A0A096N511_PAPAN Loading...

Cancer/testis antigen 83

AlphaFold DB (Q4R717), UniProt , Accession A0A096N511, Species PAPAN (Papio anubis, Olive baboon), Gene CT83, Length 114 aa.

						>A0A096N511_PAPAN|A0A096N511|CT83
MNVYLLLASGILCALMTVFWKYRRFQRNTGEMSSNSTALALVRPSSTGLINSNTDNNLSVYDLSRDILNNFPHSIAMQKRILVNLTTVENKLVELEHILVSKGFRSASAHRKST
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.4	Confident	89.5	Confident	203 Å²	203	109.6 Å²	109.6	100%	1	59%	0.594	S	S	*	*				0	-33.9	0	-72.3	178	154.5	0	0	113.4	V3	M1-V3 PolarHBondContact O-N 3.49Å
2	N	83	Confident	89.9	Confident	122 Å²	122	109.2 Å²	109.2	65%	0.652	59%	0.59	S	S	*	*	H	α-helix	trans	-63.8	-34.5	177.6	-93	18.4	0	0	0	116	Y4 L5 L6	N2-Y4 VanDerWaalsContact C-N 3.27Å; N2-Y4 PolarHBondContact O-N 3.43Å; N2-L5 PolarHBondContact O-N 2.98Å; N2-L5 VanDerWaalsContact O-N 3.12Å; N2-L6 PolarHBondContact O-N 3.49Å
3	V	88.5	Confident	90.2	Very high	109 Å²	109	107 Å²	107	66%	0.661	59%	0.587	S	S	*	*	H	α-helix	trans	-61.6	-39.1	-176.8	-176.3	0	0	0	0	111.3	M1 L5 L6 L7	M1-V3 PolarHBondContact O-N 3.49Å; V3-L5 PolarHBondContact O-N 3.29Å; V3-L6 PolarHBondContact O-N 3.12Å; V3-L7 WeakPolarHBondContact O-CB 3.46Å; V3-L7 PolarHBondContact O-N 3.46Å
4	Y	89.3	Confident	90.5	Very high	186 Å²	186	103 Å²	103	73%	0.729	58%	0.575	S	S	*	*	H	α-helix	trans	-65.4	-37.8	176.2	-64.5	-70.5	0	0	0	112.5	N2 L7 A8	N2-Y4 VanDerWaalsContact C-N 3.27Å; N2-Y4 PolarHBondContact O-N 3.43Å; Y4-L7 PolarHBondContact O-N 3.33Å; Y4-A8 VanDerWaalsContact O-CB 3.26Å; Y4-A8 WeakPolarHBondContact O-CB 3.26Å; Y4-A8 PolarHBondContact O-N 3.43Å
5	L	88.7	Confident	90.7	Very high	119 Å²	119	103.4 Å²	103.4	62%	0.623	58%	0.575	S	S	*	*	H	α-helix	trans	-67	-41.1	176.2	-65.2	176.6	0	0	0	111.6	N2 V3 A8 S9	N2-L5 PolarHBondContact O-N 2.98Å; N2-L5 VanDerWaalsContact O-N 3.12Å; V3-L5 PolarHBondContact O-N 3.29Å; L5-A8 PolarHBondContact O-N 3.23Å; L5-S9 WeakPolarHBondContact O-CB 3.38Å; L5-S9 PolarHBondContact O-N 3.45Å; L5-S9 PolarHBondContact O-OG 3.37Å
6	L	91.6	Very high	90.9	Very high	119 Å²	119	105.1 Å²	105.1	62%	0.623	58%	0.579	S	S	*	*	H	α-helix	trans	-64.5	-40.5	174.5	-71.7	171.9	0	0	0	111.9	N2 V3 S9 G10	N2-L6 PolarHBondContact O-N 3.49Å; V3-L6 PolarHBondContact O-N 3.12Å; L6-S9 PolarHBondContact O-OG 2.86Å; L6-G10 PolarHBondContact O-N 3.33Å
7	L	93.7	Very high	90.9	Very high	111 Å²	111	104.4 Å²	104.4	58%	0.581	58%	0.578	S	S	*	*	H	α-helix	trans	-65.4	-47	176.9	-156.4	79.9	0	0	0	110.6	V3 Y4 G10 I11	V3-L7 WeakPolarHBondContact O-CB 3.46Å; V3-L7 PolarHBondContact O-N 3.46Å; Y4-L7 PolarHBondContact O-N 3.33Å; L7-G10 PolarHBondContact O-N 3.35Å; L7-I11 HydrophobicContact CG-CD1 4.31Å; L7-I11 WeakPolarHBondContact O-CD1 3.42Å; L7-I11 VanDerWaalsContact O-CG1 3.27Å; L7-I11 WeakPolarHBondContact O-CG1 3.33Å; L7-I11 PolarHBondContact O-N 2.9Å
8	A	93.6	Very high	90.8	Very high	44 Å²	44	103.9 Å²	103.9	36%	0.364	58%	0.579	S	S	.	*	H	α-helix	trans	-62.6	-43	177.7	0	0	0	0	0	111.9	Y4 L5 G10 I11 L12	Y4-A8 VanDerWaalsContact O-CB 3.26Å; Y4-A8 WeakPolarHBondContact O-CB 3.26Å; Y4-A8 PolarHBondContact O-N 3.43Å; L5-A8 PolarHBondContact O-N 3.23Å; A8-G10 VanDerWaalsContact C-N 3.34Å; A8-G10 PolarHBondContact O-N 3.44Å; A8-I11 PolarHBondContact O-N 2.89Å; A8-L12 WeakPolarHBondContact O-CB 3.27Å; A8-L12 VanDerWaalsContact O-CG 3.31Å; A8-L12 WeakPolarHBondContact O-CG 3.44Å; A8-L12 PolarHBondContact O-N 3.35Å
9	S	94.2	Very high	90.5	Very high	56 Å²	56	105.4 Å²	105.4	39%	0.392	58%	0.578	S	S	.	*	H	α-helix	trans	-65.1	-39.1	176	73.1	0	0	0	0	111.7	L5 L6 L12 C13	L5-S9 WeakPolarHBondContact O-CB 3.38Å; L5-S9 PolarHBondContact O-N 3.45Å; L5-S9 PolarHBondContact O-OG 3.37Å; L6-S9 PolarHBondContact O-OG 2.86Å; S9-L12 PolarHBondContact O-N 3.38Å; S9-C13 WeakPolarHBondContact O-CB 3.41Å; S9-C13 PolarHBondContact O-N 3.03Å; S9-C13 PolarHBondContact O-SG 3.3Å
10	G	94.8	Very high	90.2	Very high	40 Å²	40	109.4 Å²	109.4	41%	0.412	59%	0.585	S	S	.	*	H	α-helix	trans	-60.6	-45.4	175.7	0	0	0	0	0	112.3	L6 L7 A8 C13 A14	L6-G10 PolarHBondContact O-N 3.33Å; L7-G10 PolarHBondContact O-N 3.35Å; A8-G10 VanDerWaalsContact C-N 3.34Å; A8-G10 PolarHBondContact O-N 3.44Å; G10-C13 PolarHBondContact O-N 2.85Å; G10-A14 WeakPolarHBondContact O-CB 3.45Å; G10-A14 PolarHBondContact O-N 3.4Å
11	I	95.4	Very high	89.9	Confident	97 Å²	97	110.7 Å²	110.7	50%	0.497	59%	0.585	S	S	.	*	H	α-helix	trans	-63.4	-46.8	176.9	-65.6	159.4	0	0	0	110.7	L7 A8 C13 A14 L15	L7-I11 HydrophobicContact CG-CD1 4.31Å; L7-I11 WeakPolarHBondContact O-CD1 3.42Å; L7-I11 VanDerWaalsContact O-CG1 3.27Å; L7-I11 WeakPolarHBondContact O-CG1 3.33Å; L7-I11 PolarHBondContact O-N 2.9Å; A8-I11 PolarHBondContact O-N 2.89Å; I11-C13 PolarHBondContact O-N 2.94Å; I11-A14 PolarHBondContact O-N 3.37Å; I11-L15 HydrophobicContact CG2-CD1 4.12Å; I11-L15 WeakPolarHBondContact O-CG 3.35Å; I11-L15 PolarHBondContact O-N 3.34Å
12	L	94.7	Very high	90.4	Very high	104 Å²	104	108.1 Å²	108.1	55%	0.545	57%	0.565	S	S	.	*	H	α-helix	trans	-60.6	-44.2	177.8	-75.2	164.1	0	0	0	111.8	A8 S9 L15 M16	A8-L12 WeakPolarHBondContact O-CB 3.27Å; A8-L12 VanDerWaalsContact O-CG 3.31Å; A8-L12 WeakPolarHBondContact O-CG 3.44Å; A8-L12 PolarHBondContact O-N 3.35Å; S9-L12 PolarHBondContact O-N 3.38Å; L12-L15 PolarHBondContact O-N 3.45Å; L12-M16 VanDerWaalsContact O-CG 3.29Å; L12-M16 WeakPolarHBondContact O-CG 3.31Å; L12-M16 PolarHBondContact O-N 3.02Å
