A0A096N701_PAPAN Loading...

Activated RNA polymerase II transcriptional coactivator p15

General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).

AlphaFold DB (Q4R947), UniProt , Accession A0A096N701, Species PAPAN (Papio anubis, Olive baboon), Gene n/a, Length 127 aa.

						>A0A096N701_PAPAN|A0A096N701
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.9	Very low	58.7	Low	244 Å²	244	155.4 Å²	155.4	100%	1.202	87%	0.866	S	S	*	*				0	126.9	0	-73.8	179.6	130.8	0	0	108.5
2	P	54.2	Low	58	Low	115 Å²	115	152.4 Å²	152.4	75%	0.747	86%	0.864	S	S	*	*			trans	-109.8	172.7	-169.9	39.8	-30.9	0	0	0	114.2
3	K	53.6	Low	58.5	Low	195 Å²	195	150.4 Å²	150.4	85%	0.848	87%	0.865	S	S	*	*			trans	96.1	114.8	154.2	-63.6	174.5	179.1	173.7	0	118.8
4	S	74.2	Confident	57.9	Low	131 Å²	131	144.9 Å²	144.9	92%	0.916	86%	0.857	S	S	*	*				-142.8	120.2	127.6	-57.1	0	0	0	0	109.3
5	K	63.2	Low	58.7	Low	200 Å²	200	143.8 Å²	143.8	87%	0.87	86%	0.86	S	S	*	*			trans	-90.9	138.5	164.7	-92.7	178	169.8	179.8	0	107.2
6	E	71.2	Confident	58.4	Low	184 Å²	184	144.9 Å²	144.9	86%	0.86	86%	0.86	S	S	*	*			trans	-122.2	137.3	155.6	-88.5	-135.8	96.1	0	0	110
7	L	60.8	Low	58.7	Low	155 Å²	155	142.4 Å²	142.4	81%	0.812	85%	0.851	S	S	*	*			trans	-111.8	129.2	176.4	-73.1	165.2	0	0	0	107
8	V	61.5	Low	59	Low	127 Å²	127	142.2 Å²	142.2	77%	0.77	85%	0.846	S	S	*	*			trans	-138.2	107	161	-69.2	0	0	0	0	106.3
9	S	55.8	Low	58.5	Low	118 Å²	118	139.9 Å²	139.9	83%	0.825	84%	0.838	S	S	*	*				83.3	126.1	84.2	-65.4	0	0	0	0	113.9
10	S	51	Low	58.6	Low	116 Å²	116	142.6 Å²	142.6	81%	0.811	84%	0.841	S	S	*	*			trans	-55.3	151.7	-175.7	47.2	0	0	0	0	117.8
11	S	57	Low	58.2	Low	124 Å²	124	141.6 Å²	141.6	87%	0.867	84%	0.836	S	S	*	*			trans	-149.2	131.7	142.4	51.9	0	0	0	0	111.7
12	S	50.6	Low	58.9	Low	120 Å²	120	137.9 Å²	137.9	84%	0.839	82%	0.821	S	S	*	*			trans	-87.3	142.9	178.1	46.6	0	0	0	0	111.4
13	S	64.8	Low	58.8	Low	126 Å²	126	142 Å²	142	88%	0.881	83%	0.827	S	S	*	*			trans	-154.6	112.2	158.8	-165.2	0	0	0	0	110.4
14	G	50.4	Low	58.8	Low	73 Å²	73	141.7 Å²	141.7	75%	0.753	83%	0.826	S	S	*	*			trans	-90.9	153.7	166	0	0	0	0	0	110.9
15	S	69.9	Low	57.8	Low	129 Å²	129	142.4 Å²	142.4	90%	0.902	82%	0.819	S	S	*	*			trans	-157.7	126.3	162.3	-148.5	0	0	0	0	109.4
16	D	53.5	Low	57.1	Low	162 Å²	162	142.5 Å²	142.5	87%	0.866	82%	0.819	S	S	*	*			trans	-96.2	-173.1	-178	-139.8	-63.9	0	0	0	109.6
17	S	63.3	Low	56.3	Low	101 Å²	101	145.8 Å²	145.8	71%	0.706	82%	0.824	S	S	*	*			trans	94	133.2	179.4	-89.6	0	0	0	0	116.2
18	D	63.9	Low	55.8	Low	140 Å²	140	147.3 Å²	147.3	75%	0.749	82%	0.824	S	S	*	*			cis	-156	151.9	16.2	-126.8	-71.2	0	0	0	110.7
19	S	50.5	Low	55.5	Low	99 Å²	99	150.9 Å²	150.9	69%	0.692	83%	0.829	S	S	*	*			trans	-84.2	149.8	175.2	44.7	0	0	0	0	112.3
20	E	59.7	Low	55.4	Low	192 Å²	192	153 Å²	153	90%	0.897	83%	0.825	S	S	*	*			trans	-157.3	139.7	144.2	-92.1	-113.2	105.5	0	0	111.3
21	V	50.5	Low	55.6	Low	122 Å²	122	153.6 Å²	153.6	74%	0.739	82%	0.824	S	S	*	*			trans	-99	139.5	-173.1	-94.6	0	0	0	0	108.8
22	D	57.9	Low	55.7	Low	166 Å²	166	151.9 Å²	151.9	89%	0.888	82%	0.818	S	S	*	*			trans	-158.6	127.9	139.6	-121.2	-50	0	0	0	114.3
23	K	51.4	Low	55.5	Low	203 Å²	203	152.2 Å²	152.2	88%	0.883	82%	0.817	S	S	*	*			trans	-103.6	119.1	175.9	-88.6	174.4	174.3	167.9	0	107.5
24	K	53.6	Low	55	Low	187 Å²	187	154.7 Å²	154.7	81%	0.813	81%	0.814	S	S	*	*			trans	-149.3	101.9	159.9	-150.6	162.7	-176.4	174	0	115.4
25	L	53.6	Low	55.6	Low	147 Å²	147	160.1 Å²	160.1	77%	0.77	82%	0.818	S	S	*	*				50.2	110.1	129.5	-56.9	169.6	0	0	0	120.6
26	K	49.1	Very low	54.4	Low	201 Å²	201	160 Å²	160	87%	0.874	81%	0.814	S	S	*	*			trans	18.1	119.1	130	-71.2	-179.6	174.9	176.5	0	117.7
27	R	53	Low	54.6	Low	254 Å²	254	158.4 Å²	158.4	96%	0.958	81%	0.809	S	S	*	*			trans	-153.8	121.7	131.2	-142.4	165.8	161.3	178.3	-6.3	112.8
28	K	50.1	Low	54	Low	187 Å²	187	162.8 Å²	162.8	81%	0.813	82%	0.816	S	S	*	*			trans	-85.5	129.1	177.4	-157.5	177.2	-173.6	-177.6	0	107.5
29	K	55.9	Low	53.2	Low	202 Å²	202	164.5 Å²	164.5	88%	0.878	82%	0.816	S	S	*	*			trans	-141.1	110.9	160.1	-161.7	163.6	-176.2	178.5	0	110.3
30	Q	54	Low	53.3	Low	161 Å²	161	167.3 Å²	167.3	75%	0.752	82%	0.819	S	S	*	*			trans	-77.8	140	166	-65.5	164.6	-22	0	0	109.1
31	V	56.1	Low	52.8	Low	129 Å²	129	167 Å²	167	78%	0.782	81%	0.814	S	S	*	*			trans	-164.4	96.3	141	-173.8	0	0	0	0	106.1
32	A	57.8	Low	52.4	Low	89 Å²	89	167.9 Å²	167.9	74%	0.736	82%	0.82	S	S	*	*				68.6	123.5	104	0	0	0	0	0	116.1
33	P	46.2	Very low	51.8	Low	127 Å²	127	163.7 Å²	163.7	83%	0.825	82%	0.816	S	S	*	*			trans	-103.1	144.6	177.3	37	-28.2	0	0	0	113.1
34	E	55.5	Low	51.8	Low	177 Å²	177	162.9 Å²	162.9	83%	0.827	82%	0.816	S	S	*	*			trans	-137.3	112.9	169.3	-73	-157.8	116.6	0	0	114.1
35	K	63	Low	51.6	Low	188 Å²	188	160 Å²	160	82%	0.817	81%	0.814	S	S	*	*			trans	55.9	139	136.1	-69.1	176.2	179.9	168.4	0	123.8
36	P	44.7	Very low	51.6	Low	126 Å²	126	157.7 Å²	157.7	82%	0.818	81%	0.81	S	S	*	*			trans	-98.1	159.9	-177.8	39.8	-34.5	0	0	0	114.6
37	V	57.8	Low	51.9	Low	128 Å²	128	159.5 Å²	159.5	78%	0.776	81%	0.812	S	S	*	*			trans	-136.3	124.4	177.5	-177.1	0	0	0	0	112.8
38	K	50.5	Low	51.7	Low	193 Å²	193	151.7 Å²	151.7	84%	0.839	80%	0.801	S	S	*	*			trans	41	121.2	151.4	-70.4	174	172.8	174.4	0	120.7
39	K	46.6	Very low	51.5	Low	176 Å²	176	152 Å²	152	77%	0.765	81%	0.81	S	S	*	*				70.8	116.1	75.5	-95.2	-170.8	171.8	177.3	0	116.7
40	Q	53.6	Low	51.2	Low	158 Å²	158	147 Å²	147	74%	0.738	80%	0.801	S	S	*	*				89.4	120.4	129.7	-76.9	-179.2	-57.4	0	0	122.3
41	K	47.9	Very low	51	Low	185 Å²	185	145 Å²	145	80%	0.804	81%	0.805	S	S	*	*				134.1	108.7	127.3	-85	-171.8	172.3	-178.6	0	112.4
42	T	41.9	Very low	50.8	Low	142 Å²	142	144 Å²	144	87%	0.871	80%	0.804	S	S	*	*				74	119.3	94.5	-37.4	0	0	0	0	113
