48Å; K51-E53 VanDerWaalsContact C-N 3.3Å; K51-E53 PolarHBondContact O-N 3.42Å; K51-E54 IonicContact NZ-OE2 3.76Å; K51-E54 PolarHBondContact O-N 2.9Å; K51-L55 HydrophobicContact CG-CD1 4.16Å; K51-L55 VanDerWaalsContact O-CG 3.3Å; K51-L55 WeakPolarHBondContact O-CG 3.45Å; K51-L55 PolarHBondContact O-N 3.42Å
52	I	96.1	Very high	96.7	Very high	30 Å²	30	84.6 Å²	84.6	15%	0.154	45%	0.447	C	S	.	.	H	α-helix	trans	-60.6	-42.8	174.9	-65.7	165.9	0	0	0	110.4	Q3 V7 E46 S48 P49 L55 M56	Q3-I52 HydrophobicContact CG-CG2 4.16Å; V7-I52 HydrophobicContact CG2-CG2 4.16Å; E46-I52 HydrophobicContact CB-CG1 4.5Å; E46-I52 HydrophobicContact CG-CG1 3.93Å; S48-I52 WeakPolarHBondContact O-CG1 3.07Å; S48-I52 PolarHBondContact O-N 2.97Å; P49-I52 PolarHBondContact O-N 3.39Å; I52-L55 PolarHBondContact O-N 3.14Å; I52-M56 HydrophobicContact CG2-CG 4.41Å; I52-M56 WeakPolarHBondContact O-CB 3.33Å; I52-M56 WeakPolarHBondContact O-CG 3.42Å; I52-M56 PolarHBondContact O-N 3.29Å
53	E	96.5	Very high	96.8	Very high	132 Å²	132	81.2 Å²	81.2	62%	0.617	43%	0.428	S	S	*	.	H	α-helix	trans	-62	-45.3	177.1	-174.4	173.7	-164.7	0	0	112.3	P49 K50 K51 L55 M56 K57	P49-E53 PolarHBondContact O-N 3.07Å; K50-E53 PolarHBondContact O-N 3.42Å; K51-E53 VanDerWaalsContact C-N 3.3Å; K51-E53 PolarHBondContact O-N 3.42Å; E53-L55 PolarHBondContact O-N 2.94Å; E53-M56 PolarHBondContact O-N 3.27Å; E53-K57 PolarHBondContact O-N 3.43Å
54	E	97.3	Very high	96.8	Very high	82 Å²	82	82.6 Å²	82.6	38%	0.383	44%	0.435	S	S	.	.	H	α-helix	trans	-58.9	-46.6	174.7	-71.4	170.7	-171.1	0	0	111.9	K50 K51 M56 K57 I58	K50-E54 WeakPolarHBondContact CE-OE1 3.37Å; K50-E54 WeakPolarHBondContact O-CG 3.42Å; K50-E54 PolarHBondContact O-N 2.96Å; K51-E54 IonicContact NZ-OE2 3.76Å; K51-E54 PolarHBondContact O-N 2.9Å; E54-M56 PolarHBondContact O-N 2.76Å; E54-K57 WeakPolarHBondContact O-CB 3.49Å; E54-K57 PolarHBondContact O-N 3.4Å; E54-I58 WeakPolarHBondContact O-CG1 3.3Å; E54-I58 PolarHBondContact O-N 3.06Å
55	L	97.7	Very high	96.8	Very high	47 Å²	47	79.2 Å²	79.2	25%	0.246	42%	0.424	C	S	.	.	H	α-helix	trans	-64.2	-40	178.4	-70.6	168.5	0	0	0	112.2	N43 K51 I52 E53 K57 I58 G59	N43-L55 HydrophobicContact CB-CD1 3.8Å; N43-L55 WeakPolarHBondContact OD1-CD1 3.33Å; K51-L55 HydrophobicContact CG-CD1 4.16Å; K51-L55 VanDerWaalsContact O-CG 3.3Å; K51-L55 WeakPolarHBondContact O-CG 3.45Å; K51-L55 PolarHBondContact O-N 3.42Å; I52-L55 PolarHBondContact O-N 3.14Å; E53-L55 PolarHBondContact O-N 2.94Å; L55-K57 VanDerWaalsContact C-N 3.33Å; L55-I58 PolarHBondContact O-N 3Å; L55-G59 PolarHBondContact O-N 3.5Å