13	C	93.9	Very high	90.1	Very high	81 Å²	81	110.5 Å²	110.5	55%	0.547	57%	0.565	S	S	.	*	H	α-helix	trans	-60.6	-45.2	175.2	-75.7	0	0	0	0	111.7	S9 G10 I11 L15 M16 T17	S9-C13 WeakPolarHBondContact O-CB 3.41Å; S9-C13 PolarHBondContact O-N 3.03Å; S9-C13 PolarHBondContact O-SG 3.3Å; G10-C13 PolarHBondContact O-N 2.85Å; I11-C13 PolarHBondContact O-N 2.94Å; C13-L15 PolarHBondContact O-N 2.97Å; C13-M16 PolarHBondContact O-N 3.47Å; C13-T17 WeakPolarHBondContact O-CG2 3.42Å; C13-T17 PolarHBondContact O-N 3.04Å
14	A	93.8	Very high	89.2	Confident	51 Å²	51	113.1 Å²	113.1	42%	0.421	56%	0.563	S	S	.	*	H	α-helix	trans	-59.5	-48.2	177.5	0	0	0	0	0	111.4	G10 I11 M16 T17 V18	G10-A14 WeakPolarHBondContact O-CB 3.45Å; G10-A14 PolarHBondContact O-N 3.4Å; I11-A14 PolarHBondContact O-N 3.37Å; A14-M16 PolarHBondContact O-N 3.47Å; A14-T17 PolarHBondContact O-N 3.03Å; A14-T17 PolarHBondContact O-OG1 3.42Å; A14-V18 WeakPolarHBondContact O-CG2 3.49Å; A14-V18 PolarHBondContact O-N 2.85Å
15	L	94.1	Very high	87.7	Confident	109 Å²	109	110.2 Å²	110.2	57%	0.571	56%	0.555	S	S	*	*	H	α-helix	trans	-60.3	-43.2	177.7	-68.4	174	0	0	0	112.3	I11 L12 C13 T17 V18 F19	I11-L15 HydrophobicContact CG2-CD1 4.12Å; I11-L15 WeakPolarHBondContact O-CG 3.35Å; I11-L15 PolarHBondContact O-N 3.34Å; L12-L15 PolarHBondContact O-N 3.45Å; C13-L15 PolarHBondContact O-N 2.97Å; L15-T17 VanDerWaalsContact C-N 3.34Å; L15-T17 PolarHBondContact O-N 3.21Å; L15-V18 PolarHBondContact O-N 3.48Å; L15-F19 VanDerWaalsContact O-CB 3.32Å; L15-F19 WeakPolarHBondContact O-CB 3.21Å; L15-F19 PolarHBondContact O-N 3.26Å
16	M	93.2	Very high	86.4	Confident	131 Å²	131	110.8 Å²	110.8	65%	0.645	55%	0.554	S	S	*	*	H	α-helix	trans	-61.6	-40.5	177	-72.7	-64.9	-170.9	0	0	112.2	L12 C13 A14 F19 W20	L12-M16 VanDerWaalsContact O-CG 3.29Å; L12-M16 WeakPolarHBondContact O-CG 3.31Å; L12-M16 PolarHBondContact O-N 3.02Å; C13-M16 PolarHBondContact O-N 3.47Å; A14-M16 PolarHBondContact O-N 3.47Å; M16-F19 PolarHBondContact O-N 3.39Å; M16-W20 WeakPolarHBondContact O-CB 3.36Å; M16-W20 PolarHBondContact O-N 2.88Å
17	T	91.1	Very high	84.9	Confident	92 Å²	92	114.9 Å²	114.9	56%	0.564	56%	0.561	S	S	*	*	H	α-helix	trans	-68	-40.6	178	62.5	0	0	0	0	112.7	C13 A14 L15 W20 K21	C13-T17 WeakPolarHBondContact O-CG2 3.42Å; C13-T17 PolarHBondContact O-N 3.04Å; A14-T17 PolarHBondContact O-N 3.03Å; A14-T17 PolarHBondContact O-OG1 3.42Å; L15-T17 VanDerWaalsContact C-N 3.34Å; L15-T17 PolarHBondContact O-N 3.21Å; T17-W20 PolarHBondContact O-N 3.46Å; T17-K21 WeakPolarHBondContact O-CB 3.43Å; T17-K21 PolarHBondContact O-N 2.95Å
18	V	89	Confident	83	Confident	97 Å²	97	114 Å²	114	59%	0.588	56%	0.557	S	S	*	*	H	α-helix	trans	-64.6	-46.2	175.6	174	0	0	0	0	110.1	A14 L15 W20 K21 Y22	A14-V18 WeakPolarHBondContact O-CG2 3.49Å; A14-V18 PolarHBondContact O-N 2.85Å; L15-V18 PolarHBondContact O-N 3.48Å; V18-W20 PolarHBondContact O-N 3.3Å; V18-K21 PolarHBondContact O-N 2.95Å; V18-Y22 WeakPolarHBondContact O-CB 3.32Å; V18-Y22 PolarHBondContact O-N 2.99Å
19	F	84.9	Confident	81	Confident	131 Å²	131	117.6 Å²	117.6	58%	0.575	57%	0.574	S	S	*	*	H	α-helix	trans	-63.1	-42.7	178.7	-168.3	-97.1	0	0	0	111.8	L15 M16 Y22 R23	L15-F19 VanDerWaalsContact O-CB 3.32Å; L15-F19 WeakPolarHBondContact O-CB 3.21Å; L15-F19 PolarHBondContact O-N 3.26Å; M16-F19 PolarHBondContact O-N 3.39Å; F19-Y22 PolarHBondContact O-N 2.95Å; F19-R23 VanDerWaalsContact O-CB 3.27Å; F19-R23 WeakPolarHBondContact O-CB 3.43Å; F19-R23 PolarHBondContact O-N 3.43Å
20	W	85.7	Confident	78.9	Confident	186 Å²	186	117.9 Å²	117.9	71%	0.705	59%	0.586	S	S	*	*	H	α-helix	trans	-59.9	-48.8	174.6	-165.3	-44.7	0	0	0	110.9	M16 T17 V18 Y22 R23 R24	M16-W20 WeakPolarHBondContact O-CB 3.36Å; M16-W20 PolarHBondContact O-N 2.88Å; T17-W20 PolarHBondContact O-N 3.46Å; V18-W20 PolarHBondContact O-N 3.3Å; W20-Y22 PolarHBondContact O-N 3.38Å; W20-R23 PolarHBondContact O-N 3.39Å; W20-R24 PolarHBondContact O-N 2.98Å
21	K	82.9	Confident	76.6	Confident	137 Å²	137	124 Å²	124	60%	0.596	60%	0.604	S	S	*	*	H	α-helix	trans	-60.7	-47.2	179.6	-172.7	166	-179.9	178.8	0	110.9	T17 V18 R24 F25	T17-K21 WeakPolarHBondContact O-CB 3.43Å; T17-K21 PolarHBondContact O-N 2.95Å; V18-K21 PolarHBondContact O-N 2.95Å; K21-R24 PolarHBondContact O-N 2.85Å; K21-F25 HydrophobicContact CD-CE2 4.42Å; K21-F25 HydrophobicContact CG-CD2 3.97Å; K21-F25 HydrophobicContact CG-CE2 3.77Å; K21-F25 WeakPolarHBondContact O-CD2 3.29Å; K21-F25 PolarHBondContact O-N 2.97Å
22	Y	81.7	Confident	74.1	Confident	148 Å²	148	127.8 Å²	127.8	58%	0.58	62%	0.622	S	S	*	*	H	α-helix	trans	-60.2	-46.6	177.5	-174.1	-97.8	0	0	0	112.1	V18 F19 W20 R24 F25 Q26	V18-Y22 WeakPolarHBondContact O-CB 3.32Å; V18-Y22 PolarHBondContact O-N 2.99Å; F19-Y22 PolarHBondContact O-N 2.95Å; W20-Y22 PolarHBondContact O-N 3.38Å; Y22-R24 VanDerWaalsContact C-N 3.31Å; Y22-R24 PolarHBondContact O-N 2.95Å; Y22-F25 PolarHBondContact O-N 3.49Å; Y22-F25 VanDerWaalsContact O-N 3.13Å; Y22-Q26 PolarHBondContact O-N 3.29Å
23	R	77.1	Confident	71.6	Confident	172 Å²	172	127.8 Å²	127.8	65%	0.649	63%	0.631	S	S	*	*	H	α-helix	trans	-62.5	-37.4	177.8	-168.7	177.8	-171.3	-164.4	3.2	112.3	F19 W20 Q26 R27	F19-R23 VanDerWaalsContact O-CB 3.27Å; F19-R23 WeakPolarHBondContact O-CB 3.43Å; F19-R23 PolarHBondContact O-N 3.43Å; W20-R23 PolarHBondContact O-N 3.39Å; R23-Q26 PolarHBondContact O-N 3.03Å; R23-R27 PolarHBondContact O-N 3.48Å
24	R	69.5	Low	69.1	Low	165 Å²	165	129.8 Å²	129.8	62%	0.623	65%	0.646	S	S	*	*	H	α-helix	trans	-64	-43.2	173.8	-174.3	-172.8	-82.9	-126.5	2.6	111	W20 K21 Y22 R27 N28	W20-R24 PolarHBondContact O-N 2.98Å; K21-R24 PolarHBondContact O-N 2.85Å; Y22-R24 VanDerWaalsContact C-N 3.31Å; Y22-R24 PolarHBondContact O-N 2.95Å; R24-R27 PolarHBondContact O-N 2.88Å; R24-N28 PolarHBondContact O-N 2.92Å; R24-N28 PolarHBondContact O-OD1 2.92Å; R24-N28 VanDerWaalsContact O-OD1 3.07Å