43	G	46.3	Very low	50.1	Low	78 Å²	78	149.9 Å²	149.9	80%	0.804	81%	0.813	S	S	*	*			trans	169.3	86.7	173.4	0	0	0	0	0	112.3
44	E	50.2	Low	50.2	Low	185 Å²	185	152.2 Å²	152.2	86%	0.864	81%	0.813	S	S	*	*			trans	-63.2	136.5	171.3	-161.4	171.8	106	0	0	110.7
45	T	50.4	Low	49.3	Very low	126 Å²	126	149.4 Å²	149.4	77%	0.773	81%	0.813	S	S	*	*			trans	165.5	118.4	132.7	38.8	0	0	0	0	112.6
46	S	53.8	Low	48.3	Very low	100 Å²	100	143.6 Å²	143.6	70%	0.699	80%	0.796	S	S	*	*			trans	-2.7	125.5	152	46.5	0	0	0	0	119.4
47	R	54.9	Low	48	Very low	239 Å²	239	142.2 Å²	142.2	90%	0.902	79%	0.789	S	S	*	*				167.1	141.4	116.5	-89.8	161.1	-179	166.8	1.4	113
48	A	48	Very low	47.8	Very low	89 Å²	89	141.6 Å²	141.6	74%	0.736	79%	0.79	S	S	*	*			trans	68.2	90.9	155.6	0	0	0	0	0	118.1	S50	A48-S50 VanDerWaalsContact C-N 3.26Å; A48-S50 PolarHBondContact O-N 3.48Å
49	L	46.3	Very low	48	Very low	193 Å²	193	142.5 Å²	142.5	100%	1.01	79%	0.789	S	S	*	*			trans	-67.8	86	153.5	-70.2	163.7	0	0	0	108.5
50	S	50.5	Low	48.9	Very low	97 Å²	97	138.1 Å²	138.1	68%	0.678	77%	0.774	S	S	*	*			trans	-102.2	123.8	164.5	67	0	0	0	0	109	A48 S52	A48-S50 VanDerWaalsContact C-N 3.26Å; A48-S50 PolarHBondContact O-N 3.48Å; S50-S52 PolarHBondContact O-N 3.19Å
51	S	50	Low	50	Low	121 Å²	121	136.9 Å²	136.9	85%	0.846	77%	0.772	S	S	*	*			trans	-46	100.6	173.2	42.2	0	0	0	0	112.8	K53	S51-K53 VanDerWaalsContact C-N 3.34Å; S51-K53 PolarHBondContact O-N 3.17Å
52	S	51	Low	52.1	Low	108 Å²	108	132.1 Å²	132.1	76%	0.755	76%	0.755	S	S	*	*			trans	-76	90.8	169.1	44.3	0	0	0	0	109.9	S50 Q54	S50-S52 PolarHBondContact O-N 3.19Å; S52-Q54 PolarHBondContact O-N 2.96Å; S52-Q54 VanDerWaalsContact O-N 3.13Å
53	K	42.9	Very low	54.7	Low	211 Å²	211	127.9 Å²	127.9	92%	0.917	73%	0.726	S	S	*	*			trans	-35.1	103.5	149.5	-156.3	175.2	-167.6	177.8	0	110	S51	S51-K53 VanDerWaalsContact C-N 3.34Å; S51-K53 PolarHBondContact O-N 3.17Å
54	Q	48.2	Very low	57	Low	176 Å²	176	129.5 Å²	129.5	82%	0.822	71%	0.711	S	S	*	*			trans	-109.1	106.2	170.7	-155.8	169.9	-31.5	0	0	108.2	S52 S56	S52-Q54 PolarHBondContact O-N 2.96Å; S52-Q54 VanDerWaalsContact O-N 3.13Å; Q54-S56 PolarHBondContact O-N 3.37Å
55	S	37.4	Very low	59.3	Low	118 Å²	118	126.5 Å²	126.5	83%	0.825	70%	0.697	S	S	*	*			trans	-66.1	114.6	172.8	49	0	0	0	0	111.1
56	S	41.1	Very low	61.5	Low	67 Å²	67	125.4 Å²	125.4	47%	0.469	69%	0.686	S	S	.	*			trans	-142.2	89.2	161.1	51.1	0	0	0	0	110.7	Q54 D60	Q54-S56 PolarHBondContact O-N 3.37Å; S56-D60 PolarHBondContact OG-OD2 2.84Å
57	S	39.7	Very low	63.5	Low	97 Å²	97	122 Å²	122	68%	0.678	67%	0.666	S	S	*	*			trans	44.2	89.5	146.1	61.2	0	0	0	0	118.7	R59	S57-R59 PolarHBondContact O-N 2.85Å
58	S	52.2	Low	65.4	Low	114 Å²	114	119.4 Å²	119.4	80%	0.797	66%	0.662	S	S	*	*	S	Bend	trans	38	-6.9	151	-70.5	0	0	0	0	122.6
59	R	55.6	Low	67.7	Low	213 Å²	213	117.4 Å²	117.4	80%	0.804	64%	0.637	S	S	*	*	S	Bend	trans	-89.7	-19.4	178.2	-76.2	-176.2	164.1	173.1	-2.1	111.3	S57	S57-R59 PolarHBondContact O-N 2.85Å
60	D	64.7	Low	70.2	Confident	84 Å²	84	114.9 Å²	114.9	45%	0.449	62%	0.615	S	S	.	*	S	Bend	trans	-90.2	-22.3	-170.1	-61.9	-34.9	0	0	0	113.6	S56 N62 M63	S56-D60 PolarHBondContact OG-OD2 2.84Å; D60-N62 PolarHBondContact O-N 3.16Å; D60-M63 PolarHBondContact O-N 3.49Å; D60-M63 VanDerWaalsContact O-N 3.07Å
61	D	76.7	Confident	72.4	Confident	131 Å²	131	112.3 Å²	112.3	70%	0.701	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.1	-23.8	-172.6	-65.9	-33.4	0	0	0	113.6
62	N	93.1	Very high	74.7	Confident	86 Å²	86	107.6 Å²	107.6	46%	0.46	56%	0.556	S	S	.	*	T	Hydrogen-bonded Turn	trans	-116.9	21.7	-179.9	-63.4	-59.4	0	0	0	113	D60 S73 V74	D60-N62 PolarHBondContact O-N 3.16Å; N62-S73 CarbonylContact O-C 3.55Å; N62-S73 WeakPolarHBondContact O-CA 3.5Å; N62-V74 HydrophobicContact CB-CB 4.14Å; N62-V74 WeakPolarHBondContact CB-O 3.42Å; N62-V74 PolarHBondContact O-N 2.78Å
63	M	94.8	Very high	76.9	Confident	53 Å²	53	102.8 Å²	102.8	26%	0.261	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	109.1	-178.9	-169.6	74.4	70.8	0	0	110.3	D60 Y71 S73 Y88	D60-M63 PolarHBondContact O-N 3.49Å; D60-M63 VanDerWaalsContact O-N 3.07Å; M63-Y71 HydrophobicContact CG-CD1 3.58Å; M63-Y71 HydrophobicContact CG-CE1 4.34Å; M63-Y71 HydrophobicContact CG-CG 4.03Å; M63-Y71 WeakPolarHBondContact SD-CB 3.23Å; M63-Y71 HydrophobicContact SD-CD1 4.11Å; M63-Y71 HydrophobicContact SD-CG 3.92Å; M63-S73 VanDerWaalsContact SD-CB 3.56Å; M63-Y88 WeakPolarHBondContact CE-OH 3.27Å
64	F	96.6	Very high	79.5	Confident	111 Å²	111	95.2 Å²	95.2	49%	0.487	49%	0.494	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	113.3	-178	-51.8	-81.9	0	0	0	110.2	Y71 V72 V74	F64-Y71 CarbonylContact O-C 3.54Å; F64-Y71 VanDerWaalsContact O-CA 3.32Å; F64-Y71 WeakPolarHBondContact O-CA 3.12Å; F64-V72 HydrophobicContact CB-CB 4.35Å; F64-V72 WeakPolarHBondContact CD2-O 3.39Å; F64-V72 PolarHBondContact N-O 2.99Å; F64-V72 PolarHBondContact O-N 2.99Å; F64-V74 HydrophobicContact CE2-CG2 4.1Å
65	Q	96.7	Very high	81.7	Confident	122 Å²	122	91.4 Å²	91.4	57%	0.57	47%	0.472	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.3	127.4	179.8	-170	173.6	12.8	0	0	111.4	G67 Y71	Q65-G67 WeakPolarHBondContact CG-O 3.24Å; Q65-G67 PolarHBondContact NE2-O 3.04Å; Q65-Y71 HydrophobicContact CB-CD1 3.77Å; Q65-Y71 HydrophobicContact CB-CE1 3.64Å; Q65-Y71 HydrophobicContact CG-CD1 4.03Å; Q65-Y71 HydrophobicContact CG-CE1 3.63Å
66	I	97.3	Very high	84.5	Confident	104 Å²	104	91 Å²	91	53%	0.533	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	0.6	176.9	60.9	165.9	0	0	0	112.9	R70 V72 I85	I66-R70 HydrophobicContact CD1-CB 4.33Å; I66-R70 HydrophobicContact CG1-CB 3.83Å; I66-R70 WeakPolarHBondContact CG1-O 3.41Å; I66-R70 PolarHBondContact N-O 2.6Å; I66-V72 HydrophobicContact CD1-CG2 3.94Å; I66-V72 HydrophobicContact CG1-CG2 4.38Å; I66-V72 HydrophobicContact CG2-CG2 3.85Å; I66-I85 HydrophobicContact CD1-CG2 4.14Å