56	M	97.6	Very high	96.9	Very high	39 Å²	39	75.2 Å²	75.2	19%	0.192	39%	0.394	C	S	.	.	H	α-helix	trans	-64.5	-38.8	174.8	-74.4	-160.2	-44.5	0	0	112	K6 V7 L10 I52 E53 E54 G59 S60	K6-M56 HydrophobicContact CB-SD 4.02Å; V7-M56 HydrophobicContact CG2-CG 4.01Å; V7-M56 HydrophobicContact CG2-SD 3.65Å; L10-M56 HydrophobicContact CD2-CB 4.26Å; L10-M56 HydrophobicContact CD2-CG 4.45Å; L10-M56 WeakPolarHBondContact CD2-O 3.31Å; I52-M56 HydrophobicContact CG2-CG 4.41Å; I52-M56 WeakPolarHBondContact O-CB 3.33Å; I52-M56 WeakPolarHBondContact O-CG 3.42Å; I52-M56 PolarHBondContact O-N 3.29Å; E53-M56 PolarHBondContact O-N 3.27Å; E54-M56 PolarHBondContact O-N 2.76Å; M56-G59 PolarHBondContact O-N 3.41Å; M56-S60 WeakPolarHBondContact O-CB 3.38Å; M56-S60 PolarHBondContact O-N 2.89Å; M56-S60 PolarHBondContact O-OG 3.25Å
57	K	97.8	Very high	96.8	Very high	140 Å²	140	76.4 Å²	76.4	61%	0.609	40%	0.395	S	S	*	.	H	α-helix	trans	-62	-50	175.4	-175.6	179.2	177.4	-175.6	0	110.5	E53 E54 L55 G59 S60 D61	E53-K57 PolarHBondContact O-N 3.43Å; E54-K57 WeakPolarHBondContact O-CB 3.49Å; E54-K57 PolarHBondContact O-N 3.4Å; L55-K57 VanDerWaalsContact C-N 3.33Å; K57-G59 VanDerWaalsContact C-N 3.32Å; K57-G59 PolarHBondContact O-N 3.02Å; K57-S60 WeakPolarHBondContact O-CB 3.39Å; K57-S60 PolarHBondContact O-N 2.95Å; K57-D61 PolarHBondContact O-N 3.45Å
58	I	97.9	Very high	96.8	Very high	98 Å²	98	73.3 Å²	73.3	50%	0.503	38%	0.376	S	S	.	.	H	α-helix	trans	-54.9	-48.9	176.8	-67.5	163.9	0	0	0	110.9	E54 L55 S60 D61 V62	E54-I58 WeakPolarHBondContact O-CG1 3.3Å; E54-I58 PolarHBondContact O-N 3.06Å; L55-I58 PolarHBondContact O-N 3Å; I58-S60 VanDerWaalsContact C-N 3.28Å; I58-S60 PolarHBondContact O-N 3.29Å; I58-D61 PolarHBondContact O-N 3.12Å; I58-V62 HydrophobicContact CG2-CG2 4.49Å; I58-V62 VanDerWaalsContact O-CG2 3.32Å; I58-V62 WeakPolarHBondContact O-CG2 3.45Å; I58-V62 PolarHBondContact O-N 2.97Å
59	G	97.9	Very high	96.6	Very high	12 Å²	12	74.8 Å²	74.8	12%	0.124	39%	0.387	C	S	.	.	H	α-helix	trans	-63.5	-34.2	179.4	0	0	0	0	0	113.1	L55 M56 K57 E63	L55-G59 PolarHBondContact O-N 3.5Å; M56-G59 PolarHBondContact O-N 3.41Å; K57-G59 VanDerWaalsContact C-N 3.32Å; K57-G59 PolarHBondContact O-N 3.02Å; G59-E63 WeakPolarHBondContact O-CB 3.44Å; G59-E63 PolarHBondContact O-N 3.46Å
60	S	98.2	Very high	96.6	Very high	55 Å²	55	72.6 Å²	72.6	39%	0.385	37%	0.371	S	S	.	.	H	α-helix	trans	-70.7	-40.2	176.1	-55.3	0	0	0	0	111.9	M56 K57 I58 V62 E63 L64	M56-S60 WeakPolarHBondContact O-CB 3.38Å; M56-S60 PolarHBondContact O-N 2.89Å; M56-S60 PolarHBondContact O-OG 3.25Å; K57-S60 WeakPolarHBondContact O-CB 3.39Å; K57-S60 PolarHBondContact O-N 2.95Å; I58-S60 VanDerWaalsContact C-N 3.28Å; I58-S60 PolarHBondContact O-N 3.29Å; S60-V62 VanDerWaalsContact C-N 3.34Å; S60-E63 WeakPolarHBondContact O-CB 3.33Å; S60-E63 PolarHBondContact O-N 3.42Å; S60-L64 PolarHBondContact O-N 3.02Å