25	F	58.5	Low	66.7	Low	124 Å²	124	133.8 Å²	133.8	54%	0.544	66%	0.66	S	S	.	*	H	α-helix	trans	-63.6	-41.8	175.4	-83.7	-73.2	0	0	0	112.1	K21 Y22 R27 N28 T29	K21-F25 HydrophobicContact CD-CE2 4.42Å; K21-F25 HydrophobicContact CG-CD2 3.97Å; K21-F25 HydrophobicContact CG-CE2 3.77Å; K21-F25 WeakPolarHBondContact O-CD2 3.29Å; K21-F25 PolarHBondContact O-N 2.97Å; Y22-F25 PolarHBondContact O-N 3.49Å; Y22-F25 VanDerWaalsContact O-N 3.13Å; F25-R27 VanDerWaalsContact C-N 3.28Å; F25-R27 PolarHBondContact O-N 2.97Å; F25-N28 PolarHBondContact O-N 2.87Å; F25-N28 VanDerWaalsContact O-N 3.11Å; F25-T29 PolarHBondContact O-N 3.37Å; F25-T29 PolarHBondContact O-OG1 3.15Å; F25-T29 VanDerWaalsContact O-OG1 3.1Å
26	Q	61.5	Low	64.1	Low	131 Å²	131	134.8 Å²	134.8	61%	0.612	68%	0.676	S	S	*	*	H	α-helix	trans	-61	-37.4	177.2	-165.6	177.3	24.6	0	0	112.2	Y22 R23 N28	Y22-Q26 PolarHBondContact O-N 3.29Å; R23-Q26 PolarHBondContact O-N 3.03Å; Q26-N28 VanDerWaalsContact C-N 3.34Å
27	R	58.8	Low	61.7	Low	206 Å²	206	134.4 Å²	134.4	78%	0.777	68%	0.681	S	S	*	*	H	α-helix	trans	-69.8	-31.8	176.6	-154.2	173.5	85.9	168.3	8.1	112.7	R23 R24 F25	R23-R27 PolarHBondContact O-N 3.48Å; R24-R27 PolarHBondContact O-N 2.88Å; F25-R27 VanDerWaalsContact C-N 3.28Å; F25-R27 PolarHBondContact O-N 2.97Å
28	N	55.5	Low	59.4	Low	93 Å²	93	134.1 Å²	134.1	50%	0.497	69%	0.688	S	S	.	*	H	α-helix	trans	-83.1	-21.7	-178.6	-61.7	8	0	0	0	112.9	R24 F25 Q26 G30	R24-N28 PolarHBondContact O-N 2.92Å; R24-N28 PolarHBondContact O-OD1 2.92Å; R24-N28 VanDerWaalsContact O-OD1 3.07Å; F25-N28 PolarHBondContact O-N 2.87Å; F25-N28 VanDerWaalsContact O-N 3.11Å; Q26-N28 VanDerWaalsContact C-N 3.34Å; N28-G30 PolarHBondContact O-N 3.32Å
29	T	51.2	Low	57.2	Low	118 Å²	118	138.2 Å²	138.2	72%	0.724	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.9	-11.5	174.5	-55.9	0	0	0	0	112.7	F25	F25-T29 PolarHBondContact O-N 3.37Å; F25-T29 PolarHBondContact O-OG1 3.15Å; F25-T29 VanDerWaalsContact O-OG1 3.1Å
30	G	50.6	Low	55.2	Low	62 Å²	62	136.7 Å²	136.7	64%	0.639	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	-9.9	176.5	0	0	0	0	0	115.7	N28 M32	N28-G30 PolarHBondContact O-N 3.32Å; G30-M32 PolarHBondContact O-N 3.42Å
31	E	45.8	Very low	53	Low	170 Å²	170	135.7 Å²	135.7	79%	0.794	73%	0.725	S	S	*	*			trans	-100.3	58	-178.8	-63.1	-166.3	150	0	0	111.2
32	M	41.7	Very low	50.7	Low	175 Å²	175	134.4 Å²	134.4	86%	0.862	73%	0.728	S	S	*	*			trans	-136.8	72.7	168	-164.1	93	95.8	0	0	109.8	G30	G30-M32 PolarHBondContact O-N 3.42Å
33	S	42.7	Very low	48.7	Very low	104 Å²	104	138 Å²	138	73%	0.727	74%	0.741	S	S	*	*			trans	-149.8	106.8	152.1	71.4	0	0	0	0	110.5
34	S	42.3	Very low	47.1	Very low	124 Å²	124	135.2 Å²	135.2	87%	0.867	75%	0.745	S	S	*	*			trans	-59.5	122.7	174.5	-46.7	0	0	0	0	112.1
35	N	42.8	Very low	45.6	Very low	135 Å²	135	132.2 Å²	132.2	72%	0.722	75%	0.75	S	S	*	*			trans	-150.7	58.3	157.5	58.7	-16.4	0	0	0	110.5	T37	N35-T37 PolarHBondContact O-N 3.39Å
36	S	40.3	Very low	44.5	Very low	129 Å²	129	131.7 Å²	131.7	90%	0.902	76%	0.761	S	S	*	*			trans	-79.3	67.7	156.1	-165.4	0	0	0	0	108.3	A38	S36-A38 PolarHBondContact O-N 2.98Å
37	T	42.6	Very low	43.5	Very low	124 Å²	124	132.1 Å²	132.1	76%	0.761	77%	0.773	S	S	*	*			trans	-87.6	99.1	168.6	-54.4	0	0	0	0	106.3	N35 L39	N35-T37 PolarHBondContact O-N 3.39Å; T37-L39 PolarHBondContact O-N 3.48Å
38	A	43.3	Very low	42.6	Very low	86 Å²	86	125.8 Å²	125.8	71%	0.711	77%	0.772	S	S	*	*			trans	-46.9	127.4	171.5	0	0	0	0	0	110.3	S36 A40	S36-A38 PolarHBondContact O-N 2.98Å; A38-A40 PolarHBondContact O-N 2.75Å; A38-A40 VanDerWaalsContact O-N 3.12Å
39	L	42.3	Very low	41.7	Very low	182 Å²	182	129.7 Å²	129.7	95%	0.953	79%	0.792	S	S	*	*			trans	-50.6	107.9	176.2	-67.6	156.7	0	0	0	111	T37	T37-L39 PolarHBondContact O-N 3.48Å
40	A	41.5	Very low	41	Very low	100 Å²	100	131.2 Å²	131.2	83%	0.826	79%	0.794	S	S	*	*			trans	-115.6	110.8	157.6	0	0	0	0	0	108.2	A38	A38-A40 PolarHBondContact O-N 2.75Å; A38-A40 VanDerWaalsContact O-N 3.12Å
41	L	39.5	Very low	40.5	Very low	165 Å²	165	135 Å²	135	86%	0.864	80%	0.8	S	S	*	*			trans	-68	119	-166.3	-174	83.3	0	0	0	112.7
42	V	36.5	Very low	40.4	Very low	109 Å²	109	131.5 Å²	131.5	66%	0.661	79%	0.794	S	S	*	*			trans	58.7	113.1	133.4	-174.5	0	0	0	0	119	P44	V42-P44 HydrophobicContact CG1-CG 3.97Å
43	R	38.7	Very low	40.3	Very low	225 Å²	225	129.3 Å²	129.3	85%	0.849	79%	0.785	S	S	*	*				-133.8	115.8	127.4	-171.6	176.2	178.2	102.5	-1.8	108
44	P	44.1	Very low	40.4	Very low	112 Å²	112	129.3 Å²	129.3	73%	0.727	78%	0.781	S	S	*	*			trans	-94.9	118.1	-174.1	32.1	-19.7	0	0	0	109.3	V42	V42-P44 HydrophobicContact CG1-CG 3.97Å
45	S	36.7	Very low	40.7	Very low	103 Å²	103	130.7 Å²	130.7	72%	0.72	78%	0.779	S	S	*	*			trans	-156.8	92.5	169.1	48.2	0	0	0	0	109.6
46	S	37.3	Very low	41.2	Very low	113 Å²	113	130.9 Å²	130.9	79%	0.79	78%	0.78	S	S	*	*			trans	164.1	97.8	139.4	-175.7	0	0	0	0	109.6
47	T	38.9	Very low	41.9	Very low	140 Å²	140	131.5 Å²	131.5	86%	0.859	77%	0.773	S	S	*	*			trans	18.5	112.6	136.3	-44.7	0	0	0	0	118.2
48	G	39.4	Very low	42.5	Very low	73 Å²	73	131.4 Å²	131.4	75%	0.753	77%	0.767	S	S	*	*				95.4	87.4	129.8	0	0	0	0	0	118.1
49	L	36.8	Very low	43.3	Very low	174 Å²	174	129.3 Å²	129.3	91%	0.911	75%	0.748	S	S	*	*				-168.6	104.6	118.2	-159.9	81.1	0	0	0	108.2
50	I	38.3	Very low	44.3	Very low	150 Å²	150	126.8 Å²	126.8	77%	0.769	74%	0.739	S	S	*	*			trans	-70.5	127.4	165.9	-52.4	173.6	0	0	0	106.1
51	N	39.9	Very low	45.4	Very low	143 Å²	143	129.6 Å²	129.6	77%	0.765	73%	0.729	S	S	*	*			trans	167.8	87	132	-81.2	-1	0	0	0	109.2