67	G	95.8	Very high	87	Confident	28 Å²	28	92.4 Å²	92.4	29%	0.289	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-176.2	-179.8	175.5	0	0	0	0	0	111.6	Q65 M69 R70	Q65-G67 WeakPolarHBondContact CG-O 3.24Å; Q65-G67 PolarHBondContact NE2-O 3.04Å; G67-M69 VanDerWaalsContact C-N 3.26Å; G67-M69 PolarHBondContact O-N 3.07Å; G67-R70 PolarHBondContact N-O 3.13Å; G67-R70 PolarHBondContact O-N 3.47Å
68	K	95.5	Very high	89.6	Confident	185 Å²	185	96.5 Å²	96.5	80%	0.804	46%	0.464	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.3	-44.4	-175.9	-174.5	179.6	178.4	178.4	0	113.1
69	M	96.1	Very high	91.7	Very high	46 Å²	46	94.2 Å²	94.2	23%	0.227	46%	0.459	C	S	.	.	T	Hydrogen-bonded Turn	trans	-129.7	27.6	-178.3	-61.4	-61.7	-69.1	0	0	111.1	G67 E87 Y88 W89 M90 M96	G67-M69 VanDerWaalsContact C-N 3.26Å; G67-M69 PolarHBondContact O-N 3.07Å; M69-E87 CarbonylContact O-C 3.5Å; M69-E87 VanDerWaalsContact O-CA 3.29Å; M69-E87 WeakPolarHBondContact O-CA 3.47Å; M69-Y88 WeakPolarHBondContact CB-O 3.5Å; M69-Y88 WeakPolarHBondContact CE-O 3.06Å; M69-Y88 PolarHBondContact O-N 3.05Å; M69-W89 VanDerWaalsContact CE-CA 3.46Å; M69-M90 HydrophobicContact CE-CG 3.86Å; M69-M96 HydrophobicContact CE-CE 3.54Å; M69-M96 HydrophobicContact CE-SD 3.48Å; M69-M96 WeakPolarHBondContact CE-SD 3.18Å; M69-M96 HydrophobicContact SD-CE 3.85Å; M69-M96 HydrophobicContact SD-SD 4.07Å
70	R	97.8	Very high	93.7	Very high	141 Å²	141	91.3 Å²	91.3	53%	0.532	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	129.7	-175.6	-69	-177.8	178.4	176.1	-0	110	I66 G67 R86 E87	I66-R70 HydrophobicContact CD1-CB 4.33Å; I66-R70 HydrophobicContact CG1-CB 3.83Å; I66-R70 WeakPolarHBondContact CG1-O 3.41Å; I66-R70 PolarHBondContact N-O 2.6Å; G67-R70 PolarHBondContact N-O 3.13Å; G67-R70 PolarHBondContact O-N 3.47Å; R70-R86 WeakPolarHBondContact CA-O 3.41Å; R70-E87 HydrophobicContact CG-CB 4.33Å; R70-E87 HydrophobicContact CG-CG 4.42Å; R70-E87 IonicContact CZ-OE2 3.92Å; R70-E87 IonicContact NE-OE2 3.53Å; R70-E87 IonicContact NH2-OE2 3.36Å; R70-E87 PolarHBondContact NH2-OE2 2.96Å
71	Y	97.5	Very high	95.2	Very high	43 Å²	43	90.8 Å²	90.8	17%	0.169	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	149.3	-175.5	-59	-97.8	0	0	0	110.7	M63 F64 Q65 R86 Y88 M96	M63-Y71 HydrophobicContact CG-CD1 3.58Å; M63-Y71 HydrophobicContact CG-CE1 4.34Å; M63-Y71 HydrophobicContact CG-CG 4.03Å; M63-Y71 WeakPolarHBondContact SD-CB 3.23Å; M63-Y71 HydrophobicContact SD-CD1 4.11Å; M63-Y71 HydrophobicContact SD-CG 3.92Å; F64-Y71 CarbonylContact O-C 3.54Å; F64-Y71 VanDerWaalsContact O-CA 3.32Å; F64-Y71 WeakPolarHBondContact O-CA 3.12Å; Q65-Y71 HydrophobicContact CB-CD1 3.77Å; Q65-Y71 HydrophobicContact CB-CE1 3.64Å; Q65-Y71 HydrophobicContact CG-CD1 4.03Å; Q65-Y71 HydrophobicContact CG-CE1 3.63Å; Y71-R86 PolarHBondContact N-O 3Å; Y71-R86 PolarHBondContact O-N 3.48Å; Y71-Y88 AromaticContact CD2-CD2 3.61Å; Y71-Y88 HydrophobicContact CD2-CD2 3.61Å; Y71-Y88 HydrophobicContact CD2-CE2 4.05Å; Y71-Y88 HydrophobicContact CD2-CG 4.16Å; Y71-Y88 HydrophobicContact CE2-CD2 4.39Å; Y71-Y88 HydrophobicContact CG-CD2 4.42Å; Y71-Y88 HydrophobicContact CG-CE2 4.44Å; Y71-M96 HydrophobicContact CE2-CE 3.53Å
72	V	98	Very high	96.2	Very high	21 Å²	21	85.9 Å²	85.9	13%	0.127	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	124.7	163.2	-177.2	0	0	0	0	106.7	F64 I66 I83 D84 I85	F64-V72 HydrophobicContact CB-CB 4.35Å; F64-V72 WeakPolarHBondContact CD2-O 3.39Å; F64-V72 PolarHBondContact N-O 2.99Å; F64-V72 PolarHBondContact O-N 2.99Å; I66-V72 HydrophobicContact CD1-CG2 3.94Å; I66-V72 HydrophobicContact CG1-CG2 4.38Å; I66-V72 HydrophobicContact CG2-CG2 3.85Å; V72-I83 HydrophobicContact CG1-CG2 3.74Å; V72-D84 CarbonylContact C-O 3.53Å; V72-D84 VanDerWaalsContact CA-O 3.27Å; V72-D84 WeakPolarHBondContact CA-O 3.5Å; V72-I85 HydrophobicContact CG1-CG1 4.31Å; V72-I85 HydrophobicContact CG2-CG1 4.15Å; V72-I85 HydrophobicContact CG2-CG2 4.35Å
73	S	97	Very high	96.5	Very high	8 Å²	8	82.2 Å²	82.2	6%	0.056	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	142.1	177.5	69.7	0	0	0	0	111.9	N62 M63 I83 D84	N62-S73 CarbonylContact O-C 3.55Å; N62-S73 WeakPolarHBondContact O-CA 3.5Å; M63-S73 VanDerWaalsContact SD-CB 3.56Å; S73-I83 CarbonylContact O-C 3.51Å; S73-I83 WeakPolarHBondContact O-CA 3.35Å; S73-D84 PolarHBondContact N-O 2.93Å; S73-D84 PolarHBondContact O-N 2.86Å; S73-D84 WeakPolarHBondContact OG-CB 3.42Å
74	V	97.4	Very high	96.6	Very high	51 Å²	51	79.9 Å²	79.9	31%	0.309	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	119.7	170.8	-176.1	0	0	0	0	108.3	N62 F64 V81 I83	N62-V74 HydrophobicContact CB-CB 4.14Å; N62-V74 WeakPolarHBondContact CB-O 3.42Å; N62-V74 PolarHBondContact O-N 2.78Å; F64-V74 HydrophobicContact CE2-CG2 4.1Å; V74-V81 HydrophobicContact CG1-CG1 4.05Å; V74-I83 HydrophobicContact CG2-CG1 4.41Å
75	R	94.8	Very high	96.7	Very high	96 Å²	96	76.9 Å²	76.9	36%	0.362	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.7	152.6	-177.3	66.7	-174.8	-177.7	96.1	2.7	112.2	L82	R75-L82 PolarHBondContact N-O 2.99Å; R75-L82 PolarHBondContact O-N 3.36Å
76	D	95.6	Very high	96.7	Very high	110 Å²	110	73.3 Å²	73.3	59%	0.588	36%	0.364	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.4	130.6	164.3	-168.1	-27.8	0	0	0	109.4	G79 K80	D76-G79 VanDerWaalsContact OD1-CA 3.24Å; D76-G79 WeakPolarHBondContact OD1-CA 3.48Å; D76-G79 PolarHBondContact OD1-N 3.28Å; D76-K80 PolarHBondContact OD1-N 3.01Å
