A0A096N7B3_PAPAN Loading...

Cilia and flagella associated protein 141

AlphaFold DB (F7GRW7), UniProt , Accession A0A096N7B3, Species PAPAN (Papio anubis, Olive baboon), Gene CFAP141, Length 101 aa.

						>A0A096N7B3_PAPAN|A0A096N7B3|CFAP141
MSVEKMTKVEESFQRAMGLKKMVDRWRNSHTHCLWQMTLGQRRNPYATLRMQDTMVQELALAKKQLLMVRQAALHQLFEKEHQQYQQELNQMGKAFYIERF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.6	Low	81.2	Confident	189 Å²	189	114 Å²	114	93%	0.931	58%	0.58	S	S	*	*				0	129.9	0	-78	-70.5	-82.5	0	0	108	K5	M1-K5 HydrophobicContact CE-CB 4.4Å
2	S	78.9	Confident	81.9	Confident	62 Å²	62	110 Å²	110	43%	0.434	57%	0.57	S	S	.	*			trans	-74.9	143.3	179.6	179.2	0	0	0	0	110.8	E4 K5 M6	S2-E4 PolarHBondContact O-N 2.85Å; S2-K5 WeakPolarHBondContact O-CB 3.44Å; S2-K5 PolarHBondContact O-N 3.39Å; S2-M6 PolarHBondContact O-N 3.38Å
3	V	78.5	Confident	82.6	Confident	114 Å²	114	110.2 Å²	110.2	69%	0.691	57%	0.565	S	S	*	*	H	α-helix	trans	-53.1	-38.3	-179.5	175.8	0	0	0	0	111.6	K5 M6 T7	V3-K5 VanDerWaalsContact C-N 3.27Å; V3-K5 PolarHBondContact O-N 3.02Å; V3-M6 PolarHBondContact O-N 3.33Å; V3-M6 VanDerWaalsContact O-N 3.11Å; V3-T7 PolarHBondContact O-N 2.86Å; V3-T7 PolarHBondContact O-OG1 3.31Å
4	E	77.8	Confident	83.3	Confident	135 Å²	135	109.9 Å²	109.9	63%	0.631	56%	0.559	S	S	*	*	H	α-helix	trans	-63.7	-27.3	176.6	-64.8	179.8	168	0	0	114.3	S2 T7 K8	S2-E4 PolarHBondContact O-N 2.85Å; E4-T7 WeakPolarHBondContact CA-OG1 3.26Å; E4-T7 PolarHBondContact O-OG1 3.39Å; E4-T7 VanDerWaalsContact O-OG1 3.04Å; E4-K8 WeakPolarHBondContact O-CG 3.36Å; E4-K8 PolarHBondContact O-N 3.26Å
5	K	79.7	Confident	83.9	Confident	128 Å²	128	114 Å²	114	56%	0.557	57%	0.565	S	S	*	*	H	α-helix	trans	-77.8	-33.5	175.6	-64.8	-174.7	179.1	-176.7	0	110.6	M1 S2 V3 V9	M1-K5 HydrophobicContact CE-CB 4.4Å; S2-K5 WeakPolarHBondContact O-CB 3.44Å; S2-K5 PolarHBondContact O-N 3.39Å; V3-K5 VanDerWaalsContact C-N 3.27Å; V3-K5 PolarHBondContact O-N 3.02Å; K5-V9 VanDerWaalsContact O-CG2 3.28Å; K5-V9 WeakPolarHBondContact O-CG2 3.26Å; K5-V9 PolarHBondContact O-N 3.12Å
6	M	80	Confident	84.5	Confident	124 Å²	124	110.4 Å²	110.4	61%	0.611	56%	0.559	S	S	*	*	H	α-helix	trans	-70.7	-40	176.9	-66.2	-166.5	71.5	0	0	111.9	S2 V3 V9 E10	S2-M6 PolarHBondContact O-N 3.38Å; V3-M6 PolarHBondContact O-N 3.33Å; V3-M6 VanDerWaalsContact O-N 3.11Å; M6-V9 PolarHBondContact O-N 3Å; M6-E10 PolarHBondContact O-N 3.41Å
7	T	83.5	Confident	85.2	Confident	71 Å²	71	107.7 Å²	107.7	44%	0.436	55%	0.545	S	S	.	.	H	α-helix	trans	-64.5	-41.6	176.4	51.9	0	0	0	0	112.3	V3 E4 V9 E10 E11	V3-T7 PolarHBondContact O-N 2.86Å; V3-T7 PolarHBondContact O-OG1 3.31Å; E4-T7 WeakPolarHBondContact CA-OG1 3.26Å; E4-T7 PolarHBondContact O-OG1 3.39Å; E4-T7 VanDerWaalsContact O-OG1 3.04Å; T7-V9 VanDerWaalsContact C-N 3.33Å; T7-V9 PolarHBondContact O-N 3.36Å; T7-E10 PolarHBondContact O-N 2.89Å; T7-E11 WeakPolarHBondContact O-CG 3.47Å; T7-E11 PolarHBondContact O-N 2.98Å
8	K	87.3	Confident	85.7	Confident	138 Å²	138	103.8 Å²	103.8	60%	0.6	54%	0.536	S	S	*	.	H	α-helix	trans	-62.4	-37.7	174.6	-73.9	175.7	-178	177.2	0	113.2	E4 S12	E4-K8 WeakPolarHBondContact O-CG 3.36Å; E4-K8 PolarHBondContact O-N 3.26Å; K8-S12 WeakPolarHBondContact O-CB 3.37Å; K8-S12 PolarHBondContact O-N 3.22Å; K8-S12 PolarHBondContact O-OG 3.45Å
9	V	87.4	Confident	86.2	Confident	90 Å²	90	104.2 Å²	104.2	55%	0.545	54%	0.539	S	S	.	.	H	α-helix	trans	-66.4	-44.4	175.6	170.3	0	0	0	0	110.4	K5 M6 T7 E11 S12 F13	K5-V9 VanDerWaalsContact O-CG2 3.28Å; K5-V9 WeakPolarHBondContact O-CG2 3.26Å; K5-V9 PolarHBondContact O-N 3.12Å; M6-V9 PolarHBondContact O-N 3Å; T7-V9 VanDerWaalsContact C-N 3.33Å; T7-V9 PolarHBondContact O-N 3.36Å; V9-E11 PolarHBondContact O-N 3.32Å; V9-S12 PolarHBondContact O-N 3.06Å; V9-S12 PolarHBondContact O-OG 3.34Å; V9-F13 WeakPolarHBondContact O-CB 3.4Å; V9-F13 PolarHBondContact O-N 3.49Å