52	S	42.3	Very low	46.8	Very low	96 Å²	96	125.4 Å²	125.4	67%	0.671	71%	0.708	S	S	*	*			trans	-47.8	133.3	142.9	50.6	0	0	0	0	110.1
53	N	41.3	Very low	48.3	Very low	128 Å²	128	124.3 Å²	124.3	68%	0.684	70%	0.698	S	S	*	*			trans	160.3	95.4	131	-76.6	-17.8	0	0	0	108.7	D55	N53-D55 PolarHBondContact O-N 3.05Å
54	T	43.6	Very low	49.7	Very low	104 Å²	104	116.5 Å²	116.5	64%	0.638	68%	0.678	S	S	*	*				46.9	52.7	120	-34.9	0	0	0	0	116.5	N56	T54-N56 VanDerWaalsContact CG2-CG 3.41Å; T54-N56 VanDerWaalsContact CG2-ND2 3.26Å; T54-N56 WeakPolarHBondContact CG2-ND2 3.42Å; T54-N56 WeakPolarHBondContact CG2-OD1 3.35Å; T54-N56 PolarHBondContact O-N 3.22Å
55	D	47.8	Very low	50.8	Low	153 Å²	153	118.6 Å²	118.6	82%	0.818	67%	0.671	S	S	*	*			trans	-79.6	78.4	156.5	-82.2	-28.3	0	0	0	107.8	N53 N57	N53-D55 PolarHBondContact O-N 3.05Å; D55-N57 PolarHBondContact O-N 3.25Å
56	N	55	Low	52.2	Low	139 Å²	139	118.4 Å²	118.4	74%	0.743	66%	0.662	S	S	*	*			trans	-64.7	14.7	169.3	-64	-11.4	0	0	0	112.7	T54 L58	T54-N56 VanDerWaalsContact CG2-CG 3.41Å; T54-N56 VanDerWaalsContact CG2-ND2 3.26Å; T54-N56 WeakPolarHBondContact CG2-ND2 3.42Å; T54-N56 WeakPolarHBondContact CG2-OD1 3.35Å; T54-N56 PolarHBondContact O-N 3.22Å; N56-L58 PolarHBondContact O-N 3.03Å
57	N	54.3	Low	53.5	Low	142 Å²	142	116.5 Å²	116.5	76%	0.759	64%	0.643	S	S	*	*			trans	-80.6	58	167	-125.4	-0.6	0	0	0	107.9	D55 S59	D55-N57 PolarHBondContact O-N 3.25Å; N57-S59 PolarHBondContact O-N 3.02Å
58	L	55.6	Low	54.6	Low	123 Å²	123	114.9 Å²	114.9	64%	0.644	63%	0.628	S	S	*	*			trans	-62	87	162.6	-166.9	116.5	0	0	0	105.1	N56 V60 L63	N56-L58 PolarHBondContact O-N 3.03Å; L58-V60 PolarHBondContact O-N 3.42Å; L58-L63 HydrophobicContact CD2-CB 3.87Å; L58-L63 HydrophobicContact CD2-CD1 4.28Å; L58-L63 HydrophobicContact CD2-CD2 4.37Å; L58-L63 HydrophobicContact CD2-CG 4.39Å
59	S	59.5	Low	55.7	Low	42 Å²	42	117.6 Å²	117.6	29%	0.294	63%	0.625	S	S	.	*			trans	-60.2	137.6	-173.4	78.1	0	0	0	0	106.1	N57 Y61 D62 L63	N57-S59 PolarHBondContact O-N 3.02Å; S59-Y61 PolarHBondContact O-N 3.05Å; S59-D62 PolarHBondContact O-N 3.1Å; S59-D62 VanDerWaalsContact OG-CG 3.29Å; S59-D62 PolarHBondContact OG-N 3.37Å; S59-D62 PolarHBondContact OG-OD2 2.91Å; S59-L63 PolarHBondContact O-N 3.28Å
60	V	63.1	Low	57	Low	128 Å²	128	113.9 Å²	113.9	78%	0.776	61%	0.606	S	S	*	*	H	α-helix	trans	-50.8	-26.2	177.8	174.1	0	0	0	0	111.1	L58 S64	L58-V60 PolarHBondContact O-N 3.42Å; V60-S64 VanDerWaalsContact O-CB 3.26Å; V60-S64 WeakPolarHBondContact O-CB 3.48Å; V60-S64 PolarHBondContact O-N 3.23Å
61	Y	65.2	Low	58.1	Low	159 Å²	159	112.5 Å²	112.5	62%	0.624	60%	0.595	S	S	*	*	H	α-helix	trans	-64.2	-45.6	174.5	-170.6	-100.8	0	0	0	113.8	S59 S64 R65	S59-Y61 PolarHBondContact O-N 3.05Å; Y61-S64 PolarHBondContact O-N 3.47Å; Y61-R65 HydrophobicContact CE1-CG 4.28Å; Y61-R65 PolarHBondContact O-N 3.33Å
62	D	69.2	Low	59.2	Low	78 Å²	78	110 Å²	110	42%	0.417	59%	0.587	S	S	.	*	H	α-helix	trans	-69	-41.3	179.9	-62.7	-46	0	0	0	111.3	S59 S64 R65 D66	S59-D62 PolarHBondContact O-N 3.1Å; S59-D62 VanDerWaalsContact OG-CG 3.29Å; S59-D62 PolarHBondContact OG-N 3.37Å; S59-D62 PolarHBondContact OG-OD2 2.91Å; D62-S64 VanDerWaalsContact C-N 3.31Å; D62-S64 PolarHBondContact O-N 3.09Å; D62-R65 PolarHBondContact O-N 3.07Å; D62-D66 PolarHBondContact O-N 3.49Å
63	L	66.9	Low	60.3	Low	86 Å²	86	112.2 Å²	112.2	45%	0.45	59%	0.586	S	S	.	*	H	α-helix	trans	-62.3	-40.8	173.6	-175	62.9	0	0	0	111.5	L58 S59 D66 I67	L58-L63 HydrophobicContact CD2-CB 3.87Å; L58-L63 HydrophobicContact CD2-CD1 4.28Å; L58-L63 HydrophobicContact CD2-CD2 4.37Å; L58-L63 HydrophobicContact CD2-CG 4.39Å; S59-L63 PolarHBondContact O-N 3.28Å; L63-D66 PolarHBondContact O-N 2.83Å; L63-I67 HydrophobicContact CD1-CD1 4.15Å; L63-I67 HydrophobicContact CD1-CG1 4.38Å; L63-I67 HydrophobicContact CG-CD1 3.88Å; L63-I67 HydrophobicContact CG-CG1 4.49Å; L63-I67 WeakPolarHBondContact O-CB 3.42Å; L63-I67 VanDerWaalsContact O-CG1 3.23Å; L63-I67 WeakPolarHBondContact O-CG1 3.3Å; L63-I67 PolarHBondContact O-N 3.48Å
64	S	67.6	Low	62	Low	61 Å²	61	107.6 Å²	107.6	43%	0.427	56%	0.564	S	S	.	*	H	α-helix	trans	-63.1	-43.7	176.4	-176.1	0	0	0	0	111.3	V60 Y61 D62 I67 L68	V60-S64 VanDerWaalsContact O-CB 3.26Å; V60-S64 WeakPolarHBondContact O-CB 3.48Å; V60-S64 PolarHBondContact O-N 3.23Å; Y61-S64 PolarHBondContact O-N 3.47Å; D62-S64 VanDerWaalsContact C-N 3.31Å; D62-S64 PolarHBondContact O-N 3.09Å; S64-I67 PolarHBondContact O-N 3.46Å; S64-L68 WeakPolarHBondContact O-CB 3.32Å; S64-L68 PolarHBondContact O-N 3.5Å
65	R	68.5	Low	63.6	Low	156 Å²	156	105.3 Å²	105.3	59%	0.589	55%	0.547	S	S	*	.	H	α-helix	trans	-62.4	-44.3	174	-82.3	-174.4	83.4	-161	7.9	111.8	Y61 D62 I67 L68 N69	Y61-R65 HydrophobicContact CE1-CG 4.28Å; Y61-R65 PolarHBondContact O-N 3.33Å; D62-R65 PolarHBondContact O-N 3.07Å; R65-I67 VanDerWaalsContact C-N 3.35Å; R65-I67 PolarHBondContact O-N 2.87Å; R65-L68 PolarHBondContact O-N 3.27Å; R65-N69 WeakPolarHBondContact O-CB 3.33Å; R65-N69 PolarHBondContact O-N 3.48Å
66	D	65.2	Low	65.2	Low	98 Å²	98	100.3 Å²	100.3	52%	0.524	53%	0.527	S	S	.	.	H	α-helix	trans	-63.9	-40.6	179.1	-101.5	2	0	0	0	111.9	D62 L63 N70	D62-D66 PolarHBondContact O-N 3.49Å; L63-D66 PolarHBondContact O-N 2.83Å; D66-N70 WeakPolarHBondContact O-CB 3.27Å; D66-N70 PolarHBondContact O-N 3.36Å; D66-N70 PolarHBondContact O-ND2 3.43Å; D66-N70 PolarHBondContact OD1-ND2 2.85Å