77	F	93.5	Very high	96.7	Very high	97 Å²	97	71 Å²	71	43%	0.425	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	113.6	170.9	-174.7	-108.8	0	0	0	110.5	G79 K80 L82	F77-G79 VanDerWaalsContact C-N 3.28Å; F77-G79 PolarHBondContact O-N 3.39Å; F77-K80 PolarHBondContact N-O 3.07Å; F77-K80 PolarHBondContact O-N 2.97Å; F77-L82 HydrophobicContact CB-CD1 3.86Å; F77-L82 HydrophobicContact CD1-CD1 4.24Å; F77-L82 HydrophobicContact CG-CD1 4.41Å
78	K	95.5	Very high	96.8	Very high	182 Å²	182	71.2 Å²	71.2	79%	0.791	34%	0.343	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.5	42.4	-179.6	-57.5	-175.8	175.9	-175.3	0	112.5	K80	K78-K80 VanDerWaalsContact C-N 3.3Å; K78-K80 PolarHBondContact O-N 3.29Å
79	G	96.3	Very high	96.8	Very high	67 Å²	67	68.5 Å²	68.5	69%	0.691	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	76	16.9	178.6	0	0	0	0	0	113.8	D76 F77	D76-G79 VanDerWaalsContact OD1-CA 3.24Å; D76-G79 WeakPolarHBondContact OD1-CA 3.48Å; D76-G79 PolarHBondContact OD1-N 3.28Å; F77-G79 VanDerWaalsContact C-N 3.28Å; F77-G79 PolarHBondContact O-N 3.39Å
80	K	97	Very high	96.9	Very high	152 Å²	152	71.6 Å²	71.6	66%	0.661	34%	0.343	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.5	127.9	178.2	-62.6	-174.4	-179.5	-175.4	0	109.3	D76 F77 K78 L82	D76-K80 PolarHBondContact OD1-N 3.01Å; F77-K80 PolarHBondContact N-O 3.07Å; F77-K80 PolarHBondContact O-N 2.97Å; K78-K80 VanDerWaalsContact C-N 3.3Å; K78-K80 PolarHBondContact O-N 3.29Å; K80-L82 PolarHBondContact O-N 3.4Å
81	V	97.1	Very high	96.8	Very high	72 Å²	72	65.7 Å²	65.7	44%	0.436	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.7	129.2	171	-179.9	0	0	0	0	108.9	V74 P107	V74-V81 HydrophobicContact CG1-CG1 4.05Å; V81-P107 HydrophobicContact CB-CG 4.11Å; V81-P107 HydrophobicContact CG1-CG 4.34Å; V81-P107 WeakPolarHBondContact O-CD 3.17Å
82	L	97.5	Very high	96.8	Very high	29 Å²	29	69.6 Å²	69.6	15%	0.152	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	137.7	174.8	-65.3	177.6	0	0	0	110.1	R75 F77 K80 L105	R75-L82 PolarHBondContact N-O 2.99Å; R75-L82 PolarHBondContact O-N 3.36Å; F77-L82 HydrophobicContact CB-CD1 3.86Å; F77-L82 HydrophobicContact CD1-CD1 4.24Å; F77-L82 HydrophobicContact CG-CD1 4.41Å; K80-L82 PolarHBondContact O-N 3.4Å; L82-L105 WeakPolarHBondContact CA-O 3.2Å
83	I	98.1	Very high	96.7	Very high	9 Å²	9	75.6 Å²	75.6	5%	0.046	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	105.7	170.4	-56.3	83.1	0	0	0	106.5	V72 S73 V74 L105 P107 W110	V72-I83 HydrophobicContact CG1-CG2 3.74Å; S73-I83 CarbonylContact O-C 3.51Å; S73-I83 WeakPolarHBondContact O-CA 3.35Å; V74-I83 HydrophobicContact CG2-CG1 4.41Å; I83-L105 PolarHBondContact N-O 2.95Å; I83-L105 PolarHBondContact O-N 3.31Å; I83-P107 HydrophobicContact CD1-CG 4.39Å; I83-W110 HydrophobicContact CD1-CB 3.9Å; I83-W110 HydrophobicContact CD1-CG 4.21Å; I83-W110 HydrophobicContact CG1-CB 4.23Å; I83-W110 HydrophobicContact CG1-CD2 4.48Å; I83-W110 HydrophobicContact CG1-CG 4.09Å; I83-W110 HydrophobicContact CG2-CD2 4.19Å; I83-W110 HydrophobicContact CG2-CE3 4.04Å; I83-W110 HydrophobicContact CG2-CZ3 4.41Å
84	D	97.4	Very high	96.6	Very high	4 Å²	4	77.1 Å²	77.1	2%	0.021	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	118.4	-175.5	-169.5	-108	0	0	0	111	V72 S73 R86 I103 S104	V72-D84 CarbonylContact C-O 3.53Å; V72-D84 VanDerWaalsContact CA-O 3.27Å; V72-D84 WeakPolarHBondContact CA-O 3.5Å; S73-D84 PolarHBondContact N-O 2.93Å; S73-D84 PolarHBondContact O-N 2.86Å; S73-D84 WeakPolarHBondContact OG-CB 3.42Å; D84-R86 WeakPolarHBondContact OD1-CB 3.38Å; D84-R86 WeakPolarHBondContact OD1-CD 3.33Å; D84-R86 IonicContact OD1-CZ 3.58Å; D84-R86 IonicContact OD1-NE 3.74Å; D84-R86 PolarHBondContact OD1-NE 2.8Å; D84-R86 IonicContact OD1-NH2 2.8Å; D84-R86 IonicContact OD2-CZ 3.61Å; D84-R86 IonicContact OD2-NE 3.5Å; D84-R86 PolarHBondContact OD2-NE 2.96Å; D84-R86 IonicContact OD2-NH2 3.85Å; D84-R86 PolarHBondContact OD2-NH2 3.48Å; D84-I103 WeakPolarHBondContact CA-O 3.42Å; D84-S104 PolarHBondContact OD2-OG 3.03Å
85	I	98.1	Very high	96.5	Very high	48 Å²	48	79.9 Å²	79.9	25%	0.246	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	110	175.1	-51.5	176.3	0	0	0	107.2	I66 V72 G102 I103 L105 W110 L113	I66-I85 HydrophobicContact CD1-CG2 4.14Å; V72-I85 HydrophobicContact CG1-CG1 4.31Å; V72-I85 HydrophobicContact CG2-CG1 4.15Å; V72-I85 HydrophobicContact CG2-CG2 4.35Å; I85-G102 CarbonylContact O-C 3.47Å; I85-G102 WeakPolarHBondContact O-CA 3.38Å; I85-I103 HydrophobicContact CB-CG2 4.36Å; I85-I103 PolarHBondContact N-O 3.13Å; I85-I103 PolarHBondContact O-N 2.81Å; I85-L105 HydrophobicContact CD1-CD1 4.13Å; I85-W110 HydrophobicContact CD1-CZ3 4.4Å; I85-L113 HydrophobicContact CD1-CD2 4.49Å
86	R	97.5	Very high	96.4	Very high	46 Å²	46	78.6 Å²	78.6	17%	0.174	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.4	143.9	-166.7	-176.1	172.4	-55.4	-79.9	-9.3	114.8	R70 Y71 D84 Y88 P98 G99	R70-R86 WeakPolarHBondContact CA-O 3.41Å; Y71-R86 PolarHBondContact N-O 3Å; Y71-R86 PolarHBondContact O-N 3.48Å; D84-R86 WeakPolarHBondContact OD1-CB 3.38Å; D84-R86 WeakPolarHBondContact OD1-CD 3.33Å; D84-R86 IonicContact OD1-CZ 3.58Å; D84-R86 IonicContact OD1-NE 3.74Å; D84-R86 PolarHBondContact OD1-NE 2.8Å; D84-R86 IonicContact OD1-NH2 2.8Å; D84-R86 IonicContact OD2-CZ 3.61Å; D84-R86 IonicContact OD2-NE 3.5Å; D84-R86 PolarHBondContact OD2-NE 2.96Å; D84-R86 IonicContact OD2-NH2 3.85Å; D84-R86 PolarHBondContact OD2-NH2 3.48Å; R86-Y88 HydrophobicContact CB-CE2 4.04Å; R86-Y88 HydrophobicContact CG-CD2 4.38Å; R86-Y88 HydrophobicContact CG-CE2 4.17Å; R86-P98 HydrophobicContact CG-CB 4.48Å; R86-G99 PolarHBondContact NH1-O 3.43Å