10	E	88.4	Confident	86.7	Confident	98 Å²	98	105.4 Å²	105.4	46%	0.458	54%	0.54	S	S	.	.	H	α-helix	trans	-60.2	-46.2	176.2	-174.2	57	-148	0	0	111.8	M6 T7 S12 F13 Q14	M6-E10 PolarHBondContact O-N 3.41Å; T7-E10 PolarHBondContact O-N 2.89Å; E10-S12 VanDerWaalsContact C-N 3.33Å; E10-S12 PolarHBondContact O-N 3.18Å; E10-F13 WeakPolarHBondContact O-CB 3.49Å; E10-F13 PolarHBondContact O-N 2.88Å; E10-F13 VanDerWaalsContact O-N 3.16Å; E10-Q14 WeakPolarHBondContact O-CG 3.17Å; E10-Q14 PolarHBondContact O-N 3.11Å; E10-Q14 PolarHBondContact OE1-NE2 3.4Å
11	E	91.1	Very high	87.2	Confident	105 Å²	105	106.2 Å²	106.2	49%	0.491	54%	0.539	S	S	.	.	H	α-helix	trans	-59.7	-42.4	175.7	-73.3	177.4	-166.1	0	0	112.6	T7 V9 F13 Q14 R15	T7-E11 WeakPolarHBondContact O-CG 3.47Å; T7-E11 PolarHBondContact O-N 2.98Å; V9-E11 PolarHBondContact O-N 3.32Å; E11-F13 VanDerWaalsContact C-N 3.31Å; E11-F13 PolarHBondContact O-N 3.03Å; E11-Q14 PolarHBondContact O-N 3.32Å; E11-R15 VanDerWaalsContact O-CG 3.3Å; E11-R15 WeakPolarHBondContact O-CG 3.3Å; E11-R15 PolarHBondContact O-N 2.94Å; E11-R15 IonicContact OE2-NH2 3.95Å
12	S	89.2	Confident	88.9	Confident	66 Å²	66	103.4 Å²	103.4	46%	0.462	53%	0.525	S	S	.	.	H	α-helix	trans	-65.2	-37.1	177.1	71.6	0	0	0	0	112	K8 V9 E10 R15 A16	K8-S12 WeakPolarHBondContact O-CB 3.37Å; K8-S12 PolarHBondContact O-N 3.22Å; K8-S12 PolarHBondContact O-OG 3.45Å; V9-S12 PolarHBondContact O-N 3.06Å; V9-S12 PolarHBondContact O-OG 3.34Å; E10-S12 VanDerWaalsContact C-N 3.33Å; E10-S12 PolarHBondContact O-N 3.18Å; S12-R15 PolarHBondContact O-N 3.21Å; S12-A16 WeakPolarHBondContact O-CB 3.35Å; S12-A16 PolarHBondContact O-N 3.45Å
13	F	91.2	Very high	89.7	Confident	113 Å²	113	104.6 Å²	104.6	50%	0.496	53%	0.53	S	S	.	.	H	α-helix	trans	-66.1	-44.7	175.7	-178.7	-102.8	0	0	0	111.3	V9 E10 E11 R15 A16 M17	V9-F13 WeakPolarHBondContact O-CB 3.4Å; V9-F13 PolarHBondContact O-N 3.49Å; E10-F13 WeakPolarHBondContact O-CB 3.49Å; E10-F13 PolarHBondContact O-N 2.88Å; E10-F13 VanDerWaalsContact O-N 3.16Å; E11-F13 VanDerWaalsContact C-N 3.31Å; E11-F13 PolarHBondContact O-N 3.03Å; F13-R15 VanDerWaalsContact C-N 3.34Å; F13-R15 PolarHBondContact O-N 3.48Å; F13-A16 PolarHBondContact O-N 3.11Å; F13-M17 HydrophobicContact CD1-CG 4.3Å; F13-M17 HydrophobicContact CE1-CG 3.89Å; F13-M17 HydrophobicContact CE2-CG 4.35Å; F13-M17 HydrophobicContact CZ-CG 3.92Å; F13-M17 HydrophobicContact CZ-SD 4.3Å; F13-M17 WeakPolarHBondContact O-CB 3.09Å; F13-M17 WeakPolarHBondContact O-CG 3.44Å; F13-M17 PolarHBondContact O-N 3.01Å
14	Q	92.3	Very high	90.6	Very high	105 Å²	105	102.6 Å²	102.6	49%	0.491	52%	0.515	S	S	.	.	H	α-helix	trans	-62.4	-39.6	175.7	-67	-57.8	-26.1	0	0	112.2	E10 E11 M17 G18	E10-Q14 WeakPolarHBondContact O-CG 3.17Å; E10-Q14 PolarHBondContact O-N 3.11Å; E10-Q14 PolarHBondContact OE1-NE2 3.4Å; E11-Q14 PolarHBondContact O-N 3.32Å; Q14-M17 PolarHBondContact O-N 3.43Å; Q14-G18 PolarHBondContact O-N 3.2Å
15	R	92.3	Very high	91.5	Very high	172 Å²	172	105.1 Å²	105.1	65%	0.649	52%	0.519	S	S	*	.	H	α-helix	trans	-62.6	-46.5	173.2	-72.2	174.1	-168	-175.3	7.2	111.8	E11 S12 F13 M17 G18 L19	E11-R15 VanDerWaalsContact O-CG 3.3Å; E11-R15 WeakPolarHBondContact O-CG 3.3Å; E11-R15 PolarHBondContact O-N 2.94Å; E11-R15 IonicContact OE2-NH2 3.95Å; S12-R15 PolarHBondContact O-N 3.21Å; F13-R15 VanDerWaalsContact C-N 3.34Å; F13-R15 PolarHBondContact O-N 3.48Å; R15-M17 VanDerWaalsContact C-N 3.33Å; R15-M17 PolarHBondContact O-N 2.97Å; R15-G18 PolarHBondContact O-N 3.27Å; R15-L19 WeakPolarHBondContact O-CG 3.48Å; R15-L19 PolarHBondContact O-N 3.42Å
16	A	94.4	Very high	92.3	Very high	56 Å²	56	107 Å²	107	46%	0.463	52%	0.523	S	S	.	.	H	α-helix	trans	-61.6	-41.2	177.5	0	0	0	0	0	112.1	S12 F13 L19 K20	S12-A16 WeakPolarHBondContact O-CB 3.35Å; S12-A16 PolarHBondContact O-N 3.45Å; F13-A16 PolarHBondContact O-N 3.11Å; A16-L19 PolarHBondContact O-N 2.8Å; A16-K20 PolarHBondContact O-N 3Å