61	D	98.3	Very high	96.6	Very high	86 Å²	86	69.5 Å²	69.5	46%	0.46	36%	0.361	S	S	.	.	H	α-helix	trans	-65.3	-39.4	176.1	-66.3	-18.9	0	0	0	110.9	K57 I58 L64 L65	K57-D61 PolarHBondContact O-N 3.45Å; I58-D61 PolarHBondContact O-N 3.12Å; D61-L64 PolarHBondContact O-N 3.19Å; D61-L65 WeakPolarHBondContact O-CB 3.34Å; D61-L65 PolarHBondContact O-N 3.06Å
62	V	97.8	Very high	96.5	Very high	64 Å²	64	67.2 Å²	67.2	39%	0.388	35%	0.352	S	S	.	.	H	α-helix	trans	-63.9	-42.9	173.6	169.5	0	0	0	0	111.5	L14 I58 S60 L64 L65 L66	L14-V62 HydrophobicContact CD2-CG1 4.16Å; I58-V62 HydrophobicContact CG2-CG2 4.49Å; I58-V62 VanDerWaalsContact O-CG2 3.32Å; I58-V62 WeakPolarHBondContact O-CG2 3.45Å; I58-V62 PolarHBondContact O-N 2.97Å; S60-V62 VanDerWaalsContact C-N 3.34Å; V62-L64 VanDerWaalsContact C-N 3.33Å; V62-L64 PolarHBondContact O-N 3.36Å; V62-L65 PolarHBondContact O-N 2.97Å; V62-L66 HydrophobicContact CG1-CD1 4.1Å; V62-L66 HydrophobicContact CG1-CG 4.35Å; V62-L66 WeakPolarHBondContact O-CB 3.47Å; V62-L66 VanDerWaalsContact O-CG 3.29Å; V62-L66 WeakPolarHBondContact O-CG 3.33Å; V62-L66 PolarHBondContact O-N 3.34Å
63	E	97.8	Very high	96.4	Very high	33 Å²	33	67.6 Å²	67.6	15%	0.154	36%	0.363	C	S	.	.	H	α-helix	trans	-57.3	-48.5	175.3	-170.4	-73.2	142.6	0	0	111.2	T13 L14 T17 G59 S60 L66 R67	T13-E63 HydrophobicContact CG2-CG 3.63Å; L14-E63 HydrophobicContact CD2-CB 3.79Å; L14-E63 HydrophobicContact CD2-CG 4.36Å; L14-E63 HydrophobicContact CG-CB 4.41Å; T17-E63 HydrophobicContact CG2-CG 4.42Å; T17-E63 PolarHBondContact OG1-OE1 3.24Å; G59-E63 WeakPolarHBondContact O-CB 3.44Å; G59-E63 PolarHBondContact O-N 3.46Å; S60-E63 WeakPolarHBondContact O-CB 3.33Å; S60-E63 PolarHBondContact O-N 3.42Å; E63-L66 PolarHBondContact O-N 3.28Å; E63-R67 WeakPolarHBondContact O-CB 3.49Å; E63-R67 PolarHBondContact O-N 2.98Å; E63-R67 VanDerWaalsContact O-N 3.07Å; E63-R67 IonicContact OE1-NE 3.98Å
64	L	96.9	Very high	96.3	Very high	80 Å²	80	66 Å²	66	42%	0.419	36%	0.357	S	S	.	.	H	α-helix	trans	-59.7	-50.4	178.5	179.5	62.5	0	0	0	111	S60 D61 V62 L66 R67 T68	S60-L64 PolarHBondContact O-N 3.02Å; D61-L64 PolarHBondContact O-N 3.19Å; V62-L64 VanDerWaalsContact C-N 3.33Å; V62-L64 PolarHBondContact O-N 3.36Å; L64-L66 PolarHBondContact O-N 3.01Å; L64-R67 PolarHBondContact O-N 3.14Å; L64-R67 VanDerWaalsContact O-N 3.14Å; L64-T68 HydrophobicContact CD1-CG2 3.73Å; L64-T68 HydrophobicContact CG-CG2 4.45Å; L64-T68 WeakPolarHBondContact O-CG2 3.48Å; L64-T68 PolarHBondContact O-N 2.94Å; L64-T68 PolarHBondContact O-OG1 2.94Å