67	I	64.7	Low	66.5	Low	74 Å²	74	98.8 Å²	98.8	38%	0.379	52%	0.516	S	S	.	.	H	α-helix	trans	-66.1	-44.8	175.5	-66.8	167.6	0	0	0	110.6	L63 S64 R65 F71	L63-I67 HydrophobicContact CD1-CD1 4.15Å; L63-I67 HydrophobicContact CD1-CG1 4.38Å; L63-I67 HydrophobicContact CG-CD1 3.88Å; L63-I67 HydrophobicContact CG-CG1 4.49Å; L63-I67 WeakPolarHBondContact O-CB 3.42Å; L63-I67 VanDerWaalsContact O-CG1 3.23Å; L63-I67 WeakPolarHBondContact O-CG1 3.3Å; L63-I67 PolarHBondContact O-N 3.48Å; S64-I67 PolarHBondContact O-N 3.46Å; R65-I67 VanDerWaalsContact C-N 3.35Å; R65-I67 PolarHBondContact O-N 2.87Å; I67-F71 WeakPolarHBondContact O-CB 3.48Å; I67-F71 PolarHBondContact O-N 3.42Å; I67-F71 VanDerWaalsContact O-N 3.16Å
68	L	61.9	Low	67.7	Low	105 Å²	105	97.1 Å²	97.1	55%	0.55	50%	0.504	S	S	.	.	H	α-helix	trans	-65	-42.7	179.6	-118.9	100.2	0	0	0	112.1	S64 R65 I75	S64-L68 WeakPolarHBondContact O-CB 3.32Å; S64-L68 PolarHBondContact O-N 3.5Å; R65-L68 PolarHBondContact O-N 3.27Å; L68-I75 HydrophobicContact CD2-CD1 4.15Å; L68-I75 HydrophobicContact CG-CD1 3.82Å
69	N	63.2	Low	69.2	Low	130 Å²	130	98 Å²	98	70%	0.695	50%	0.503	S	S	*	.	H	α-helix	trans	-84.7	-38.5	-170.3	-158.3	43.3	0	0	0	112.1	R65	R65-N69 WeakPolarHBondContact O-CB 3.33Å; R65-N69 PolarHBondContact O-N 3.48Å
70	N	64.5	Low	70.5	Confident	96 Å²	96	104.7 Å²	104.7	51%	0.513	52%	0.522	S	S	.	.	H	α-helix	trans	-83	-20.4	178.7	-62.6	-51.4	0	0	0	112.8	D66 P72	D66-N70 WeakPolarHBondContact O-CB 3.27Å; D66-N70 PolarHBondContact O-N 3.36Å; D66-N70 PolarHBondContact O-ND2 3.43Å; D66-N70 PolarHBondContact OD1-ND2 2.85Å; N70-P72 VanDerWaalsContact C-CD 3.47Å
71	F	61.5	Low	71.6	Confident	122 Å²	122	102.6 Å²	102.6	54%	0.535	51%	0.505	S	S	.	.			trans	-129.1	66.6	-178.8	-56.9	-86.3	0	0	0	112.8	I67 H73 S74 I75	I67-F71 WeakPolarHBondContact O-CB 3.48Å; I67-F71 PolarHBondContact O-N 3.42Å; I67-F71 VanDerWaalsContact O-N 3.16Å; F71-H73 PolarHBondContact O-N 2.88Å; F71-H73 VanDerWaalsContact O-N 3.09Å; F71-S74 VanDerWaalsContact CB-CB 3.42Å; F71-S74 WeakPolarHBondContact O-CA 3.37Å; F71-S74 VanDerWaalsContact O-CB 3.25Å; F71-S74 WeakPolarHBondContact O-CB 3.31Å; F71-S74 PolarHBondContact O-N 2.76Å; F71-I75 PolarHBondContact O-N 3.05Å
72	P	61.9	Low	73	Confident	91 Å²	91	100.2 Å²	100.2	59%	0.591	50%	0.503	S	S	*	.	H	α-helix	trans	-53.7	-29.8	163.9	23.4	-32.8	0	0	0	111.3	N70 S74 I75 A76	N70-P72 VanDerWaalsContact C-CD 3.47Å; P72-S74 VanDerWaalsContact C-N 3.33Å; P72-S74 PolarHBondContact O-N 3.49Å; P72-I75 PolarHBondContact O-N 3.1Å; P72-A76 PolarHBondContact O-N 2.98Å
73	H	66.6	Low	74.1	Confident	141 Å²	141	100.9 Å²	100.9	65%	0.653	51%	0.51	S	S	*	.	H	α-helix	trans	-63.1	-35	172.3	-163.1	70.7	0	0	0	113.3	F71 A76 M77	F71-H73 PolarHBondContact O-N 2.88Å; F71-H73 VanDerWaalsContact O-N 3.09Å; H73-A76 PolarHBondContact O-N 3.17Å; H73-M77 VanDerWaalsContact O-CB 3.32Å; H73-M77 WeakPolarHBondContact O-CB 3.32Å; H73-M77 PolarHBondContact O-N 2.95Å
74	S	75.3	Confident	75.3	Confident	32 Å²	32	101.7 Å²	101.7	22%	0.224	51%	0.514	C	S	.	.	H	α-helix	trans	-65.4	-41.3	176.9	179.9	0	0	0	0	111.1	F71 P72 A76 M77 Q78	F71-S74 VanDerWaalsContact CB-CB 3.42Å; F71-S74 WeakPolarHBondContact O-CA 3.37Å; F71-S74 VanDerWaalsContact O-CB 3.25Å; F71-S74 WeakPolarHBondContact O-CB 3.31Å; F71-S74 PolarHBondContact O-N 2.76Å; P72-S74 VanDerWaalsContact C-N 3.33Å; P72-S74 PolarHBondContact O-N 3.49Å; S74-A76 PolarHBondContact O-N 3.26Å; S74-M77 PolarHBondContact O-N 3.18Å; S74-Q78 VanDerWaalsContact O-CB 3.31Å; S74-Q78 WeakPolarHBondContact O-CB 3.43Å; S74-Q78 WeakPolarHBondContact O-CG 3.21Å; S74-Q78 PolarHBondContact O-N 3.49Å; S74-Q78 PolarHBondContact OG-NE2 2.86Å
75	I	77.8	Confident	76.6	Confident	56 Å²	56	103.9 Å²	103.9	29%	0.287	52%	0.521	S	S	.	.	H	α-helix	trans	-63.8	-44.5	177.4	-55.3	173.2	0	0	0	110.6	L68 F71 P72 M77 Q78 K79	L68-I75 HydrophobicContact CD2-CD1 4.15Å; L68-I75 HydrophobicContact CG-CD1 3.82Å; F71-I75 PolarHBondContact O-N 3.05Å; P72-I75 PolarHBondContact O-N 3.1Å; I75-M77 VanDerWaalsContact C-N 3.32Å; I75-M77 PolarHBondContact O-N 3.28Å; I75-Q78 PolarHBondContact O-N 2.92Å; I75-K79 HydrophobicContact CG2-CD 4.46Å; I75-K79 WeakPolarHBondContact O-CB 3.49Å; I75-K79 WeakPolarHBondContact O-CG 3.44Å; I75-K79 PolarHBondContact O-N 3.49Å
76	A	81.2	Confident	77.9	Confident	47 Å²	47	99.5 Å²	99.5	39%	0.388	51%	0.511	S	S	.	.	H	α-helix	trans	-62.3	-41.4	176.7	0	0	0	0	0	111.6	P72 H73 S74 R80	P72-A76 PolarHBondContact O-N 2.98Å; H73-A76 PolarHBondContact O-N 3.17Å; S74-A76 PolarHBondContact O-N 3.26Å; A76-R80 WeakPolarHBondContact O-CG 3.37Å; A76-R80 PolarHBondContact O-N 2.94Å
77	M	82.4	Confident	79.4	Confident	107 Å²	107	98.4 Å²	98.4	53%	0.527	51%	0.508	S	S	.	.	H	α-helix	trans	-65.7	-44.9	176	-172.8	176.3	179.6	0	0	111.8	H73 S74 I75 K79 R80 I81	H73-M77 VanDerWaalsContact O-CB 3.32Å; H73-M77 WeakPolarHBondContact O-CB 3.32Å; H73-M77 PolarHBondContact O-N 2.95Å; S74-M77 PolarHBondContact O-N 3.18Å; I75-M77 VanDerWaalsContact C-N 3.32Å; I75-M77 PolarHBondContact O-N 3.28Å; M77-K79 PolarHBondContact O-N 3.38Å; M77-R80 WeakPolarHBondContact O-CB 3.41Å; M77-R80 PolarHBondContact O-N 3.28Å; M77-I81 HydrophobicContact CE-CD1 4.25Å; M77-I81 HydrophobicContact CG-CD1 3.95Å; M77-I81 VanDerWaalsContact O-CG1 3.27Å; M77-I81 WeakPolarHBondContact O-CG1 3.38Å; M77-I81 PolarHBondContact O-N 3.4Å
78	Q	80.6	Confident	80.9	Confident	108 Å²	108	99.4 Å²	99.4	51%	0.505	52%	0.518	S	S	.	.	H	α-helix	trans	-60.7	-43.5	176.1	-74.4	174.4	39.7	0	0	111.5	S74 I75 I81 L82	S74-Q78 VanDerWaalsContact O-CB 3.31Å; S74-Q78 WeakPolarHBondContact O-CB 3.43Å; S74-Q78 WeakPolarHBondContact O-CG 3.21Å; S74-Q78 PolarHBondContact O-N 3.49Å; S74-Q78 PolarHBondContact OG-NE2 2.86Å; I75-Q78 PolarHBondContact O-N 2.92Å; Q78-I81 PolarHBondContact O-N 3.07Å; Q78-L82 WeakPolarHBondContact O-CB 3.35Å; Q78-L82 PolarHBondContact O-N 3.36Å