87	E	97.7	Very high	96.4	Very high	56 Å²	56	76.8 Å²	76.8	26%	0.262	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.5	130	166.4	-172.6	172.7	119.1	0	0	109.9	M69 R70 G99 K101	M69-E87 CarbonylContact O-C 3.5Å; M69-E87 VanDerWaalsContact O-CA 3.29Å; M69-E87 WeakPolarHBondContact O-CA 3.47Å; R70-E87 HydrophobicContact CG-CB 4.33Å; R70-E87 HydrophobicContact CG-CG 4.42Å; R70-E87 IonicContact CZ-OE2 3.92Å; R70-E87 IonicContact NE-OE2 3.53Å; R70-E87 IonicContact NH2-OE2 3.36Å; R70-E87 PolarHBondContact NH2-OE2 2.96Å; E87-G99 WeakPolarHBondContact O-CA 3.18Å; E87-G99 PolarHBondContact O-N 2.93Å; E87-K101 HydrophobicContact CB-CB 4.12Å; E87-K101 PolarHBondContact N-O 3.42Å; E87-K101 IonicContact OE1-NZ 3.37Å; E87-K101 PolarHBondContact OE1-NZ 3.35Å; E87-K101 IonicContact OE2-NZ 3.96Å
88	Y	97.4	Very high	96.5	Very high	33 Å²	33	75.9 Å²	75.9	13%	0.129	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	163.8	176.4	-75.2	-110.1	0	0	0	110.1	M63 M69 Y71 R86 M96 K97 P98	M63-Y88 WeakPolarHBondContact CE-OH 3.27Å; M69-Y88 WeakPolarHBondContact CB-O 3.5Å; M69-Y88 WeakPolarHBondContact CE-O 3.06Å; M69-Y88 PolarHBondContact O-N 3.05Å; Y71-Y88 AromaticContact CD2-CD2 3.61Å; Y71-Y88 HydrophobicContact CD2-CD2 3.61Å; Y71-Y88 HydrophobicContact CD2-CE2 4.05Å; Y71-Y88 HydrophobicContact CD2-CG 4.16Å; Y71-Y88 HydrophobicContact CE2-CD2 4.39Å; Y71-Y88 HydrophobicContact CG-CD2 4.42Å; Y71-Y88 HydrophobicContact CG-CE2 4.44Å; R86-Y88 HydrophobicContact CB-CE2 4.04Å; R86-Y88 HydrophobicContact CG-CD2 4.38Å; R86-Y88 HydrophobicContact CG-CE2 4.17Å; Y88-M96 HydrophobicContact CD1-CB 4.32Å; Y88-M96 HydrophobicContact CG-CE 4.28Å; Y88-K97 CarbonylContact C-O 3.46Å; Y88-K97 VanDerWaalsContact CA-O 3.23Å; Y88-K97 WeakPolarHBondContact CA-O 3.45Å; Y88-K97 WeakPolarHBondContact CB-O 3.41Å; Y88-K97 VanDerWaalsContact CD1-C 3.44Å; Y88-K97 WeakPolarHBondContact CD1-O 2.92Å; Y88-P98 HydrophobicContact CD1-CB 4.47Å; Y88-P98 HydrophobicContact CE1-CB 4.09Å
89	W	96.7	Very high	96.5	Very high	127 Å²	127	67.9 Å²	67.9	48%	0.481	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	153	170.6	60.2	-75.7	0	0	0	108.9	M69 D91 K97 P98	M69-W89 VanDerWaalsContact CE-CA 3.46Å; W89-D91 HydrophobicContact CE3-CB 4.2Å; W89-D91 HydrophobicContact CH2-CB 3.72Å; W89-D91 HydrophobicContact CZ3-CB 3.42Å; W89-D91 VanDerWaalsContact CZ3-CB 3.42Å; W89-K97 VanDerWaalsContact CD1-O 3.24Å; W89-K97 HydrophobicContact CD2-CB 4.13Å; W89-K97 VanDerWaalsContact CE2-CB 3.46Å; W89-K97 HydrophobicContact CG-CB 4.5Å; W89-K97 HydrophobicContact CH2-CB 4.39Å; W89-K97 HydrophobicContact CH2-CG 4.22Å; W89-K97 HydrophobicContact CZ2-CB 3.6Å; W89-K97 HydrophobicContact CZ2-CG 3.85Å; W89-K97 PolarHBondContact N-O 2.88Å; W89-K97 PolarHBondContact O-N 2.79Å; W89-P98 PolarHBondContact NE1-O 2.79Å
90	M	96.3	Very high	96.5	Very high	112 Å²	112	76.7 Å²	76.7	55%	0.552	38%	0.377	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.1	128.5	171.3	-63.7	-173.3	88.4	0	0	108.4	M69 G94 E95 M96	M69-M90 HydrophobicContact CE-CG 3.86Å; M90-G94 VanDerWaalsContact CE-O 3.3Å; M90-G94 WeakPolarHBondContact CE-O 3.43Å; M90-E95 WeakPolarHBondContact CA-O 3.32Å; M90-M96 HydrophobicContact CG-SD 3.48Å; M90-M96 WeakPolarHBondContact CG-SD 3.41Å; M90-M96 HydrophobicContact SD-SD 4.39Å
91	D	96.1	Very high	96.6	Very high	17 Å²	17	76.1 Å²	76.1	9%	0.091	38%	0.375	C	S	.	.			trans	-75.6	169	170.7	68.5	14.6	0	0	0	112	W89 E93 G94 E95 K97	W89-D91 HydrophobicContact CE3-CB 4.2Å; W89-D91 HydrophobicContact CH2-CB 3.72Å; W89-D91 HydrophobicContact CZ3-CB 3.42Å; W89-D91 VanDerWaalsContact CZ3-CB 3.42Å; D91-E93 PolarHBondContact O-N 3.17Å; D91-E93 WeakPolarHBondContact OD1-CA 3.43Å; D91-E93 WeakPolarHBondContact OD1-CB 3.49Å; D91-E93 PolarHBondContact OD1-N 3.15Å; D91-E93 VanDerWaalsContact OD1-N 3.16Å; D91-G94 PolarHBondContact O-N 3.37Å; D91-G94 PolarHBondContact OD1-N 2.59Å; D91-E95 PolarHBondContact N-O 2.8Å; D91-E95 PolarHBondContact OD1-N 2.74Å; D91-E95 WeakPolarHBondContact OD2-CB 3.41Å; D91-K97 HydrophobicContact CB-CG 4.31Å; D91-K97 WeakPolarHBondContact OD2-CE 3.49Å; D91-K97 IonicContact OD2-NZ 3.5Å
92	P	97.2	Very high	96.6	Very high	124 Å²	124	74.7 Å²	74.7	81%	0.805	37%	0.374	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.4	-24	177.2	-26.3	36.8	0	0	0	114	G94	P92-G94 VanDerWaalsContact C-N 3.29Å
93	E	97	Very high	96.6	Very high	147 Å²	147	77.9 Å²	77.9	69%	0.687	39%	0.391	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.7	-11.5	176.1	-61.9	68.8	-147.8	0	0	112.7	D91	D91-E93 PolarHBondContact O-N 3.17Å; D91-E93 WeakPolarHBondContact OD1-CA 3.43Å; D91-E93 WeakPolarHBondContact OD1-CB 3.49Å; D91-E93 PolarHBondContact OD1-N 3.15Å; D91-E93 VanDerWaalsContact OD1-N 3.16Å
94	G	94.6	Very high	96.6	Very high	41 Å²	41	79.5 Å²	79.5	42%	0.423	40%	0.403	S	S	.	.	S	Bend	trans	89.6	9	179.1	0	0	0	0	0	114.3	M90 D91 P92	M90-G94 VanDerWaalsContact CE-O 3.3Å; M90-G94 WeakPolarHBondContact CE-O 3.43Å; D91-G94 PolarHBondContact O-N 3.37Å; D91-G94 PolarHBondContact OD1-N 2.59Å; P92-G94 VanDerWaalsContact C-N 3.29Å
95	E	94.8	Very high	96.6	Very high	108 Å²	108	80.2 Å²	80.2	51%	0.505	41%	0.406	S	S	.	.			trans	-83	139.2	176.3	-55.4	-172.5	167	0	0	111.6	M90 D91 K97	M90-E95 WeakPolarHBondContact CA-O 3.32Å; D91-E95 PolarHBondContact N-O 2.8Å; D91-E95 PolarHBondContact OD1-N 2.74Å; D91-E95 WeakPolarHBondContact OD2-CB 3.41Å; E95-K97 PolarHBondContact O-N 2.64Å; E95-K97 WeakPolarHBondContact OE2-CE 3.27Å; E95-K97 IonicContact OE2-NZ 2.61Å; E95-K97 PolarHBondContact OE2-NZ 3.5Å
96	M	92.9	Very high	96.6	Very high	69 Å²	69	80.5 Å²	80.5	34%	0.34	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.7	112.9	173.6	-70.2	-69.8	-76.5	0	0	110	M69 Y71 Y88 M90	M69-M96 HydrophobicContact CE-CE 3.54Å; M69-M96 HydrophobicContact CE-SD 3.48Å; M69-M96 WeakPolarHBondContact CE-SD 3.18Å; M69-M96 HydrophobicContact SD-CE 3.85Å; M69-M96 HydrophobicContact SD-SD 4.07Å; Y71-M96 HydrophobicContact CE2-CE 3.53Å; Y88-M96 HydrophobicContact CD1-CB 4.32Å; Y88-M96 HydrophobicContact CG-CE 4.28Å; M90-M96 HydrophobicContact CG-SD 3.48Å; M90-M96 WeakPolarHBondContact CG-SD 3.41Å; M90-M96 HydrophobicContact SD-SD 4.39Å