17	M	95.5	Very high	93.1	Very high	65 Å²	65	108.8 Å²	108.8	32%	0.32	52%	0.523	S	S	.	.	H	α-helix	trans	-64.3	-39.4	174.5	-78.1	-63	-62.6	0	0	112.6	F13 Q14 R15 K20 K21	F13-M17 HydrophobicContact CD1-CG 4.3Å; F13-M17 HydrophobicContact CE1-CG 3.89Å; F13-M17 HydrophobicContact CE2-CG 4.35Å; F13-M17 HydrophobicContact CZ-CG 3.92Å; F13-M17 HydrophobicContact CZ-SD 4.3Å; F13-M17 WeakPolarHBondContact O-CB 3.09Å; F13-M17 WeakPolarHBondContact O-CG 3.44Å; F13-M17 PolarHBondContact O-N 3.01Å; Q14-M17 PolarHBondContact O-N 3.43Å; R15-M17 VanDerWaalsContact C-N 3.33Å; R15-M17 PolarHBondContact O-N 2.97Å; M17-K20 PolarHBondContact O-N 3.49Å; M17-K21 WeakPolarHBondContact O-CG 3.5Å; M17-K21 PolarHBondContact O-N 3.14Å; M17-K21 VanDerWaalsContact O-N 3.07Å
18	G	94.9	Very high	93.7	Very high	38 Å²	38	110.8 Å²	110.8	39%	0.392	53%	0.531	S	S	.	.	H	α-helix	trans	-61	-45.3	173.5	0	0	0	0	0	112.4	Q14 R15 K21 M22	Q14-G18 PolarHBondContact O-N 3.2Å; R15-G18 PolarHBondContact O-N 3.27Å; G18-K21 PolarHBondContact O-N 2.95Å; G18-M22 PolarHBondContact O-N 3.37Å
19	L	95	Very high	94.2	Very high	111 Å²	111	108 Å²	108	58%	0.581	53%	0.529	S	S	*	.	H	α-helix	trans	-63.3	-44.1	176.4	-69.6	172	0	0	0	111.9	R15 A16 K21 M22 V23	R15-L19 WeakPolarHBondContact O-CG 3.48Å; R15-L19 PolarHBondContact O-N 3.42Å; A16-L19 PolarHBondContact O-N 2.8Å; L19-K21 PolarHBondContact O-N 3.38Å; L19-M22 WeakPolarHBondContact O-CB 3.36Å; L19-M22 PolarHBondContact O-N 3Å; L19-M22 VanDerWaalsContact O-N 3.11Å; L19-V23 WeakPolarHBondContact O-CG2 3.49Å; L19-V23 PolarHBondContact O-N 3.36Å
20	K	96.3	Very high	94.6	Very high	128 Å²	128	107.9 Å²	107.9	56%	0.557	52%	0.522	S	S	*	.	H	α-helix	trans	-57.4	-47.9	176	-175	179.9	178.3	-177.5	0	111.8	A16 M17 M22 V23 D24	A16-K20 PolarHBondContact O-N 3Å; M17-K20 PolarHBondContact O-N 3.49Å; K20-M22 VanDerWaalsContact C-N 3.26Å; K20-M22 PolarHBondContact O-N 3.5Å; K20-V23 PolarHBondContact O-N 3.47Å; K20-D24 PolarHBondContact O-N 2.87Å
21	K	96.5	Very high	95	Very high	122 Å²	122	105.9 Å²	105.9	53%	0.53	52%	0.517	S	S	.	.	H	α-helix	trans	-59.6	-37.3	176.3	-72.7	174.3	-178.9	176.4	0	112.2	M17 G18 L19 R25	M17-K21 WeakPolarHBondContact O-CG 3.5Å; M17-K21 PolarHBondContact O-N 3.14Å; M17-K21 VanDerWaalsContact O-N 3.07Å; G18-K21 PolarHBondContact O-N 2.95Å; L19-K21 PolarHBondContact O-N 3.38Å; K21-R25 WeakPolarHBondContact O-CB 3.26Å; K21-R25 VanDerWaalsContact O-CG 3.26Å; K21-R25 WeakPolarHBondContact O-CG 3.3Å; K21-R25 PolarHBondContact O-N 3.45Å
22	M	96	Very high	95.2	Very high	130 Å²	130	106.1 Å²	106.1	64%	0.64	52%	0.517	S	S	*	.	H	α-helix	trans	-66.5	-43.9	177.1	-170.5	-178.8	-70.1	0	0	111.5	G18 L19 K20 R25 W26	G18-M22 PolarHBondContact O-N 3.37Å; L19-M22 WeakPolarHBondContact O-CB 3.36Å; L19-M22 PolarHBondContact O-N 3Å; L19-M22 VanDerWaalsContact O-N 3.11Å; K20-M22 VanDerWaalsContact C-N 3.26Å; K20-M22 PolarHBondContact O-N 3.5Å; M22-R25 PolarHBondContact O-N 3.46Å; M22-W26 WeakPolarHBondContact O-CB 3.3Å; M22-W26 PolarHBondContact O-N 2.94Å
23	V	96.6	Very high	95.4	Very high	88 Å²	88	105.8 Å²	105.8	53%	0.533	51%	0.514	S	S	.	.	H	α-helix	trans	-61.8	-44.5	175.3	172.6	0	0	0	0	111.2	L19 K20 R25 W26 R27	L19-V23 WeakPolarHBondContact O-CG2 3.49Å; L19-V23 PolarHBondContact O-N 3.36Å; K20-V23 PolarHBondContact O-N 3.47Å; V23-R25 PolarHBondContact O-N 2.88Å; V23-W26 PolarHBondContact O-N 3.26Å; V23-R27 WeakPolarHBondContact O-CB 3.41Å; V23-R27 PolarHBondContact O-N 3.31Å
24	D	97.1	Very high	95.6	Very high	71 Å²	71	104.5 Å²	104.5	38%	0.38	51%	0.512	S	S	.	.	H	α-helix	trans	-62.8	-42.5	178.6	-69.6	-28.8	0	0	0	111.6	K20 R27 N28	K20-D24 PolarHBondContact O-N 2.87Å; D24-R27 PolarHBondContact O-N 2.87Å; D24-N28 WeakPolarHBondContact O-CB 3.36Å; D24-N28 VanDerWaalsContact O-CG 3.25Å; D24-N28 PolarHBondContact O-N 2.95Å; D24-N28 PolarHBondContact O-ND2 3.03Å