65	L	96.5	Very high	96	Very high	102 Å²	102	69.5 Å²	69.5	53%	0.534	37%	0.374	S	S	.	.	H	α-helix	trans	-56.7	-48	179.5	-175.3	79.1	0	0	0	112.1	D61 V62 R67 T68 S69	D61-L65 WeakPolarHBondContact O-CB 3.34Å; D61-L65 PolarHBondContact O-N 3.06Å; V62-L65 PolarHBondContact O-N 2.97Å; L65-R67 VanDerWaalsContact C-N 3.28Å; L65-R67 PolarHBondContact O-N 3.12Å; L65-T68 PolarHBondContact O-N 3.39Å; L65-S69 WeakPolarHBondContact O-CB 3.08Å; L65-S69 PolarHBondContact O-N 2.87Å
66	L	95.9	Very high	95.6	Very high	30 Å²	30	69.7 Å²	69.7	16%	0.157	38%	0.377	C	S	.	.	H	α-helix	trans	-58.5	-44	178	-74.1	176.7	0	0	0	110.9	T17 V21 F22 V62 E63 L64 V70 R86	T17-L66 HydrophobicContact CG2-CB 3.84Å; V21-L66 HydrophobicContact CG2-CB 4.25Å; V21-L66 VanDerWaalsContact CG2-O 3.29Å; V21-L66 WeakPolarHBondContact CG2-O 3.27Å; F22-L66 HydrophobicContact CE2-CD2 4.31Å; F22-L66 HydrophobicContact CZ-CD2 4Å; V62-L66 HydrophobicContact CG1-CD1 4.1Å; V62-L66 HydrophobicContact CG1-CG 4.35Å; V62-L66 WeakPolarHBondContact O-CB 3.47Å; V62-L66 VanDerWaalsContact O-CG 3.29Å; V62-L66 WeakPolarHBondContact O-CG 3.33Å; V62-L66 PolarHBondContact O-N 3.34Å; E63-L66 PolarHBondContact O-N 3.28Å; L64-L66 PolarHBondContact O-N 3.01Å; L66-V70 HydrophobicContact CD2-CG2 4.06Å; L66-R86 PolarHBondContact O-NH2 3.49Å; L66-R86 VanDerWaalsContact O-NH2 3.08Å
67	R	94.6	Very high	94.9	Very high	93 Å²	93	76.1 Å²	76.1	35%	0.351	41%	0.412	S	S	.	.	H	α-helix	trans	-69	-42.6	-178.1	-170.9	174	57.9	73.5	-0.3	112.4	T17 E63 L64 L65 R86	T17-R67 HydrophobicContact CG2-CB 4.21Å; E63-R67 WeakPolarHBondContact O-CB 3.49Å; E63-R67 PolarHBondContact O-N 2.98Å; E63-R67 VanDerWaalsContact O-N 3.07Å; E63-R67 IonicContact OE1-NE 3.98Å; L64-R67 PolarHBondContact O-N 3.14Å; L64-R67 VanDerWaalsContact O-N 3.14Å; L65-R67 VanDerWaalsContact C-N 3.28Å; L65-R67 PolarHBondContact O-N 3.12Å; R67-R86 PolarHBondContact O-NH2 3.48Å
68	T	94.1	Very high	94.1	Very high	58 Å²	58	77 Å²	77	36%	0.356	42%	0.419	S	S	.	.	H	α-helix	trans	-96.3	-19.2	-169.5	59.8	0	0	0	0	115.3	L64 L65 L89	L64-T68 HydrophobicContact CD1-CG2 3.73Å; L64-T68 HydrophobicContact CG-CG2 4.45Å; L64-T68 WeakPolarHBondContact O-CG2 3.48Å; L64-T68 PolarHBondContact O-N 2.94Å; L64-T68 PolarHBondContact O-OG1 2.94Å; L65-T68 PolarHBondContact O-N 3.39Å; T68-L89 VanDerWaalsContact C-CD2 3.47Å; T68-L89 WeakPolarHBondContact O-CD2 3.47Å
69	S	93.3	Very high	93.6	Very high	79 Å²	79	80.1 Å²	80.1	55%	0.552	44%	0.436	S	S	*	.	H	α-helix	trans	-129.5	-5.9	-164.7	-54.7	0	0	0	0	114.2	L65	L65-S69 WeakPolarHBondContact O-CB 3.08Å; L65-S69 PolarHBondContact O-N 2.87Å