97	K	95	Very high	96.7	Very high	73 Å²	73	81.6 Å²	81.6	32%	0.317	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	140.8	177	-61.5	-66	179.2	-175.6	0	110.9	Y88 W89 D91 E95 G99	Y88-K97 CarbonylContact C-O 3.46Å; Y88-K97 VanDerWaalsContact CA-O 3.23Å; Y88-K97 WeakPolarHBondContact CA-O 3.45Å; Y88-K97 WeakPolarHBondContact CB-O 3.41Å; Y88-K97 VanDerWaalsContact CD1-C 3.44Å; Y88-K97 WeakPolarHBondContact CD1-O 2.92Å; W89-K97 VanDerWaalsContact CD1-O 3.24Å; W89-K97 HydrophobicContact CD2-CB 4.13Å; W89-K97 VanDerWaalsContact CE2-CB 3.46Å; W89-K97 HydrophobicContact CG-CB 4.5Å; W89-K97 HydrophobicContact CH2-CB 4.39Å; W89-K97 HydrophobicContact CH2-CG 4.22Å; W89-K97 HydrophobicContact CZ2-CB 3.6Å; W89-K97 HydrophobicContact CZ2-CG 3.85Å; W89-K97 PolarHBondContact N-O 2.88Å; W89-K97 PolarHBondContact O-N 2.79Å; D91-K97 HydrophobicContact CB-CG 4.31Å; D91-K97 WeakPolarHBondContact OD2-CE 3.49Å; D91-K97 IonicContact OD2-NZ 3.5Å; E95-K97 PolarHBondContact O-N 2.64Å; E95-K97 WeakPolarHBondContact OE2-CE 3.27Å; E95-K97 IonicContact OE2-NZ 2.61Å; E95-K97 PolarHBondContact OE2-NZ 3.5Å; K97-G99 PolarHBondContact O-N 2.77Å
98	P	96	Very high	96.7	Very high	77 Å²	77	85 Å²	85	50%	0.5	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.1	130.5	173.5	26	-33	0	0	0	110	R86 Y88 W89	R86-P98 HydrophobicContact CG-CB 4.48Å; Y88-P98 HydrophobicContact CD1-CB 4.47Å; Y88-P98 HydrophobicContact CE1-CB 4.09Å; W89-P98 PolarHBondContact NE1-O 2.79Å
99	G	96.3	Very high	96.7	Very high	14 Å²	14	87.7 Å²	87.7	14%	0.144	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.4	175.1	174.5	0	0	0	0	0	112.8	R86 E87 K97 K101	R86-G99 PolarHBondContact NH1-O 3.43Å; E87-G99 WeakPolarHBondContact O-CA 3.18Å; E87-G99 PolarHBondContact O-N 2.93Å; K97-G99 PolarHBondContact O-N 2.77Å; G99-K101 VanDerWaalsContact C-N 3.32Å
100	R	96.8	Very high	96.8	Very high	253 Å²	253	85.7 Å²	85.7	96%	0.955	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-71.7	-26.2	176.5	-64	-176.1	-177	-177.2	0.5	112.9	G102	R100-G102 PolarHBondContact O-N 3.17Å
101	K	97.9	Very high	96.9	Very high	140 Å²	140	82.5 Å²	82.5	61%	0.609	43%	0.432	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.4	107.8	-179.4	-61.4	177.9	-170.2	163.3	0	110	E87 G99	E87-K101 HydrophobicContact CB-CB 4.12Å; E87-K101 PolarHBondContact N-O 3.42Å; E87-K101 IonicContact OE1-NZ 3.37Å; E87-K101 PolarHBondContact OE1-NZ 3.35Å; E87-K101 IonicContact OE2-NZ 3.96Å; G99-K101 VanDerWaalsContact C-N 3.32Å
102	G	97.4	Very high	97	Very high	41 Å²	41	86.1 Å²	86.1	42%	0.423	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	167.5	169.2	175.8	0	0	0	0	0	111.9	I85 R100	I85-G102 CarbonylContact O-C 3.47Å; I85-G102 WeakPolarHBondContact O-CA 3.38Å; R100-G102 PolarHBondContact O-N 3.17Å
103	I	98.2	Very high	97.1	Very high	97 Å²	97	83 Å²	83	50%	0.497	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	138.4	179.4	-171.5	166.2	0	0	0	109.7	D84 I85 L105	D84-I103 WeakPolarHBondContact CA-O 3.42Å; I85-I103 HydrophobicContact CB-CG2 4.36Å; I85-I103 PolarHBondContact N-O 3.13Å; I85-I103 PolarHBondContact O-N 2.81Å; I103-L105 HydrophobicContact CD1-CD2 3.76Å; I103-L105 HydrophobicContact CG1-CD2 3.87Å; I103-L105 HydrophobicContact CG2-CD2 4.29Å; I103-L105 HydrophobicContact CG2-CG 4.41Å
104	S	97.5	Very high	97.1	Very high	43 Å²	43	81 Å²	81	30%	0.301	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.4	118.5	168.2	-53.5	0	0	0	0	108.7	D84	D84-S104 PolarHBondContact OD2-OG 3.03Å
105	L	98.3	Very high	97.3	Very high	18 Å²	18	85.7 Å²	85.7	9%	0.094	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.9	142.8	176.8	-56.4	177.5	0	0	0	109.7	L82 I83 I85 I103 Q109 W110 L113	L82-L105 WeakPolarHBondContact CA-O 3.2Å; I83-L105 PolarHBondContact N-O 2.95Å; I83-L105 PolarHBondContact O-N 3.31Å; I85-L105 HydrophobicContact CD1-CD1 4.13Å; I103-L105 HydrophobicContact CD1-CD2 3.76Å; I103-L105 HydrophobicContact CG1-CD2 3.87Å; I103-L105 HydrophobicContact CG2-CD2 4.29Å; I103-L105 HydrophobicContact CG2-CG 4.41Å; L105-Q109 HydrophobicContact CB-CB 4.14Å; L105-Q109 HydrophobicContact CD2-CB 4.22Å; L105-W110 HydrophobicContact CD1-CE3 4.22Å; L105-L113 HydrophobicContact CD1-CD2 4.03Å
106	N	97.9	Very high	97.5	Very high	55 Å²	55	85.5 Å²	85.5	29%	0.294	42%	0.424	S	S	.	.	P	Polyproline II helix	trans	-77.9	169.4	164.3	73.2	10	0	0	0	110.1	E108 Q109 W110	N106-E108 VanDerWaalsContact C-N 3.26Å; N106-E108 PolarHBondContact O-N 3.27Å; N106-E108 PolarHBondContact OD1-N 2.91Å; N106-Q109 PolarHBondContact O-N 2.99Å; N106-Q109 VanDerWaalsContact OD1-CB 3.23Å; N106-Q109 WeakPolarHBondContact OD1-CB 3.45Å; N106-Q109 WeakPolarHBondContact OD1-CG 3.23Å; N106-Q109 PolarHBondContact OD1-N 3.35Å; N106-Q109 PolarHBondContact OD1-OE1 3.23Å; N106-W110 PolarHBondContact O-N 3.16Å
107	P	98	Very high	97.7	Very high	69 Å²	69	85.9 Å²	85.9	45%	0.448	43%	0.427	S	S	.	.	H	α-helix	trans	-61.5	-31.9	-178.2	-26.5	37.3	0	0	0	114	V81 I83 W110 S111	V81-P107 HydrophobicContact CB-CG 4.11Å; V81-P107 HydrophobicContact CG1-CG 4.34Å; V81-P107 WeakPolarHBondContact O-CD 3.17Å; I83-P107 HydrophobicContact CD1-CG 4.39Å; P107-W110 PolarHBondContact O-N 3.39Å; P107-S111 PolarHBondContact O-N 2.82Å
108	E	98.2	Very high	97.9	Very high	127 Å²	127	86 Å²	86	59%	0.593	44%	0.437	S	S	*	.	H	α-helix	trans	-67.2	-49.3	178	-176.3	-177.5	-179.2	0	0	111.6	N106 W110 S111 Q112	N106-E108 VanDerWaalsContact C-N 3.26Å; N106-E108 PolarHBondContact O-N 3.27Å; N106-E108 PolarHBondContact OD1-N 2.91Å; E108-W110 VanDerWaalsContact C-N 3.28Å; E108-W110 PolarHBondContact O-N 2.83Å; E108-S111 WeakPolarHBondContact O-CB 3.04Å; E108-S111 PolarHBondContact O-N 3.28Å; E108-S111 VanDerWaalsContact O-N 3.07Å; E108-Q112 PolarHBondContact O-N 3.46Å