25	R	96.7	Very high	95.7	Very high	188 Å²	188	107.6 Å²	107.6	71%	0.709	52%	0.52	S	S	*	.	H	α-helix	trans	-61.5	-45.2	174.2	-74.9	173.6	-177.3	-173.2	0.5	112	K21 M22 V23 R27 N28 S29	K21-R25 WeakPolarHBondContact O-CB 3.26Å; K21-R25 VanDerWaalsContact O-CG 3.26Å; K21-R25 WeakPolarHBondContact O-CG 3.3Å; K21-R25 PolarHBondContact O-N 3.45Å; M22-R25 PolarHBondContact O-N 3.46Å; V23-R25 PolarHBondContact O-N 2.88Å; R25-R27 VanDerWaalsContact C-N 3.34Å; R25-N28 PolarHBondContact O-N 3.11Å; R25-S29 WeakPolarHBondContact O-CB 3.37Å; R25-S29 PolarHBondContact O-N 3.36Å
26	W	96.8	Very high	95.6	Very high	168 Å²	168	104.9 Å²	104.9	64%	0.636	51%	0.514	S	S	*	.	H	α-helix	trans	-60.9	-45.3	177.2	176.7	85.2	0	0	0	111.1	M22 V23 N28 S29 H30	M22-W26 WeakPolarHBondContact O-CB 3.3Å; M22-W26 PolarHBondContact O-N 2.94Å; V23-W26 PolarHBondContact O-N 3.26Å; W26-N28 VanDerWaalsContact C-N 3.35Å; W26-N28 PolarHBondContact O-N 3.41Å; W26-S29 PolarHBondContact O-N 3.44Å; W26-H30 WeakPolarHBondContact O-CB 3.37Å; W26-H30 PolarHBondContact O-N 3.37Å
27	R	96.9	Very high	95.4	Very high	161 Å²	161	107.4 Å²	107.4	61%	0.608	52%	0.518	S	S	*	.	H	α-helix	trans	-61.9	-41.7	178.8	-170.9	179	-176.6	-168.8	1.3	112.3	V23 D24 R25 H30 T31	V23-R27 WeakPolarHBondContact O-CB 3.41Å; V23-R27 PolarHBondContact O-N 3.31Å; D24-R27 PolarHBondContact O-N 2.87Å; R25-R27 VanDerWaalsContact C-N 3.34Å; R27-H30 PolarHBondContact O-N 3.21Å; R27-T31 WeakPolarHBondContact O-CB 3.4Å; R27-T31 PolarHBondContact O-N 3.09Å; R27-T31 PolarHBondContact O-OG1 3.37Å
28	N	96.8	Very high	95	Very high	113 Å²	113	107 Å²	107	60%	0.604	52%	0.519	S	S	*	.	H	α-helix	trans	-65.2	-44.8	176.9	-71.5	-13.2	0	0	0	111.6	D24 R25 W26 T31 H32	D24-N28 WeakPolarHBondContact O-CB 3.36Å; D24-N28 VanDerWaalsContact O-CG 3.25Å; D24-N28 PolarHBondContact O-N 2.95Å; D24-N28 PolarHBondContact O-ND2 3.03Å; R25-N28 PolarHBondContact O-N 3.11Å; W26-N28 VanDerWaalsContact C-N 3.35Å; W26-N28 PolarHBondContact O-N 3.41Å; N28-T31 PolarHBondContact O-N 3.2Å; N28-H32 WeakPolarHBondContact O-CB 3.43Å; N28-H32 PolarHBondContact O-N 3.46Å
29	S	96.3	Very high	94.6	Very high	80 Å²	80	110.2 Å²	110.2	56%	0.559	53%	0.527	S	S	*	.	H	α-helix	trans	-62.2	-44.9	176.1	-176.5	0	0	0	0	111.8	R25 W26 T31 H32 C33	R25-S29 WeakPolarHBondContact O-CB 3.37Å; R25-S29 PolarHBondContact O-N 3.36Å; W26-S29 PolarHBondContact O-N 3.44Å; S29-T31 PolarHBondContact O-N 3.47Å; S29-H32 PolarHBondContact O-N 3Å; S29-C33 WeakPolarHBondContact O-CB 3.36Å; S29-C33 PolarHBondContact O-N 3.29Å
30	H	96.4	Very high	94	Very high	87 Å²	87	106.9 Å²	106.9	40%	0.403	52%	0.52	S	S	.	.	H	α-helix	trans	-60.5	-46.2	177.3	-178.7	67.5	0	0	0	111.6	W26 R27 C33 L34	W26-H30 WeakPolarHBondContact O-CB 3.37Å; W26-H30 PolarHBondContact O-N 3.37Å; R27-H30 PolarHBondContact O-N 3.21Å; H30-C33 PolarHBondContact O-N 3.02Å; H30-L34 WeakPolarHBondContact O-CG 3.43Å; H30-L34 PolarHBondContact O-N 3.48Å
31	T	96.3	Very high	93.3	Very high	56 Å²	56	107.4 Å²	107.4	34%	0.344	52%	0.524	S	S	.	.	H	α-helix	trans	-58.9	-52.6	175.7	-56.3	0	0	0	0	110	R27 N28 S29 C33 L34 W35	R27-T31 WeakPolarHBondContact O-CB 3.4Å; R27-T31 PolarHBondContact O-N 3.09Å; R27-T31 PolarHBondContact O-OG1 3.37Å; N28-T31 PolarHBondContact O-N 3.2Å; S29-T31 PolarHBondContact O-N 3.47Å; T31-C33 VanDerWaalsContact C-N 3.29Å; T31-C33 PolarHBondContact O-N 3.04Å; T31-L34 WeakPolarHBondContact O-CB 3.43Å; T31-L34 PolarHBondContact O-N 3.43Å; T31-L34 VanDerWaalsContact O-N 3.08Å; T31-W35 PolarHBondContact O-N 2.92Å