70	V	94.8	Very high	93.3	Very high	41 Å²	41	83.1 Å²	83.1	25%	0.248	45%	0.452	C	S	.	.			trans	-101.8	121.2	-179.7	178.7	0	0	0	0	111.6	V21 F22 L66 R86	V21-V70 HydrophobicContact CG1-CB 3.81Å; V21-V70 HydrophobicContact CG1-CG1 3.56Å; F22-V70 HydrophobicContact CE1-CG1 4.04Å; L66-V70 HydrophobicContact CD2-CG2 4.06Å; V70-R86 VanDerWaalsContact O-CZ 3.25Å; V70-R86 PolarHBondContact O-NH1 2.9Å; V70-R86 PolarHBondContact O-NH2 2.95Å
71	I	94.9	Very high	93.1	Very high	81 Å²	81	84.7 Å²	84.7	42%	0.415	46%	0.456	S	S	.	.			trans	-114.2	136.8	171.3	-64	171.4	0	0	0	108.7	L83 P85 L89	I71-L83 HydrophobicContact CG2-CB 4.19Å; I71-L83 HydrophobicContact CG2-CD2 4.33Å; I71-P85 HydrophobicContact CD1-CB 4.34Å; I71-P85 HydrophobicContact CG1-CB 4.46Å; I71-P85 HydrophobicContact CG2-CB 4.35Å; I71-L89 HydrophobicContact CD1-CD1 4.37Å; I71-L89 HydrophobicContact CG1-CD1 3.63Å
72	Q	95.1	Very high	92.8	Very high	30 Å²	30	86.9 Å²	86.9	14%	0.14	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	137.8	175.7	-64.1	-174.5	92.5	0	0	110.3	V21 K23 L83 V84	V21-Q72 VanDerWaalsContact O-CG 3.27Å; V21-Q72 WeakPolarHBondContact O-CG 3.5Å; V21-Q72 PolarHBondContact O-NE2 3.38Å; V21-Q72 VanDerWaalsContact O-NE2 3.11Å; K23-Q72 PolarHBondContact O-NE2 2.9Å; K23-Q72 VanDerWaalsContact O-NE2 3.16Å; K23-Q72 PolarHBondContact O-OE1 2.8Å; Q72-L83 CarbonylContact O-C 3.58Å; Q72-L83 WeakPolarHBondContact O-CA 3.48Å; Q72-V84 HydrophobicContact CB-CB 4.33Å; Q72-V84 PolarHBondContact O-N 3.26Å
73	G	94.4	Very high	92.6	Very high	38 Å²	38	88.9 Å²	88.9	39%	0.392	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	129.4	172.8	0	0	0	0	0	110.6	K82	G73-K82 WeakPolarHBondContact CA-O 3.42Å
74	I	92.9	Very high	92.4	Very high	97 Å²	97	90 Å²	90	50%	0.497	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	119.8	177.9	-56.1	174	0	0	0	108	T76 K82 V84	I74-T76 PolarHBondContact O-N 3.1Å; I74-K82 HydrophobicContact CB-CB 4.43Å; I74-K82 PolarHBondContact N-O 3.45Å; I74-K82 PolarHBondContact O-N 3.46Å; I74-V84 HydrophobicContact CD1-CG2 3.9Å; I74-V84 HydrophobicContact CG1-CG2 4.33Å
75	H	91.3	Very high	92.2	Very high	156 Å²	156	88.7 Å²	88.7	72%	0.722	47%	0.474	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-61.2	136.6	173.8	-81.8	-85.3	0	0	0	110.1
76	T	89.4	Confident	92.1	Very high	51 Å²	51	85.5 Å²	85.5	31%	0.313	46%	0.455	S	S	.	.			trans	-109.1	167.8	170	79.1	0	0	0	0	109.5	I74 Q78 T80 K82	I74-T76 PolarHBondContact O-N 3.1Å; T76-Q78 PolarHBondContact O-N 3.17Å; T76-T80 PolarHBondContact N-O 2.77Å; T76-T80 PolarHBondContact OG1-O 3.01Å; T76-T80 VanDerWaalsContact OG1-O 3.12Å; T76-T80 PolarHBondContact OG1-OG1 3.33Å; T76-K82 HydrophobicContact CG2-CB 4.21Å
77	D	84.1	Confident	91.7	Very high	175 Å²	175	93.1 Å²	93.1	94%	0.936	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	-10.2	-174.8	-51.3	-33.5	0	0	0	113.9