109	Q	98.3	Very high	98	Very high	90 Å²	90	87.6 Å²	87.6	42%	0.421	44%	0.441	S	S	.	.	H	α-helix	trans	-60.5	-39	174.7	-71.6	164.5	-17.6	0	0	111.3	L105 N106 S111 Q112 L113	L105-Q109 HydrophobicContact CB-CB 4.14Å; L105-Q109 HydrophobicContact CD2-CB 4.22Å; N106-Q109 PolarHBondContact O-N 2.99Å; N106-Q109 VanDerWaalsContact OD1-CB 3.23Å; N106-Q109 WeakPolarHBondContact OD1-CB 3.45Å; N106-Q109 WeakPolarHBondContact OD1-CG 3.23Å; N106-Q109 PolarHBondContact OD1-N 3.35Å; N106-Q109 PolarHBondContact OD1-OE1 3.23Å; Q109-S111 VanDerWaalsContact C-N 3.35Å; Q109-Q112 PolarHBondContact O-N 2.93Å; Q109-L113 WeakPolarHBondContact O-CB 3.48Å; Q109-L113 PolarHBondContact O-N 2.92Å
110	W	98.5	Very high	98	Very high	85 Å²	85	90.4 Å²	90.4	32%	0.322	45%	0.452	S	S	.	.	H	α-helix	trans	-63.7	-38.9	173.5	176.9	-113.8	0	0	0	112.2	I83 I85 L105 N106 P107 E108 L113 K114	I83-W110 HydrophobicContact CD1-CB 3.9Å; I83-W110 HydrophobicContact CD1-CG 4.21Å; I83-W110 HydrophobicContact CG1-CB 4.23Å; I83-W110 HydrophobicContact CG1-CD2 4.48Å; I83-W110 HydrophobicContact CG1-CG 4.09Å; I83-W110 HydrophobicContact CG2-CD2 4.19Å; I83-W110 HydrophobicContact CG2-CE3 4.04Å; I83-W110 HydrophobicContact CG2-CZ3 4.41Å; I85-W110 HydrophobicContact CD1-CZ3 4.4Å; L105-W110 HydrophobicContact CD1-CE3 4.22Å; N106-W110 PolarHBondContact O-N 3.16Å; P107-W110 PolarHBondContact O-N 3.39Å; E108-W110 VanDerWaalsContact C-N 3.28Å; E108-W110 PolarHBondContact O-N 2.83Å; W110-L113 HydrophobicContact CE3-CD2 3.93Å; W110-L113 HydrophobicContact CZ3-CD2 3.83Å; W110-L113 PolarHBondContact O-N 2.91Å; W110-K114 HydrophobicContact CZ2-CD 4.25Å; W110-K114 HydrophobicContact CZ2-CG 4.29Å; W110-K114 WeakPolarHBondContact O-CG 3.45Å; W110-K114 PolarHBondContact O-N 3.37Å; W110-K114 VanDerWaalsContact O-N 3.13Å
111	S	98.3	Very high	98.1	Very high	44 Å²	44	82.3 Å²	82.3	31%	0.308	43%	0.427	S	S	.	.	H	α-helix	trans	-62.8	-49	174	-162	0	0	0	0	111.7	P107 E108 Q109 L113 K114 E115	P107-S111 PolarHBondContact O-N 2.82Å; E108-S111 WeakPolarHBondContact O-CB 3.04Å; E108-S111 PolarHBondContact O-N 3.28Å; E108-S111 VanDerWaalsContact O-N 3.07Å; Q109-S111 VanDerWaalsContact C-N 3.35Å; S111-L113 VanDerWaalsContact C-N 3.29Å; S111-L113 PolarHBondContact O-N 3.32Å; S111-K114 WeakPolarHBondContact O-CB 3.41Å; S111-K114 PolarHBondContact O-N 2.78Å; S111-E115 WeakPolarHBondContact O-CG 3.3Å; S111-E115 PolarHBondContact O-N 2.92Å; S111-E115 PolarHBondContact OG-OE1 2.91Å
112	Q	98.4	Very high	98.2	Very high	93 Å²	93	78.6 Å²	78.6	44%	0.435	42%	0.415	S	S	.	.	H	α-helix	trans	-62	-36.5	178.8	-68.3	-177.3	29.6	0	0	112.5	E108 Q109 K114 E115 Q116	E108-Q112 PolarHBondContact O-N 3.46Å; Q109-Q112 PolarHBondContact O-N 2.93Å; Q112-K114 VanDerWaalsContact C-N 3.34Å; Q112-E115 PolarHBondContact O-N 2.92Å; Q112-Q116 WeakPolarHBondContact O-CG 3.48Å; Q112-Q116 PolarHBondContact O-N 2.94Å; Q112-Q116 VanDerWaalsContact O-N 3.17Å
113	L	98.3	Very high	98.2	Very high	60 Å²	60	79 Å²	79	31%	0.314	41%	0.414	S	S	.	.	H	α-helix	trans	-61.5	-44.2	173.4	177.9	61.3	0	0	0	110.8	I85 L105 Q109 W110 S111 Q116 I117 I120	I85-L113 HydrophobicContact CD1-CD2 4.49Å; L105-L113 HydrophobicContact CD1-CD2 4.03Å; Q109-L113 WeakPolarHBondContact O-CB 3.48Å; Q109-L113 PolarHBondContact O-N 2.92Å; W110-L113 HydrophobicContact CE3-CD2 3.93Å; W110-L113 HydrophobicContact CZ3-CD2 3.83Å; W110-L113 PolarHBondContact O-N 2.91Å; S111-L113 VanDerWaalsContact C-N 3.29Å; S111-L113 PolarHBondContact O-N 3.32Å; L113-Q116 PolarHBondContact O-N 3.01Å; L113-I117 PolarHBondContact O-N 3.01Å; L113-I120 HydrophobicContact CD1-CD1 4.08Å
114	K	98.4	Very high	98.2	Very high	105 Å²	105	78.9 Å²	78.9	46%	0.457	42%	0.417	S	S	.	.	H	α-helix	trans	-64	-40.2	177.7	-71.3	-175.2	-64.5	161.1	0	112.7	W110 S111 Q112 Q116 I117	W110-K114 HydrophobicContact CZ2-CD 4.25Å; W110-K114 HydrophobicContact CZ2-CG 4.29Å; W110-K114 WeakPolarHBondContact O-CG 3.45Å; W110-K114 PolarHBondContact O-N 3.37Å; W110-K114 VanDerWaalsContact O-N 3.13Å; S111-K114 WeakPolarHBondContact O-CB 3.41Å; S111-K114 PolarHBondContact O-N 2.78Å; Q112-K114 VanDerWaalsContact C-N 3.34Å; K114-Q116 PolarHBondContact O-N 3.16Å; K114-I117 HydrophobicContact CB-CD1 4.26Å; K114-I117 HydrophobicContact CG-CD1 4.23Å; K114-I117 WeakPolarHBondContact O-CB 3.32Å; K114-I117 WeakPolarHBondContact O-CG1 3.29Å; K114-I117 PolarHBondContact O-N 2.75Å; K114-I117 VanDerWaalsContact O-N 3.17Å
115	E	98.4	Very high	98.2	Very high	139 Å²	139	85.5 Å²	85.5	65%	0.65	44%	0.436	S	S	*	.	H	α-helix	trans	-61.8	-33.1	176.8	-72.7	163.1	-150.9	0	0	111.8	S111 Q112	S111-E115 WeakPolarHBondContact O-CG 3.3Å; S111-E115 PolarHBondContact O-N 2.92Å; S111-E115 PolarHBondContact OG-OE1 2.91Å; Q112-E115 PolarHBondContact O-N 2.92Å
116	Q	98.1	Very high	98.1	Very high	103 Å²	103	92.7 Å²	92.7	48%	0.481	47%	0.466	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.9	-4.2	177.3	-71.6	-178.2	77	0	0	114.6	Q112 L113 K114 S118 D119 I120	Q112-Q116 WeakPolarHBondContact O-CG 3.48Å; Q112-Q116 PolarHBondContact O-N 2.94Å; Q112-Q116 VanDerWaalsContact O-N 3.17Å; L113-Q116 PolarHBondContact O-N 3.01Å; K114-Q116 PolarHBondContact O-N 3.16Å; Q116-S118 VanDerWaalsContact C-N 3.27Å; Q116-S118 PolarHBondContact O-N 2.78Å; Q116-D119 PolarHBondContact O-N 3.39Å; Q116-D119 VanDerWaalsContact O-N 3.16Å; Q116-I120 HydrophobicContact CB-CD1 4.13Å; Q116-I120 HydrophobicContact CB-CG1 4.5Å; Q116-I120 VanDerWaalsContact O-CG1 3.27Å; Q116-I120 WeakPolarHBondContact O-CG1 3.44Å; Q116-I120 PolarHBondContact O-N 3.18Å