32	H	95.1	Very high	92.3	Very high	110 Å²	110	109.5 Å²	109.5	51%	0.509	53%	0.529	S	S	.	.	H	α-helix	trans	-56.4	-41.7	179.4	-179.7	-99.3	0	0	0	112.9	N28 S29 W35 Q36	N28-H32 WeakPolarHBondContact O-CB 3.43Å; N28-H32 PolarHBondContact O-N 3.46Å; S29-H32 PolarHBondContact O-N 3Å; H32-W35 PolarHBondContact O-N 3.4Å; H32-Q36 VanDerWaalsContact CE1-CD 3.41Å; H32-Q36 PolarHBondContact CE1-NE2 3.13Å; H32-Q36 WeakPolarHBondContact O-CG 3.34Å; H32-Q36 PolarHBondContact O-N 3.33Å
33	C	94.4	Very high	91.4	Very high	59 Å²	59	113 Å²	113	40%	0.399	54%	0.535	S	S	.	.	H	α-helix	trans	-59.6	-47.7	174.7	-173.7	0	0	0	0	111.9	S29 H30 T31 W35 Q36 M37	S29-C33 WeakPolarHBondContact O-CB 3.36Å; S29-C33 PolarHBondContact O-N 3.29Å; H30-C33 PolarHBondContact O-N 3.02Å; T31-C33 VanDerWaalsContact C-N 3.29Å; T31-C33 PolarHBondContact O-N 3.04Å; C33-W35 VanDerWaalsContact C-N 3.32Å; C33-W35 PolarHBondContact O-N 2.89Å; C33-Q36 PolarHBondContact O-N 2.97Å; C33-M37 WeakPolarHBondContact O-CG 3.42Å; C33-M37 PolarHBondContact O-N 3Å
34	L	95.2	Very high	90.5	Very high	86 Å²	86	114 Å²	114	45%	0.45	54%	0.537	S	S	.	.	H	α-helix	trans	-60.1	-40.7	176.6	-69.5	174.7	0	0	0	112.4	H30 T31 M37 T38	H30-L34 WeakPolarHBondContact O-CG 3.43Å; H30-L34 PolarHBondContact O-N 3.48Å; T31-L34 WeakPolarHBondContact O-CB 3.43Å; T31-L34 PolarHBondContact O-N 3.43Å; T31-L34 VanDerWaalsContact O-N 3.08Å; L34-M37 PolarHBondContact O-N 3.18Å; L34-T38 WeakPolarHBondContact O-CB 3.38Å; L34-T38 PolarHBondContact O-N 3.49Å; L34-T38 PolarHBondContact O-OG1 3.16Å
35	W	94.1	Very high	89.8	Confident	171 Å²	171	114 Å²	114	65%	0.648	54%	0.541	S	S	*	.	H	α-helix	trans	-62.1	-45.9	175.2	-83.1	88.2	0	0	0	111.6	T31 H32 C33 T38 L39	T31-W35 PolarHBondContact O-N 2.92Å; H32-W35 PolarHBondContact O-N 3.4Å; C33-W35 VanDerWaalsContact C-N 3.32Å; C33-W35 PolarHBondContact O-N 2.89Å; W35-T38 PolarHBondContact O-N 3.38Å; W35-L39 WeakPolarHBondContact O-CB 3.47Å; W35-L39 VanDerWaalsContact O-CG 3.28Å; W35-L39 WeakPolarHBondContact O-CG 3.49Å; W35-L39 PolarHBondContact O-N 2.96Å
36	Q	90.2	Very high	89.1	Confident	115 Å²	115	112.7 Å²	112.7	54%	0.537	54%	0.537	S	S	.	.	H	α-helix	trans	-62.3	-44	177.1	-73.9	-170.2	-21.5	0	0	112.4	H32 C33 L39 G40	H32-Q36 VanDerWaalsContact CE1-CD 3.41Å; H32-Q36 PolarHBondContact CE1-NE2 3.13Å; H32-Q36 WeakPolarHBondContact O-CG 3.34Å; H32-Q36 PolarHBondContact O-N 3.33Å; C33-Q36 PolarHBondContact O-N 2.97Å; Q36-L39 PolarHBondContact O-N 3.46Å; Q36-G40 PolarHBondContact O-N 3.46Å
37	M	89.9	Confident	88.5	Confident	108 Å²	108	106.9 Å²	106.9	53%	0.532	52%	0.524	S	S	.	.	H	α-helix	trans	-61	-46.3	176.7	-71.3	-176.4	71.9	0	0	111.5	C33 L34 L39 G40 Q41	C33-M37 WeakPolarHBondContact O-CG 3.42Å; C33-M37 PolarHBondContact O-N 3Å; L34-M37 PolarHBondContact O-N 3.18Å; M37-L39 VanDerWaalsContact C-N 3.35Å; M37-L39 PolarHBondContact O-N 3.41Å; M37-G40 PolarHBondContact O-N 3.43Å; M37-Q41 WeakPolarHBondContact O-CB 3.4Å; M37-Q41 WeakPolarHBondContact O-CG 3.45Å; M37-Q41 PolarHBondContact O-N 3Å
38	T	88.6	Confident	88	Confident	56 Å²	56	102 Å²	102	34%	0.344	51%	0.513	S	S	.	.	H	α-helix	trans	-63.4	-41.7	179.1	-54.5	0	0	0	0	111.4	L34 W35 Q41 R42	L34-T38 WeakPolarHBondContact O-CB 3.38Å; L34-T38 PolarHBondContact O-N 3.49Å; L34-T38 PolarHBondContact O-OG1 3.16Å; W35-T38 PolarHBondContact O-N 3.38Å; T38-Q41 PolarHBondContact O-N 2.94Å; T38-R42 WeakPolarHBondContact O-CG 3.44Å; T38-R42 PolarHBondContact O-N 3.39Å
39	L	85.9	Confident	87.5	Confident	106 Å²	106	100.8 Å²	100.8	56%	0.555	51%	0.506	S	S	*	.	H	α-helix	trans	-64.3	-42.8	175.3	-74.2	171.9	0	0	0	111.7	W35 Q36 M37 R42 R43	W35-L39 WeakPolarHBondContact O-CB 3.47Å; W35-L39 VanDerWaalsContact O-CG 3.28Å; W35-L39 WeakPolarHBondContact O-CG 3.49Å; W35-L39 PolarHBondContact O-N 2.96Å; Q36-L39 PolarHBondContact O-N 3.46Å; M37-L39 VanDerWaalsContact C-N 3.35Å; M37-L39 PolarHBondContact O-N 3.41Å; L39-R42 PolarHBondContact O-N 2.9Å; L39-R43 WeakPolarHBondContact O-CB 3.46Å; L39-R43 PolarHBondContact O-N 3.4Å