78	Q	80.1	Confident	91.3	Very high	159 Å²	159	93.3 Å²	93.3	74%	0.743	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	-112.4	31.6	-170.6	-65.1	177.1	-17.9	0	0	113.7	T76 T80	T76-Q78 PolarHBondContact O-N 3.17Å; Q78-T80 PolarHBondContact O-N 3.48Å
79	N	87	Confident	91	Very high	162 Å²	162	92.5 Å²	92.5	87%	0.866	49%	0.488	S	S	*	.	S	Bend	trans	55.7	25.6	-176.1	-159.7	39.1	0	0	0	113.3
80	T	92.2	Very high	90.6	Very high	76 Å²	76	94 Å²	94	47%	0.466	49%	0.489	S	S	.	.			trans	-113.2	159.2	174.6	63.8	0	0	0	0	110.2	T76 Q78	T76-T80 PolarHBondContact N-O 2.77Å; T76-T80 PolarHBondContact OG1-O 3.01Å; T76-T80 VanDerWaalsContact OG1-O 3.12Å; T76-T80 PolarHBondContact OG1-OG1 3.33Å; Q78-T80 PolarHBondContact O-N 3.48Å
81	L	93	Very high	90.2	Very high	87 Å²	87	98.1 Å²	98.1	46%	0.455	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.4	123.1	-179.1	-167	75.2	0	0	0	109.2	L83	L81-L83 HydrophobicContact CD2-CD2 3.67Å; L81-L83 HydrophobicContact CG-CD2 4.23Å; L81-L83 PolarHBondContact O-N 3.26Å
82	K	93.6	Very high	89.6	Confident	133 Å²	133	102.7 Å²	102.7	58%	0.578	53%	0.534	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.8	110.4	168.9	-178.2	-179.2	179.5	178	0	108.9	G73 I74 T76	G73-K82 WeakPolarHBondContact CA-O 3.42Å; I74-K82 HydrophobicContact CB-CB 4.43Å; I74-K82 PolarHBondContact N-O 3.45Å; I74-K82 PolarHBondContact O-N 3.46Å; T76-K82 HydrophobicContact CG2-CB 4.21Å
83	L	93.8	Very high	88.8	Confident	106 Å²	106	109.2 Å²	109.2	56%	0.555	57%	0.57	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-77.6	139.4	172.9	-61	-178.6	0	0	0	110.8	I71 Q72 L81 P85	I71-L83 HydrophobicContact CG2-CB 4.19Å; I71-L83 HydrophobicContact CG2-CD2 4.33Å; Q72-L83 CarbonylContact O-C 3.58Å; Q72-L83 WeakPolarHBondContact O-CA 3.48Å; L81-L83 HydrophobicContact CD2-CD2 3.67Å; L81-L83 HydrophobicContact CG-CD2 4.23Å; L81-L83 PolarHBondContact O-N 3.26Å; L83-P85 VanDerWaalsContact C-CD 3.42Å; L83-P85 WeakPolarHBondContact O-CD 3.42Å
84	V	93.5	Very high	88.1	Confident	56 Å²	56	113.2 Å²	113.2	34%	0.339	59%	0.586	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-122.1	73.7	177.6	-170.6	0	0	0	0	108.6	Q72 I74	Q72-V84 HydrophobicContact CB-CB 4.33Å; Q72-V84 PolarHBondContact O-N 3.26Å; I74-V84 HydrophobicContact CD1-CG2 3.9Å; I74-V84 HydrophobicContact CG1-CG2 4.33Å
85	P	92.6	Very high	87.6	Confident	52 Å²	52	114 Å²	114	34%	0.338	60%	0.598	S	S	.	*			trans	-68.4	147.2	175.3	29.6	-34.3	0	0	0	110.5	I71 L83 L90	I71-P85 HydrophobicContact CD1-CB 4.34Å; I71-P85 HydrophobicContact CG1-CB 4.46Å; I71-P85 HydrophobicContact CG2-CB 4.35Å; L83-P85 VanDerWaalsContact C-CD 3.42Å; L83-P85 WeakPolarHBondContact O-CD 3.42Å; P85-L90 HydrophobicContact CB-CD2 3.86Å; P85-L90 HydrophobicContact CB-CG 4.5Å; P85-L90 HydrophobicContact CG-CD2 3.76Å