117	I	98.3	Very high	97.9	Very high	78 Å²	78	100 Å²	100	40%	0.4	50%	0.504	S	S	.	.	H	α-helix	trans	-56	-41.4	-176.5	-75	173	0	0	0	111.7	L113 K114 D119 I120 D121	L113-I117 PolarHBondContact O-N 3.01Å; K114-I117 HydrophobicContact CB-CD1 4.26Å; K114-I117 HydrophobicContact CG-CD1 4.23Å; K114-I117 WeakPolarHBondContact O-CB 3.32Å; K114-I117 WeakPolarHBondContact O-CG1 3.29Å; K114-I117 PolarHBondContact O-N 2.75Å; K114-I117 VanDerWaalsContact O-N 3.17Å; I117-D119 PolarHBondContact O-N 3.19Å; I117-I120 PolarHBondContact O-N 2.85Å; I117-D121 WeakPolarHBondContact O-CB 3.32Å; I117-D121 PolarHBondContact O-N 3.15Å
118	S	97.7	Very high	97.9	Very high	75 Å²	75	101.6 Å²	101.6	52%	0.524	51%	0.507	S	S	.	.	H	α-helix	trans	-60.9	-45.9	179.9	-171.8	0	0	0	0	112.1	Q116 I120 D121 D122	Q116-S118 VanDerWaalsContact C-N 3.27Å; Q116-S118 PolarHBondContact O-N 2.78Å; S118-I120 VanDerWaalsContact C-N 3.33Å; S118-D121 PolarHBondContact O-N 3.45Å; S118-D122 PolarHBondContact O-N 2.95Å
119	D	98.1	Very high	97.8	Very high	110 Å²	110	100.2 Å²	100.2	59%	0.588	50%	0.502	S	S	*	.	H	α-helix	trans	-68.6	-35.9	179.7	-64.9	-21	0	0	0	111.3	Q116 I117 D122 A123	Q116-D119 PolarHBondContact O-N 3.39Å; Q116-D119 VanDerWaalsContact O-N 3.16Å; I117-D119 PolarHBondContact O-N 3.19Å; D119-D122 PolarHBondContact O-N 3.4Å; D119-A123 WeakPolarHBondContact O-CB 3.5Å; D119-A123 PolarHBondContact O-N 3.17Å
120	I	98.3	Very high	97.8	Very high	73 Å²	73	100.8 Å²	100.8	37%	0.374	51%	0.507	S	S	.	.	H	α-helix	trans	-64	-46	173.8	-67.4	167.6	0	0	0	110.3	L113 Q116 I117 S118 D122 A123 V124	L113-I120 HydrophobicContact CD1-CD1 4.08Å; Q116-I120 HydrophobicContact CB-CD1 4.13Å; Q116-I120 HydrophobicContact CB-CG1 4.5Å; Q116-I120 VanDerWaalsContact O-CG1 3.27Å; Q116-I120 WeakPolarHBondContact O-CG1 3.44Å; Q116-I120 PolarHBondContact O-N 3.18Å; I117-I120 PolarHBondContact O-N 2.85Å; S118-I120 VanDerWaalsContact C-N 3.33Å; I120-D122 VanDerWaalsContact C-N 3.33Å; I120-D122 PolarHBondContact O-N 3.48Å; I120-A123 WeakPolarHBondContact O-CB 3.43Å; I120-A123 PolarHBondContact O-N 2.61Å; I120-A123 VanDerWaalsContact O-N 3.15Å; I120-V124 HydrophobicContact CG2-CG2 4.37Å; I120-V124 VanDerWaalsContact O-CG2 3.32Å; I120-V124 WeakPolarHBondContact O-CG2 3.35Å; I120-V124 PolarHBondContact O-N 3.36Å
121	D	98.4	Very high	97.8	Very high	83 Å²	83	101.7 Å²	101.7	44%	0.444	52%	0.518	S	S	.	.	H	α-helix	trans	-63.9	-38.1	178.3	-76.1	-19.4	0	0	0	111.7	I117 S118 V124 R125	I117-D121 WeakPolarHBondContact O-CB 3.32Å; I117-D121 PolarHBondContact O-N 3.15Å; S118-D121 PolarHBondContact O-N 3.45Å; D121-V124 PolarHBondContact O-N 3.48Å; D121-R125 WeakPolarHBondContact O-CG 3.45Å; D121-R125 PolarHBondContact O-N 3.07Å; D121-R125 VanDerWaalsContact O-N 3.07Å; D121-R125 PolarHBondContact O-NE 3.39Å
122	D	98.3	Very high	97.7	Very high	63 Å²	63	105.3 Å²	105.3	34%	0.337	53%	0.531	S	S	.	.	H	α-helix	trans	-63.2	-40.8	171.4	-81.9	-10.4	0	0	0	112.6	S118 D119 I120 R125 K126	S118-D122 PolarHBondContact O-N 2.95Å; D119-D122 PolarHBondContact O-N 3.4Å; I120-D122 VanDerWaalsContact C-N 3.33Å; I120-D122 PolarHBondContact O-N 3.48Å; D122-R125 IonicContact OD1-CZ 2.64Å; D122-R125 IonicContact OD1-NE 3.62Å; D122-R125 IonicContact OD1-NH2 2.77Å; D122-R125 PolarHBondContact OD1-NH2 3.36Å; D122-K126 WeakPolarHBondContact O-CD 3.31Å; D122-K126 VanDerWaalsContact O-CG 3.31Å; D122-K126 WeakPolarHBondContact O-CG 3.46Å; D122-K126 PolarHBondContact O-N 3.4Å
123	A	98.3	Very high	97.7	Very high	50 Å²	50	106.1 Å²	106.1	41%	0.413	54%	0.537	S	S	.	.	H	α-helix	trans	-67.9	-41.4	176.8	0	0	0	0	0	112	D119 I120 R125 K126 L127	D119-A123 WeakPolarHBondContact O-CB 3.5Å; D119-A123 PolarHBondContact O-N 3.17Å; I120-A123 WeakPolarHBondContact O-CB 3.43Å; I120-A123 PolarHBondContact O-N 2.61Å; I120-A123 VanDerWaalsContact O-N 3.15Å; A123-R125 VanDerWaalsContact C-N 3.32Å; A123-R125 PolarHBondContact O-N 3.37Å; A123-K126 PolarHBondContact O-N 3.36Å; A123-L127 PolarHBondContact O-N 3.49Å
124	V	98.1	Very high	97.7	Very high	93 Å²	93	109.4 Å²	109.4	56%	0.564	55%	0.553	S	S	*	*	H	α-helix	trans	-62.1	-39.4	176.4	170.9	0	0	0	0	111.2	I120 D121 K126 L127	I120-V124 HydrophobicContact CG2-CG2 4.37Å; I120-V124 VanDerWaalsContact O-CG2 3.32Å; I120-V124 WeakPolarHBondContact O-CG2 3.35Å; I120-V124 PolarHBondContact O-N 3.36Å; D121-V124 PolarHBondContact O-N 3.48Å; V124-K126 VanDerWaalsContact C-N 3.26Å; V124-K126 PolarHBondContact O-N 3.22Å; V124-L127 PolarHBondContact O-N 3.45Å
125	R	97.4	Very high	97.6	Very high	183 Å²	183	109.8 Å²	109.8	69%	0.691	56%	0.561	S	S	*	*	H	α-helix	trans	-69.1	-20.3	178	-75.8	-176.3	-73.9	-157.4	-2.4	114.5	D121 D122 A123	D121-R125 WeakPolarHBondContact O-CG 3.45Å; D121-R125 PolarHBondContact O-N 3.07Å; D121-R125 VanDerWaalsContact O-N 3.07Å; D121-R125 PolarHBondContact O-NE 3.39Å; D122-R125 IonicContact OD1-CZ 2.64Å; D122-R125 IonicContact OD1-NE 3.62Å; D122-R125 IonicContact OD1-NH2 2.77Å; D122-R125 PolarHBondContact OD1-NH2 3.36Å; A123-R125 VanDerWaalsContact C-N 3.32Å; A123-R125 PolarHBondContact O-N 3.37Å
126	K	96.9	Very high	97.5	Very high	169 Å²	169	107.3 Å²	107.3	74%	0.735	55%	0.553	S	S	*	*	H	α-helix	trans	-88	-14.5	179.8	-72.5	168.3	-175	166.9	0	113	D122 A123 V124	D122-K126 WeakPolarHBondContact O-CD 3.31Å; D122-K126 VanDerWaalsContact O-CG 3.31Å; D122-K126 WeakPolarHBondContact O-CG 3.46Å; D122-K126 PolarHBondContact O-N 3.4Å; A123-K126 PolarHBondContact O-N 3.36Å; V124-K126 VanDerWaalsContact C-N 3.26Å; V124-K126 PolarHBondContact O-N 3.22Å
127	L	92.7	Very high	97.5	Very high	208 Å²	208	107.7 Å²	107.7	100%	1.089	56%	0.56	S	S	*	*			trans	-101	0	178.7	-66.3	177	0	0	0	111.1	A123 V124	A123-L127 PolarHBondContact O-N 3.49Å; V124-L127 PolarHBondContact O-N 3.45Å

Retrieved 127 of 127 residues in 273.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).