40	G	82.7	Confident	87.1	Confident	42 Å²	42	105.9 Å²	105.9	43%	0.433	51%	0.513	S	S	.	.	H	α-helix	trans	-60.6	-46.3	175.6	0	0	0	0	0	112.3	Q36 M37 R42 R43 N44	Q36-G40 PolarHBondContact O-N 3.46Å; M37-G40 PolarHBondContact O-N 3.43Å; G40-R42 VanDerWaalsContact C-N 3.31Å; G40-R42 PolarHBondContact O-N 3.43Å; G40-R43 PolarHBondContact O-N 3.01Å; G40-N44 WeakPolarHBondContact O-CB 3.35Å; G40-N44 PolarHBondContact O-N 3.16Å; G40-N44 VanDerWaalsContact O-N 3.12Å
41	Q	80	Confident	86.8	Confident	138 Å²	138	108.1 Å²	108.1	65%	0.645	53%	0.525	S	S	*	.	H	α-helix	trans	-61.3	-36.2	176.2	-75.5	179.3	-11.1	0	0	112.9	M37 T38 P45	M37-Q41 WeakPolarHBondContact O-CB 3.4Å; M37-Q41 WeakPolarHBondContact O-CG 3.45Å; M37-Q41 PolarHBondContact O-N 3Å; T38-Q41 PolarHBondContact O-N 2.94Å; Q41-P45 WeakPolarHBondContact O-CD 3.47Å; Q41-P45 WeakPolarHBondContact O-CG 3.45Å
42	R	76.8	Confident	86.6	Confident	167 Å²	167	110.6 Å²	110.6	63%	0.63	53%	0.533	S	S	*	.	H	α-helix	trans	-78.3	-37.7	176.6	-71.4	178.3	-177.6	-169.5	1.4	112.7	T38 L39 G40 P45 Y46	T38-R42 WeakPolarHBondContact O-CG 3.44Å; T38-R42 PolarHBondContact O-N 3.39Å; L39-R42 PolarHBondContact O-N 2.9Å; G40-R42 VanDerWaalsContact C-N 3.31Å; G40-R42 PolarHBondContact O-N 3.43Å; R42-P45 VanDerWaalsContact O-CD 3.27Å; R42-P45 WeakPolarHBondContact O-CD 3.44Å; R42-P45 VanDerWaalsContact O-CG 3.32Å; R42-P45 WeakPolarHBondContact O-CG 3.41Å; R42-Y46 WeakPolarHBondContact O-CD2 3.39Å
43	R	77.3	Confident	86.5	Confident	204 Å²	204	109.6 Å²	109.6	77%	0.77	53%	0.531	S	S	*	.	H	α-helix	trans	-71	-33.3	-176	-166.7	174.3	-178.8	-177.3	-0.1	112.2	L39 G40 A47	L39-R43 WeakPolarHBondContact O-CB 3.46Å; L39-R43 PolarHBondContact O-N 3.4Å; G40-R43 PolarHBondContact O-N 3.01Å; R43-A47 VanDerWaalsContact O-CB 3.23Å; R43-A47 WeakPolarHBondContact O-CB 3.34Å; R43-A47 PolarHBondContact O-N 3.43Å
44	N	77.3	Confident	86.5	Confident	107 Å²	107	110.5 Å²	110.5	57%	0.572	54%	0.535	S	S	*	.	H	α-helix	trans	-59.3	-56.4	179	-166.4	0.1	0	0	0	113.5	G40 Y46 A47 T48	G40-N44 WeakPolarHBondContact O-CB 3.35Å; G40-N44 PolarHBondContact O-N 3.16Å; G40-N44 VanDerWaalsContact O-N 3.12Å; N44-Y46 PolarHBondContact O-N 3.41Å; N44-A47 PolarHBondContact O-N 3.48Å; N44-T48 PolarHBondContact O-N 3.16Å; N44-T48 PolarHBondContact O-OG1 3.34Å; N44-T48 VanDerWaalsContact O-OG1 3.07Å
45	P	82	Confident	86.6	Confident	72 Å²	72	112.1 Å²	112.1	47%	0.468	54%	0.541	S	S	.	.	H	α-helix	trans	-64.8	-39	-177.8	24.7	-34.8	0	0	0	113	Q41 R42 A47 T48 L49	Q41-P45 WeakPolarHBondContact O-CD 3.47Å; Q41-P45 WeakPolarHBondContact O-CG 3.45Å; R42-P45 VanDerWaalsContact O-CD 3.27Å; R42-P45 WeakPolarHBondContact O-CD 3.44Å; R42-P45 VanDerWaalsContact O-CG 3.32Å; R42-P45 WeakPolarHBondContact O-CG 3.41Å; P45-A47 VanDerWaalsContact C-N 3.35Å; P45-T48 PolarHBondContact O-N 3.37Å; P45-L49 WeakPolarHBondContact O-CB 3.15Å; P45-L49 PolarHBondContact O-N 2.94Å
46	Y	82.3	Confident	86.7	Confident	161 Å²	161	108.6 Å²	108.6	63%	0.631	54%	0.539	S	S	*	.	H	α-helix	trans	-68.8	-33.9	176.7	-72.1	-62	0	0	0	112.6	R42 N44 R50	R42-Y46 WeakPolarHBondContact O-CD2 3.39Å; N44-Y46 PolarHBondContact O-N 3.41Å; Y46-R50 WeakPolarHBondContact O-CB 3.25Å; Y46-R50 WeakPolarHBondContact O-CG 3.42Å; Y46-R50 PolarHBondContact O-N 2.98Å
47	A	84.3	Confident	87	Confident	45 Å²	45	109.2 Å²	109.2	37%	0.372	54%	0.541	S	S	.	.	H	α-helix	trans	-66.8	-44.6	173.4	0	0	0	0	0	111	R43 N44 P45 R50 M51	R43-A47 VanDerWaalsContact O-CB 3.23Å; R43-A47 WeakPolarHBondContact O-CB 3.34Å; R43-A47 PolarHBondContact O-N 3.43Å; N44-A47 PolarHBondContact O-N 3.48Å; P45-A47 VanDerWaalsContact C-N 3.35Å; A47-R50 PolarHBondContact O-N 2.88Å; A47-M51 WeakPolarHBondContact O-CB 3.4Å; A47-M51 WeakPolarHBondContact O-CG 3.37Å; A47-M51 PolarHBondContact O-N 2.92Å