86	R	93.2	Very high	87	Confident	35 Å²	35	115.9 Å²	115.9	13%	0.132	60%	0.6	C	S	.	*			trans	-84.1	153.9	171	-62.5	179.4	-66.2	-77.9	-0.4	109.5	L66 R67 V70 D88 L89	L66-R86 PolarHBondContact O-NH2 3.49Å; L66-R86 VanDerWaalsContact O-NH2 3.08Å; R67-R86 PolarHBondContact O-NH2 3.48Å; V70-R86 VanDerWaalsContact O-CZ 3.25Å; V70-R86 PolarHBondContact O-NH1 2.9Å; V70-R86 PolarHBondContact O-NH2 2.95Å; R86-D88 WeakPolarHBondContact CB-OD1 3.45Å; R86-D88 IonicContact NE-OD1 3.97Å; R86-D88 PolarHBondContact O-N 3.15Å; R86-L89 HydrophobicContact CB-CG 4.47Å; R86-L89 WeakPolarHBondContact O-CB 3.29Å; R86-L89 PolarHBondContact O-N 3.32Å
87	K	87.6	Confident	86.7	Confident	191 Å²	191	117.2 Å²	117.2	83%	0.83	61%	0.61	S	S	*	*	G	3₁₀ helix	trans	-58.4	-34.8	-174.7	-69.2	-173.3	176.6	-174.2	0	113.2	L89 L90	K87-L89 PolarHBondContact O-N 3.45Å; K87-L90 PolarHBondContact O-N 3.3Å
88	D	86.2	Confident	86.6	Confident	96 Å²	96	115.4 Å²	115.4	51%	0.513	60%	0.601	S	S	.	*	G	3₁₀ helix	trans	-68.7	-13.9	177.7	58.5	-42.8	0	0	0	113.9	R86	R86-D88 WeakPolarHBondContact CB-OD1 3.45Å; R86-D88 IonicContact NE-OD1 3.97Å; R86-D88 PolarHBondContact O-N 3.15Å
89	L	87.3	Confident	86.7	Confident	41 Å²	41	110.7 Å²	110.7	22%	0.215	59%	0.589	C	S	.	*	G	3₁₀ helix	trans	-95.6	-13.4	175.1	-59.5	-177.6	0	0	0	113.3	T68 I71 R86 K87	T68-L89 VanDerWaalsContact C-CD2 3.47Å; T68-L89 WeakPolarHBondContact O-CD2 3.47Å; I71-L89 HydrophobicContact CD1-CD1 4.37Å; I71-L89 HydrophobicContact CG1-CD1 3.63Å; R86-L89 HydrophobicContact CB-CG 4.47Å; R86-L89 WeakPolarHBondContact O-CB 3.29Å; R86-L89 PolarHBondContact O-N 3.32Å; K87-L89 PolarHBondContact O-N 3.45Å
90	L	86.6	Confident	85.9	Confident	110 Å²	110	108.9 Å²	108.9	58%	0.576	59%	0.586	S	S	*	*	P	Polyproline II helix	trans	-81.8	129.4	-177.9	-63	177.1	0	0	0	109.4	P85 K87	P85-L90 HydrophobicContact CB-CD2 3.86Å; P85-L90 HydrophobicContact CB-CG 4.5Å; P85-L90 HydrophobicContact CG-CD2 3.76Å; K87-L90 PolarHBondContact O-N 3.3Å
91	V	84.6	Confident	84.8	Confident	128 Å²	128	111.2 Å²	111.2	78%	0.776	60%	0.6	S	S	*	*	P	Polyproline II helix	trans	-97.6	160.1	171.6	-63.5	0	0	0	0	109.8	N93	V91-N93 PolarHBondContact O-N 3.38Å
92	E	82.9	Confident	83.4	Confident	178 Å²	178	116.1 Å²	116.1	83%	0.832	62%	0.621	S	S	*	*	P	Polyproline II helix	trans	-58.1	136.6	170.9	-69.8	-175.6	177.1	0	0	109.8	V94	E92-V94 PolarHBondContact O-N 3.04Å
93	N	79.3	Confident	81.7	Confident	167 Å²	167	119.7 Å²	119.7	89%	0.893	64%	0.636	S	S	*	*			trans	-66.5	108	177.4	-76.1	-41.4	0	0	0	108.6	V91	V91-N93 PolarHBondContact O-N 3.38Å
94	V	78.9	Confident	79.5	Confident	122 Å²	122	127.4 Å²	127.4	74%	0.739	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-97	127.4	167.4	-174.1	0	0	0	0	106.8	E92 Y96	E92-V94 PolarHBondContact O-N 3.04Å; V94-Y96 PolarHBondContact O-N 3.24Å