79	K	85.8	Confident	82.5	Confident	142 Å²	142	100.3 Å²	100.3	62%	0.617	52%	0.519	S	S	*	.	H	α-helix	trans	-61.1	-43.8	173.7	-76.1	-177.5	178.5	-176.4	0	111.9	I75 M77 L82 V83	I75-K79 HydrophobicContact CG2-CD 4.46Å; I75-K79 WeakPolarHBondContact O-CB 3.49Å; I75-K79 WeakPolarHBondContact O-CG 3.44Å; I75-K79 PolarHBondContact O-N 3.49Å; M77-K79 PolarHBondContact O-N 3.38Å; K79-L82 PolarHBondContact O-N 2.88Å; K79-V83 WeakPolarHBondContact O-CG2 3.26Å; K79-V83 PolarHBondContact O-N 3.13Å
80	R	86.3	Confident	84	Confident	182 Å²	182	99 Å²	99	69%	0.687	51%	0.512	S	S	*	.	H	α-helix	trans	-62.3	-43.5	175.7	-75.7	176.8	179.1	-170.3	-0.2	111.9	A76 M77 L82 V83 N84	A76-R80 WeakPolarHBondContact O-CG 3.37Å; A76-R80 PolarHBondContact O-N 2.94Å; M77-R80 WeakPolarHBondContact O-CB 3.41Å; M77-R80 PolarHBondContact O-N 3.28Å; R80-L82 VanDerWaalsContact C-N 3.35Å; R80-V83 PolarHBondContact O-N 3.48Å; R80-N84 WeakPolarHBondContact O-CB 3.08Å; R80-N84 PolarHBondContact O-N 2.79Å; R80-N84 PolarHBondContact O-OD1 3.25Å
81	I	88	Confident	85.6	Confident	83 Å²	83	100 Å²	100	43%	0.426	51%	0.512	S	S	.	.	H	α-helix	trans	-60.7	-46.7	176.2	-69.7	165.1	0	0	0	109.9	M77 Q78 V83 N84 L85	M77-I81 HydrophobicContact CE-CD1 4.25Å; M77-I81 HydrophobicContact CG-CD1 3.95Å; M77-I81 VanDerWaalsContact O-CG1 3.27Å; M77-I81 WeakPolarHBondContact O-CG1 3.38Å; M77-I81 PolarHBondContact O-N 3.4Å; Q78-I81 PolarHBondContact O-N 3.07Å; I81-V83 PolarHBondContact O-N 3.03Å; I81-N84 PolarHBondContact O-N 2.97Å; I81-L85 HydrophobicContact CG2-CD1 3.96Å; I81-L85 HydrophobicContact CG2-CG 4.36Å; I81-L85 WeakPolarHBondContact O-CG 3.33Å; I81-L85 PolarHBondContact O-N 2.98Å
82	L	93	Very high	87.2	Confident	110 Å²	110	99.8 Å²	99.8	58%	0.576	52%	0.516	S	S	*	.	H	α-helix	trans	-59.6	-49.1	178.9	-177.4	62.4	0	0	0	111.9	Q78 K79 R80 N84 L85 T86	Q78-L82 WeakPolarHBondContact O-CB 3.35Å; Q78-L82 PolarHBondContact O-N 3.36Å; K79-L82 PolarHBondContact O-N 2.88Å; R80-L82 VanDerWaalsContact C-N 3.35Å; L82-N84 VanDerWaalsContact C-N 3.31Å; L82-N84 PolarHBondContact O-N 3.33Å; L82-L85 PolarHBondContact O-N 3.46Å; L82-T86 PolarHBondContact O-N 2.87Å; L82-T86 PolarHBondContact O-OG1 3.26Å
83	V	93.5	Very high	88.8	Confident	92 Å²	92	99.4 Å²	99.4	56%	0.558	51%	0.512	S	S	*	.	H	α-helix	trans	-60.8	-40.8	177.6	170.6	0	0	0	0	111.6	K79 R80 I81 T86 T87	K79-V83 WeakPolarHBondContact O-CG2 3.26Å; K79-V83 PolarHBondContact O-N 3.13Å; R80-V83 PolarHBondContact O-N 3.48Å; I81-V83 PolarHBondContact O-N 3.03Å; V83-T86 PolarHBondContact O-N 3.2Å; V83-T87 WeakPolarHBondContact O-CB 3.26Å; V83-T87 PolarHBondContact O-N 2.95Å; V83-T87 PolarHBondContact O-OG1 3.32Å
84	N	92.3	Very high	90.1	Very high	103 Å²	103	97.3 Å²	97.3	55%	0.551	50%	0.502	S	S	*	.	H	α-helix	trans	-63.5	-43.4	176.6	-74.1	-4.1	0	0	0	111.5	R80 I81 L82 T87 V88	R80-N84 WeakPolarHBondContact O-CB 3.08Å; R80-N84 PolarHBondContact O-N 2.79Å; R80-N84 PolarHBondContact O-OD1 3.25Å; I81-N84 PolarHBondContact O-N 2.97Å; L82-N84 VanDerWaalsContact C-N 3.31Å; L82-N84 PolarHBondContact O-N 3.33Å; N84-T87 WeakPolarHBondContact O-CB 3.36Å; N84-T87 PolarHBondContact O-N 2.92Å; N84-V88 WeakPolarHBondContact O-CG2 3.46Å; N84-V88 PolarHBondContact O-N 2.69Å
85	L	95.4	Very high	91	Very high	107 Å²	107	100.9 Å²	100.9	56%	0.56	52%	0.518	S	S	*	.	H	α-helix	trans	-62.7	-46.8	177.8	-71.8	173.5	0	0	0	111.6	I81 L82 T87 V88 E89	I81-L85 HydrophobicContact CG2-CD1 3.96Å; I81-L85 HydrophobicContact CG2-CG 4.36Å; I81-L85 WeakPolarHBondContact O-CG 3.33Å; I81-L85 PolarHBondContact O-N 2.98Å; L82-L85 PolarHBondContact O-N 3.46Å; L85-T87 VanDerWaalsContact C-N 3.26Å; L85-T87 PolarHBondContact O-N 2.92Å; L85-V88 PolarHBondContact O-N 3.5Å; L85-V88 VanDerWaalsContact O-N 3.17Å; L85-E89 WeakPolarHBondContact O-CB 3.49Å; L85-E89 PolarHBondContact O-N 3.35Å
86	T	95.5	Very high	91.7	Very high	63 Å²	63	104.2 Å²	104.2	39%	0.387	53%	0.532	S	S	.	.	H	α-helix	trans	-59.9	-38.1	175.2	-56.7	0	0	0	0	111.9	L82 V83 E89 N90	L82-T86 PolarHBondContact O-N 2.87Å; L82-T86 PolarHBondContact O-OG1 3.26Å; V83-T86 PolarHBondContact O-N 3.2Å; T86-E89 PolarHBondContact O-N 2.91Å; T86-N90 VanDerWaalsContact O-CG 3.25Å; T86-N90 PolarHBondContact O-N 3.39Å; T86-N90 PolarHBondContact O-ND2 2.9Å
87	T	95.8	Very high	92.2	Very high	75 Å²	75	108.5 Å²	108.5	46%	0.46	54%	0.544	S	S	.	.	H	α-helix	trans	-65.7	-43	176.5	-56.6	0	0	0	0	111.6	V83 N84 L85 K91	V83-T87 WeakPolarHBondContact O-CB 3.26Å; V83-T87 PolarHBondContact O-N 2.95Å; V83-T87 PolarHBondContact O-OG1 3.32Å; N84-T87 WeakPolarHBondContact O-CB 3.36Å; N84-T87 PolarHBondContact O-N 2.92Å; L85-T87 VanDerWaalsContact C-N 3.26Å; L85-T87 PolarHBondContact O-N 2.92Å; T87-K91 VanDerWaalsContact O-CG 3.31Å; T87-K91 WeakPolarHBondContact O-CG 3.39Å; T87-K91 PolarHBondContact O-N 3.38Å; T87-K91 VanDerWaalsContact O-N 3.1Å
88	V	96.5	Very high	92.6	Very high	96 Å²	96	107.4 Å²	107.4	58%	0.582	54%	0.539	S	S	*	.	H	α-helix	trans	-65.3	-42.1	177.1	169.3	0	0	0	0	111.2	N84 L85 K91 L92	N84-V88 WeakPolarHBondContact O-CG2 3.46Å; N84-V88 PolarHBondContact O-N 2.69Å; L85-V88 PolarHBondContact O-N 3.5Å; L85-V88 VanDerWaalsContact O-N 3.17Å; V88-K91 PolarHBondContact O-N 3.33Å; V88-L92 WeakPolarHBondContact O-CB 3.27Å; V88-L92 PolarHBondContact O-N 2.96Å