48	T	86.1	Confident	87.3	Confident	59 Å²	59	110 Å²	110	36%	0.362	54%	0.544	S	S	.	.	H	α-helix	trans	-61.3	-45.5	175.2	-53.3	0	0	0	0	111.8	N44 P45 M51 Q52	N44-T48 PolarHBondContact O-N 3.16Å; N44-T48 PolarHBondContact O-OG1 3.34Å; N44-T48 VanDerWaalsContact O-OG1 3.07Å; P45-T48 PolarHBondContact O-N 3.37Å; T48-M51 PolarHBondContact O-N 3.01Å; T48-Q52 WeakPolarHBondContact O-CG 3.41Å; T48-Q52 PolarHBondContact O-N 3.2Å
49	L	87.2	Confident	87.8	Confident	87 Å²	87	112.5 Å²	112.5	46%	0.455	55%	0.554	S	S	.	*	H	α-helix	trans	-61.8	-46.9	178.8	-175.5	65.7	0	0	0	111.4	P45 M51 Q52 D53	P45-L49 WeakPolarHBondContact O-CB 3.15Å; P45-L49 PolarHBondContact O-N 2.94Å; L49-M51 VanDerWaalsContact C-N 3.31Å; L49-M51 PolarHBondContact O-N 3.21Å; L49-Q52 WeakPolarHBondContact O-CB 3.27Å; L49-Q52 PolarHBondContact O-N 3.41Å; L49-Q52 VanDerWaalsContact O-N 3.16Å; L49-D53 PolarHBondContact O-N 2.94Å
50	R	87.4	Confident	88.3	Confident	187 Å²	187	110.1 Å²	110.1	71%	0.706	55%	0.55	S	S	*	*	H	α-helix	trans	-59.8	-41.8	175.3	-76.9	-177.9	178.7	-142.5	0.6	112.2	Y46 A47 Q52 D53 T54	Y46-R50 WeakPolarHBondContact O-CB 3.25Å; Y46-R50 WeakPolarHBondContact O-CG 3.42Å; Y46-R50 PolarHBondContact O-N 2.98Å; A47-R50 PolarHBondContact O-N 2.88Å; R50-Q52 VanDerWaalsContact C-N 3.34Å; R50-D53 PolarHBondContact O-N 3.39Å; R50-T54 WeakPolarHBondContact O-CG2 3.46Å; R50-T54 PolarHBondContact O-N 3.45Å; R50-T54 PolarHBondContact O-OG1 2.86Å
51	M	90.1	Very high	89.1	Confident	135 Å²	135	112.7 Å²	112.7	67%	0.665	55%	0.554	S	S	*	*	H	α-helix	trans	-62.3	-41.5	176	-77.8	-179.2	163.6	0	0	111.8	A47 T48 L49 T54 M55	A47-M51 WeakPolarHBondContact O-CB 3.4Å; A47-M51 WeakPolarHBondContact O-CG 3.37Å; A47-M51 PolarHBondContact O-N 2.92Å; T48-M51 PolarHBondContact O-N 3.01Å; L49-M51 VanDerWaalsContact C-N 3.31Å; L49-M51 PolarHBondContact O-N 3.21Å; M51-T54 WeakPolarHBondContact CA-OG1 3.36Å; M51-T54 PolarHBondContact O-N 2.74Å; M51-T54 PolarHBondContact O-OG1 3.38Å; M51-M55 WeakPolarHBondContact O-CB 3.32Å; M51-M55 PolarHBondContact O-N 3.07Å
52	Q	92.3	Very high	89.9	Confident	108 Å²	108	108.4 Å²	108.4	51%	0.505	54%	0.542	S	S	.	.	H	α-helix	trans	-61.8	-46	175.5	-72.9	174.6	-1.8	0	0	111.6	T48 L49 R50 T54 M55 V56	T48-Q52 WeakPolarHBondContact O-CG 3.41Å; T48-Q52 PolarHBondContact O-N 3.2Å; L49-Q52 WeakPolarHBondContact O-CB 3.27Å; L49-Q52 PolarHBondContact O-N 3.41Å; L49-Q52 VanDerWaalsContact O-N 3.16Å; R50-Q52 VanDerWaalsContact C-N 3.34Å; Q52-T54 VanDerWaalsContact C-N 3.34Å; Q52-T54 PolarHBondContact O-N 3.21Å; Q52-M55 WeakPolarHBondContact O-CB 3.32Å; Q52-M55 PolarHBondContact O-N 2.95Å; Q52-M55 VanDerWaalsContact O-N 3.16Å; Q52-V56 WeakPolarHBondContact O-CG2 2.88Å; Q52-V56 PolarHBondContact O-N 3.02Å
53	D	93.1	Very high	90.9	Very high	89 Å²	89	107.1 Å²	107.1	48%	0.476	54%	0.541	S	S	.	.	H	α-helix	trans	-59.8	-45.3	177.6	-69.4	-27.6	0	0	0	111.5	L49 R50 M55 V56 Q57	L49-D53 PolarHBondContact O-N 2.94Å; R50-D53 PolarHBondContact O-N 3.39Å; D53-M55 VanDerWaalsContact C-N 3.33Å; D53-M55 PolarHBondContact O-N 2.79Å; D53-V56 PolarHBondContact O-N 2.95Å; D53-Q57 WeakPolarHBondContact O-CG 3.4Å; D53-Q57 PolarHBondContact O-N 3.25Å; D53-Q57 VanDerWaalsContact O-N 3.16Å
54	T	94.4	Very high	91.9	Very high	77 Å²	77	103.4 Å²	103.4	47%	0.472	53%	0.53	S	S	.	.	H	α-helix	trans	-62.4	-41.5	175.7	53.3	0	0	0	0	111.8	R50 M51 Q52 V56 Q57 E58	R50-T54 WeakPolarHBondContact O-CG2 3.46Å; R50-T54 PolarHBondContact O-N 3.45Å; R50-T54 PolarHBondContact O-OG1 2.86Å; M51-T54 WeakPolarHBondContact CA-OG1 3.36Å; M51-T54 PolarHBondContact O-N 2.74Å; M51-T54 PolarHBondContact O-OG1 3.38Å; Q52-T54 VanDerWaalsContact C-N 3.34Å; Q52-T54 PolarHBondContact O-N 3.21Å; T54-V56 VanDerWaalsContact C-N 3.33Å; T54-V56 PolarHBondContact O-N 3.47Å; T54-Q57 PolarHBondContact O-N 2.9Å; T54-E58 WeakPolarHBondContact O-CG 3.35Å; T54-E58 PolarHBondContact O-N 3.39Å