95	P	82.6	Confident	78.8	Confident	114 Å²	114	131 Å²	131	74%	0.74	69%	0.686	S	S	*	*	P	Polyproline II helix	trans	-50.7	133.1	172.1	-25.7	34.1	0	0	0	109.8	C97	P95-C97 PolarHBondContact O-N 2.76Å
96	Y	79.1	Confident	78.1	Confident	195 Å²	195	135.2 Å²	135.2	77%	0.765	71%	0.705	S	S	*	*	P	Polyproline II helix	trans	-58.2	129	173.5	173.8	-95.4	0	0	0	109	V94 D98	V94-Y96 PolarHBondContact O-N 3.24Å; Y96-D98 WeakPolarHBondContact CE1-OD1 3.47Å; Y96-D98 VanDerWaalsContact CZ-OD1 3.31Å; Y96-D98 PolarHBondContact OH-OD1 3.33Å
97	C	81.8	Confident	77.2	Confident	78 Å²	78	140.7 Å²	140.7	53%	0.527	74%	0.736	S	S	.	*			trans	-127.2	122.1	179.9	-172.6	0	0	0	0	108.3	P95 A99	P95-C97 PolarHBondContact O-N 2.76Å; C97-A99 PolarHBondContact O-N 2.96Å; C97-A99 PolarHBondContact SG-O 3.05Å
98	D	82.8	Confident	76.6	Confident	138 Å²	138	137.8 Å²	137.8	74%	0.738	73%	0.731	S	S	*	*	S	Bend	trans	-64.8	-22	177.6	-70.2	-55.7	0	0	0	112.6	Y96	Y96-D98 WeakPolarHBondContact CE1-OD1 3.47Å; Y96-D98 VanDerWaalsContact CZ-OD1 3.31Å; Y96-D98 PolarHBondContact OH-OD1 3.33Å
99	A	81.9	Confident	76	Confident	60 Å²	60	140.4 Å²	140.4	50%	0.496	74%	0.744	S	S	.	*	S	Bend	trans	-98.7	122	174.8	0	0	0	0	0	110.1	C97 T101	C97-A99 PolarHBondContact O-N 2.96Å; C97-A99 PolarHBondContact SG-O 3.05Å; A99-T101 PolarHBondContact O-N 3.25Å; A99-T101 VanDerWaalsContact O-N 3.14Å
100	P	71.3	Confident	75.3	Confident	123 Å²	123	147 Å²	147	80%	0.799	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-62.7	119.9	174.2	24.1	-31	0	0	0	109.4	Q102	P100-Q102 PolarHBondContact O-N 3.35Å
101	T	69.2	Low	74.5	Confident	125 Å²	125	149.6 Å²	149.6	77%	0.767	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-61.9	127.7	170	30.5	0	0	0	0	109.3	A99 K103	A99-T101 PolarHBondContact O-N 3.25Å; A99-T101 VanDerWaalsContact O-N 3.14Å; T101-K103 PolarHBondContact O-N 3.48Å
102	Q	62.8	Low	73.7	Confident	190 Å²	190	151.3 Å²	151.3	89%	0.888	80%	0.796	S	S	*	*	P	Polyproline II helix	trans	-58.3	125.4	171.4	-68.4	-175.9	-1.7	0	0	108.5	P100 Q104	P100-Q102 PolarHBondContact O-N 3.35Å; Q102-Q104 PolarHBondContact O-N 3.28Å
103	K	58.5	Low	72.9	Confident	209 Å²	209	149.1 Å²	149.1	91%	0.909	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-64.7	121.7	171.7	-70.4	-175.8	176.5	-177.7	0	107.8	T101	T101-K103 PolarHBondContact O-N 3.48Å
104	Q	47	Very low	72.3	Confident	268 Å²	268	147.5 Å²	147.5	100%	1.252	78%	0.784	S	S	*	*			trans	-69.1	0	162.6	-77.1	-175.2	-10.2	0	0	110.2	Q102	Q102-Q104 PolarHBondContact O-N 3.28Å

Retrieved 104 of 104 residues in 284.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).