89	E	95	Very high	93	Very high	123 Å²	123	108.7 Å²	108.7	58%	0.575	55%	0.549	S	S	*	.	H	α-helix	trans	-59.6	-49.4	176.7	-175.9	175.9	-173.2	0	0	111.5	L85 T86 K91 L92 V93	L85-E89 WeakPolarHBondContact O-CB 3.49Å; L85-E89 PolarHBondContact O-N 3.35Å; T86-E89 PolarHBondContact O-N 2.91Å; E89-K91 VanDerWaalsContact C-N 3.29Å; E89-K91 PolarHBondContact O-N 3.32Å; E89-L92 WeakPolarHBondContact O-CB 3.18Å; E89-L92 PolarHBondContact O-N 2.89Å; E89-L92 VanDerWaalsContact O-N 3.1Å; E89-V93 WeakPolarHBondContact O-CG2 3.39Å; E89-V93 PolarHBondContact O-N 3.43Å
90	N	96.2	Very high	93.1	Very high	104 Å²	104	106.6 Å²	106.6	56%	0.556	55%	0.548	S	S	*	.	H	α-helix	trans	-59.9	-39.9	177	-70.8	-23.6	0	0	0	112.3	T86 L92 V93 E94	T86-N90 VanDerWaalsContact O-CG 3.25Å; T86-N90 PolarHBondContact O-N 3.39Å; T86-N90 PolarHBondContact O-ND2 2.9Å; N90-L92 VanDerWaalsContact C-N 3.33Å; N90-V93 PolarHBondContact O-N 2.69Å; N90-E94 PolarHBondContact O-N 2.97Å; N90-E94 VanDerWaalsContact O-N 3.07Å
91	K	96.2	Very high	93	Very high	116 Å²	116	100.3 Å²	100.3	50%	0.504	53%	0.532	S	S	.	.	H	α-helix	trans	-67.3	-34.2	176.6	-74.6	-74.7	160.5	-156.3	0	112.5	T87 V88 E89 E94 L95	T87-K91 VanDerWaalsContact O-CG 3.31Å; T87-K91 WeakPolarHBondContact O-CG 3.39Å; T87-K91 PolarHBondContact O-N 3.38Å; T87-K91 VanDerWaalsContact O-N 3.1Å; V88-K91 PolarHBondContact O-N 3.33Å; E89-K91 VanDerWaalsContact C-N 3.29Å; E89-K91 PolarHBondContact O-N 3.32Å; K91-E94 IonicContact NZ-OE2 2.76Å; K91-E94 PolarHBondContact NZ-OE2 3.33Å; K91-E94 PolarHBondContact O-N 2.98Å; K91-L95 WeakPolarHBondContact O-CG 3.31Å; K91-L95 PolarHBondContact O-N 3.32Å; K91-L95 VanDerWaalsContact O-N 3.09Å
92	L	96.6	Very high	92.6	Very high	118 Å²	118	103.4 Å²	103.4	62%	0.618	54%	0.542	S	S	*	.	H	α-helix	trans	-67.3	-44.6	176.6	-171.4	67.4	0	0	0	111.2	V88 E89 N90 E94 L95 E96	V88-L92 WeakPolarHBondContact O-CB 3.27Å; V88-L92 PolarHBondContact O-N 2.96Å; E89-L92 WeakPolarHBondContact O-CB 3.18Å; E89-L92 PolarHBondContact O-N 2.89Å; E89-L92 VanDerWaalsContact O-N 3.1Å; N90-L92 VanDerWaalsContact C-N 3.33Å; L92-E94 VanDerWaalsContact C-N 3.32Å; L92-E94 PolarHBondContact O-N 2.88Å; L92-L95 PolarHBondContact O-N 3.1Å; L92-E96 PolarHBondContact O-N 3.11Å
93	V	96	Very high	91.7	Very high	83 Å²	83	99.9 Å²	99.9	50%	0.503	53%	0.533	S	S	.	.	H	α-helix	trans	-61.5	-41.1	175.7	174.3	0	0	0	0	111.3	E89 N90 L95 E96 H97	E89-V93 WeakPolarHBondContact O-CG2 3.39Å; E89-V93 PolarHBondContact O-N 3.43Å; N90-V93 PolarHBondContact O-N 2.69Å; V93-L95 PolarHBondContact O-N 3.01Å; V93-E96 PolarHBondContact O-N 3.07Å; V93-H97 PolarHBondContact O-N 3.17Å
94	E	93	Very high	90.3	Very high	96 Å²	96	103.1 Å²	103.1	45%	0.449	54%	0.54	S	S	.	.	H	α-helix	trans	-59.4	-46	175.1	-172.4	-177.2	174	0	0	111.5	N90 K91 L92 H97 I98	N90-E94 PolarHBondContact O-N 2.97Å; N90-E94 VanDerWaalsContact O-N 3.07Å; K91-E94 IonicContact NZ-OE2 2.76Å; K91-E94 PolarHBondContact NZ-OE2 3.33Å; K91-E94 PolarHBondContact O-N 2.98Å; L92-E94 VanDerWaalsContact C-N 3.32Å; L92-E94 PolarHBondContact O-N 2.88Å; E94-H97 PolarHBondContact O-N 3Å; E94-I98 HydrophobicContact CG-CD1 4.21Å; E94-I98 VanDerWaalsContact O-CG1 3.3Å; E94-I98 WeakPolarHBondContact O-CG1 3.47Å; E94-I98 PolarHBondContact O-N 3.02Å
95	L	93.6	Very high	88.9	Confident	108 Å²	108	107.1 Å²	107.1	57%	0.565	55%	0.547	S	S	*	.	H	α-helix	trans	-65.5	-41.1	177.8	-74.9	171.4	0	0	0	112.6	K91 L92 V93 H97 I98 L99	K91-L95 WeakPolarHBondContact O-CG 3.31Å; K91-L95 PolarHBondContact O-N 3.32Å; K91-L95 VanDerWaalsContact O-N 3.09Å; L92-L95 PolarHBondContact O-N 3.1Å; V93-L95 PolarHBondContact O-N 3.01Å; L95-H97 VanDerWaalsContact C-N 3.33Å; L95-H97 PolarHBondContact O-N 3.19Å; L95-I98 PolarHBondContact O-N 3.43Å; L95-L99 WeakPolarHBondContact O-CB 3.23Å; L95-L99 PolarHBondContact O-N 3.38Å
96	E	92.2	Very high	87.2	Confident	126 Å²	126	105.8 Å²	105.8	59%	0.589	55%	0.547	S	S	*	.	H	α-helix	trans	-58	-47.9	175.4	-176.6	178.8	-169.1	0	0	110.6	L92 V93 I98 L99 V100	L92-E96 PolarHBondContact O-N 3.11Å; V93-E96 PolarHBondContact O-N 3.07Å; E96-I98 PolarHBondContact O-N 3.47Å; E96-L99 PolarHBondContact O-N 3.47Å; E96-L99 VanDerWaalsContact O-N 3.15Å; E96-V100 WeakPolarHBondContact O-CG2 3.35Å; E96-V100 PolarHBondContact O-N 3.26Å
97	H	92.3	Very high	85.6	Confident	136 Å²	136	105.7 Å²	105.7	63%	0.63	55%	0.553	S	S	*	*	H	α-helix	trans	-62.5	-40.3	177.8	-173.5	-93.2	0	0	0	112.5	V93 E94 L95 L99 S101	V93-H97 PolarHBondContact O-N 3.17Å; E94-H97 PolarHBondContact O-N 3Å; L95-H97 VanDerWaalsContact C-N 3.33Å; L95-H97 PolarHBondContact O-N 3.19Å; H97-L99 VanDerWaalsContact C-N 3.34Å; H97-S101 WeakPolarHBondContact O-CB 3.32Å; H97-S101 PolarHBondContact O-N 3.47Å; H97-S101 PolarHBondContact O-OG 3.25Å
98	I	91.5	Very high	83.8	Confident	84 Å²	84	105.1 Å²	105.1	43%	0.431	55%	0.552	S	S	.	*	H	α-helix	trans	-62.8	-41.7	174.2	-68.8	165.9	0	0	0	110.9	E94 L95 E96 S101 K102	E94-I98 HydrophobicContact CG-CD1 4.21Å; E94-I98 VanDerWaalsContact O-CG1 3.3Å; E94-I98 WeakPolarHBondContact O-CG1 3.47Å; E94-I98 PolarHBondContact O-N 3.02Å; L95-I98 PolarHBondContact O-N 3.43Å; E96-I98 PolarHBondContact O-N 3.47Å; I98-S101 WeakPolarHBondContact CA-OG 3.08Å; I98-S101 PolarHBondContact O-OG 3.44Å; I98-K102 WeakPolarHBondContact O-CB 3.25Å; I98-K102 PolarHBondContact O-N 2.9Å
99	L	88.9	Confident	82	Confident	136 Å²	136	103.9 Å²	103.9	71%	0.712	55%	0.551	S	S	*	*	H	α-helix	trans	-66.3	-46.3	-179.4	-155.2	83.6	0	0	0	111.2	L95 E96 H97 K102 G103	L95-L99 WeakPolarHBondContact O-CB 3.23Å; L95-L99 PolarHBondContact O-N 3.38Å; E96-L99 PolarHBondContact O-N 3.47Å; E96-L99 VanDerWaalsContact O-N 3.15Å; H97-L99 VanDerWaalsContact C-N 3.34Å; L99-K102 PolarHBondContact O-N 2.91Å; L99-G103 PolarHBondContact O-N 3.3Å
100	V	87.9	Confident	80.3	Confident	97 Å²	97	105.3 Å²	105.3	59%	0.588	56%	0.557	S	S	*	*	H	α-helix	trans	-62.4	-47.4	177.9	172.4	0	0	0	0	110.8	E96 K102 G103 F104	E96-V100 WeakPolarHBondContact O-CG2 3.35Å; E96-V100 PolarHBondContact O-N 3.26Å; V100-K102 PolarHBondContact O-N 2.75Å; V100-G103 PolarHBondContact O-N 3.32Å; V100-F104 PolarHBondContact O-N 2.83Å
101	S	83.3	Confident	78.7	Confident	51 Å²	51	110.6 Å²	110.6	36%	0.357	57%	0.57	S	S	.	*	H	α-helix	trans	-64.8	-37.5	178.4	59.9	0	0	0	0	112.6	H97 I98 F104 R105	H97-S101 WeakPolarHBondContact O-CB 3.32Å; H97-S101 PolarHBondContact O-N 3.47Å; H97-S101 PolarHBondContact O-OG 3.25Å; I98-S101 WeakPolarHBondContact CA-OG 3.08Å; I98-S101 PolarHBondContact O-OG 3.44Å; S101-F104 PolarHBondContact O-N 2.91Å; S101-R105 WeakPolarHBondContact O-CG 3.44Å; S101-R105 PolarHBondContact O-N 3.41Å
102	K	79.6	Confident	76.9	Confident	147 Å²	147	114.4 Å²	114.4	64%	0.639	59%	0.586	S	S	*	*	H	α-helix	trans	-69.4	-40.8	175.8	-169.5	173.7	-179.1	179.8	0	112	I98 L99 V100 F104 R105 S106	I98-K102 WeakPolarHBondContact O-CB 3.25Å; I98-K102 PolarHBondContact O-N 2.9Å; L99-K102 PolarHBondContact O-N 2.91Å; V100-K102 PolarHBondContact O-N 2.75Å; K102-F104 VanDerWaalsContact C-N 3.31Å; K102-F104 PolarHBondContact O-N 3.45Å; K102-R105 PolarHBondContact O-N 3.27Å; K102-S106 PolarHBondContact O-N 3.37Å; K102-S106 PolarHBondContact O-OG 3.4Å
103	G	75.2	Confident	75	Confident	37 Å²	37	114 Å²	114	38%	0.381	59%	0.593	S	S	.	*	H	α-helix	trans	-61.3	-39.1	174.2	0	0	0	0	0	112.4	L99 V100 S106 A107	L99-G103 PolarHBondContact O-N 3.3Å; V100-G103 PolarHBondContact O-N 3.32Å; G103-S106 PolarHBondContact O-N 2.86Å; G103-S106 PolarHBondContact O-OG 3.36Å; G103-A107 WeakPolarHBondContact O-CB 3.14Å; G103-A107 PolarHBondContact O-N 2.86Å
104	F	62.9	Low	72.7	Confident	159 Å²	159	118.9 Å²	118.9	70%	0.697	62%	0.624	S	S	*	*	H	α-helix	trans	-66.8	-40.7	173.9	-162.8	-94.7	0	0	0	112	V100 S101 K102 A107 S108	V100-F104 PolarHBondContact O-N 2.83Å; S101-F104 PolarHBondContact O-N 2.91Å; K102-F104 VanDerWaalsContact C-N 3.31Å; K102-F104 PolarHBondContact O-N 3.45Å; F104-A107 PolarHBondContact O-N 3.41Å; F104-S108 WeakPolarHBondContact O-CB 3.42Å; F104-S108 PolarHBondContact O-N 2.9Å
105	R	63	Low	71.7	Confident	188 Å²	188	120.1 Å²	120.1	71%	0.709	63%	0.632	S	S	*	*	H	α-helix	trans	-62.2	-43.2	175.4	-76.6	-178.7	69.9	-152.2	1.1	112.2	S101 K102 S108 A109	S101-R105 WeakPolarHBondContact O-CG 3.44Å; S101-R105 PolarHBondContact O-N 3.41Å; K102-R105 PolarHBondContact O-N 3.27Å; R105-S108 PolarHBondContact O-N 3.09Å; R105-S108 PolarHBondContact O-OG 2.79Å; R105-A109 PolarHBondContact O-N 3.48Å
106	S	61.1	Low	70.6	Confident	78 Å²	78	120.7 Å²	120.7	55%	0.545	64%	0.636	S	S	.	*	H	α-helix	trans	-66.7	-39	177.2	53.9	0	0	0	0	112.4	K102 G103 A109 H110	K102-S106 PolarHBondContact O-N 3.37Å; K102-S106 PolarHBondContact O-OG 3.4Å; G103-S106 PolarHBondContact O-N 2.86Å; G103-S106 PolarHBondContact O-OG 3.36Å; S106-A109 PolarHBondContact O-N 3.16Å; S106-H110 PolarHBondContact O-N 2.9Å
107	A	60.5	Low	69.4	Low	62 Å²	62	120.4 Å²	120.4	51%	0.512	64%	0.638	S	S	.	*	H	α-helix	trans	-64	-40.5	173.8	0	0	0	0	0	112.2	G103 F104 H110 R111	G103-A107 WeakPolarHBondContact O-CB 3.14Å; G103-A107 PolarHBondContact O-N 2.86Å; F104-A107 PolarHBondContact O-N 3.41Å; A107-H110 PolarHBondContact O-N 2.82Å; A107-R111 PolarHBondContact O-N 3.33Å
108	S	58.8	Low	68	Low	63 Å²	63	119.5 Å²	119.5	44%	0.441	64%	0.639	S	S	.	*	H	α-helix	trans	-66.8	-36.2	177.9	80.2	0	0	0	0	112.9	F104 R105 H110 R111	F104-S108 WeakPolarHBondContact O-CB 3.42Å; F104-S108 PolarHBondContact O-N 2.9Å; R105-S108 PolarHBondContact O-N 3.09Å; R105-S108 PolarHBondContact O-OG 2.79Å; S108-H110 VanDerWaalsContact C-N 3.31Å; S108-H110 PolarHBondContact O-N 3.47Å; S108-R111 PolarHBondContact O-N 2.99Å
109	A	59.1	Low	66.5	Low	69 Å²	69	121.7 Å²	121.7	57%	0.57	65%	0.652	S	S	*	*	H	α-helix	trans	-65.8	-35.6	178.2	0	0	0	0	0	111.5	R105 S106 K112	R105-A109 PolarHBondContact O-N 3.48Å; S106-A109 PolarHBondContact O-N 3.16Å; A109-K112 PolarHBondContact O-N 3.3Å
110	H	58.6	Low	65.1	Low	153 Å²	153	120.7 Å²	120.7	71%	0.708	65%	0.648	S	S	*	*	H	α-helix	trans	-68.2	-35.7	176.7	-166.7	57.9	0	0	0	112.4	S106 A107 S108 K112 S113	S106-H110 PolarHBondContact O-N 2.9Å; A107-H110 PolarHBondContact O-N 2.82Å; S108-H110 VanDerWaalsContact C-N 3.31Å; S108-H110 PolarHBondContact O-N 3.47Å; H110-K112 PolarHBondContact O-N 3.12Å; H110-S113 PolarHBondContact O-N 3.39Å
111	R	62.6	Low	63.4	Low	215 Å²	215	122.4 Å²	122.4	81%	0.811	65%	0.652	S	S	*	*	H	α-helix	trans	-66.3	-21	179.7	-160.7	178.8	-166	-161.2	4.2	113.7	A107 S108 S113	A107-R111 PolarHBondContact O-N 3.33Å; S108-R111 PolarHBondContact O-N 2.99Å; R111-S113 VanDerWaalsContact C-N 3.34Å; R111-S113 PolarHBondContact O-N 3.06Å
112	K	58.2	Low	61.9	Low	197 Å²	197	127.9 Å²	127.9	86%	0.857	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.1	-0.2	-176.7	-149	177.8	179.6	-172.1	0	114.4	A109 H110	A109-K112 PolarHBondContact O-N 3.3Å; H110-K112 PolarHBondContact O-N 3.12Å
113	S	57.9	Low	60.4	Low	109 Å²	109	126.3 Å²	126.3	76%	0.762	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.4	17.5	-177.4	-165.7	0	0	0	0	114.9	H110 R111	H110-S113 PolarHBondContact O-N 3.39Å; R111-S113 VanDerWaalsContact C-N 3.34Å; R111-S113 PolarHBondContact O-N 3.06Å
114	T	47.2	Very low	59.1	Low	186 Å²	186	134.5 Å²	134.5	100%	1.141	71%	0.705	S	S	*	*			trans	-118.3	0	169.5	-5.8	0	0	0	0	109

Retrieved 114 of 114 residues in 204.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).