55	M	95.8	Very high	92.8	Very high	120 Å²	120	104.6 Å²	104.6	59%	0.591	53%	0.532	S	S	*	.	H	α-helix	trans	-63.2	-40.2	179	-176	179	176.4	0	0	111.6	M51 Q52 D53 Q57 E58 L59	M51-M55 WeakPolarHBondContact O-CB 3.32Å; M51-M55 PolarHBondContact O-N 3.07Å; Q52-M55 WeakPolarHBondContact O-CB 3.32Å; Q52-M55 PolarHBondContact O-N 2.95Å; Q52-M55 VanDerWaalsContact O-N 3.16Å; D53-M55 VanDerWaalsContact C-N 3.33Å; D53-M55 PolarHBondContact O-N 2.79Å; M55-Q57 VanDerWaalsContact C-N 3.33Å; M55-Q57 PolarHBondContact O-N 3.34Å; M55-E58 PolarHBondContact O-N 3.3Å; M55-L59 HydrophobicContact CE-CD1 4.23Å; M55-L59 HydrophobicContact CG-CD1 4.18Å; M55-L59 HydrophobicContact CG-CG 4.49Å; M55-L59 WeakPolarHBondContact O-CB 3.43Å; M55-L59 VanDerWaalsContact O-CG 3.25Å; M55-L59 WeakPolarHBondContact O-CG 3.34Å; M55-L59 PolarHBondContact O-N 3.01Å
56	V	96.7	Very high	93.6	Very high	97 Å²	97	106.9 Å²	106.9	59%	0.588	54%	0.54	S	S	*	.	H	α-helix	trans	-62.8	-41.2	176.4	171.2	0	0	0	0	111.2	Q52 D53 T54 L59 A60	Q52-V56 WeakPolarHBondContact O-CG2 2.88Å; Q52-V56 PolarHBondContact O-N 3.02Å; D53-V56 PolarHBondContact O-N 2.95Å; T54-V56 VanDerWaalsContact C-N 3.33Å; T54-V56 PolarHBondContact O-N 3.47Å; V56-L59 PolarHBondContact O-N 3.46Å; V56-A60 WeakPolarHBondContact O-CB 3.35Å; V56-A60 PolarHBondContact O-N 3.25Å
57	Q	96.3	Very high	94.4	Very high	128 Å²	128	103.3 Å²	103.3	60%	0.598	53%	0.531	S	S	*	.	H	α-helix	trans	-64.2	-47.1	176.9	-69.1	176.5	-0.4	0	0	111.7	D53 T54 M55 L59 A60 L61	D53-Q57 WeakPolarHBondContact O-CG 3.4Å; D53-Q57 PolarHBondContact O-N 3.25Å; D53-Q57 VanDerWaalsContact O-N 3.16Å; T54-Q57 PolarHBondContact O-N 2.9Å; M55-Q57 VanDerWaalsContact C-N 3.33Å; M55-Q57 PolarHBondContact O-N 3.34Å; Q57-L59 VanDerWaalsContact C-N 3.34Å; Q57-L59 PolarHBondContact O-N 2.82Å; Q57-A60 WeakPolarHBondContact O-CB 3.22Å; Q57-A60 PolarHBondContact O-N 2.97Å; Q57-L61 WeakPolarHBondContact O-CG 3.49Å; Q57-L61 PolarHBondContact O-N 3.37Å
58	E	97.1	Very high	95	Very high	126 Å²	126	106.1 Å²	106.1	59%	0.589	54%	0.538	S	S	*	.	H	α-helix	trans	-60.2	-42.9	177.1	-69.4	-59.4	151.2	0	0	111.7	T54 M55 A60 L61 A62	T54-E58 WeakPolarHBondContact O-CG 3.35Å; T54-E58 PolarHBondContact O-N 3.39Å; M55-E58 PolarHBondContact O-N 3.3Å; E58-A60 VanDerWaalsContact C-N 3.34Å; E58-A60 PolarHBondContact O-N 3.38Å; E58-L61 PolarHBondContact O-N 2.93Å; E58-A62 WeakPolarHBondContact O-CB 3.42Å; E58-A62 PolarHBondContact O-N 3.38Å
59	L	97.9	Very high	95.6	Very high	107 Å²	107	108.1 Å²	108.1	56%	0.56	55%	0.55	S	S	*	*	H	α-helix	trans	-63.6	-38.3	176.1	-73	173.8	0	0	0	112.5	M55 V56 Q57 A62 K63	M55-L59 HydrophobicContact CE-CD1 4.23Å; M55-L59 HydrophobicContact CG-CD1 4.18Å; M55-L59 HydrophobicContact CG-CG 4.49Å; M55-L59 WeakPolarHBondContact O-CB 3.43Å; M55-L59 VanDerWaalsContact O-CG 3.25Å; M55-L59 WeakPolarHBondContact O-CG 3.34Å; M55-L59 PolarHBondContact O-N 3.01Å; V56-L59 PolarHBondContact O-N 3.46Å; Q57-L59 VanDerWaalsContact C-N 3.34Å; Q57-L59 PolarHBondContact O-N 2.82Å; L59-A62 PolarHBondContact O-N 3.12Å; L59-K63 WeakPolarHBondContact O-CB 3.37Å; L59-K63 PolarHBondContact O-N 3.3Å
60	A	97.9	Very high	96.1	Very high	57 Å²	57	112.7 Å²	112.7	47%	0.471	56%	0.561	S	S	.	*	H	α-helix	trans	-65.4	-41.1	176.4	0	0	0	0	0	111.8	V56 Q57 E58 K63 K64	V56-A60 WeakPolarHBondContact O-CB 3.35Å; V56-A60 PolarHBondContact O-N 3.25Å; Q57-A60 WeakPolarHBondContact O-CB 3.22Å; Q57-A60 PolarHBondContact O-N 2.97Å; E58-A60 VanDerWaalsContact C-N 3.34Å; E58-A60 PolarHBondContact O-N 3.38Å; A60-K63 PolarHBondContact O-N 2.97Å; A60-K64 PolarHBondContact O-N 3.45Å
61	L	98.1	Very high	96.6	Very high	95 Å²	95	109.3 Å²	109.3	50%	0.497	55%	0.554	S	S	.	*	H	α-helix	trans	-65.5	-46.2	175.3	-68.1	175.5	0	0	0	111.6	Q57 E58 K63 K64 Q65	Q57-L61 WeakPolarHBondContact O-CG 3.49Å; Q57-L61 PolarHBondContact O-N 3.37Å; E58-L61 PolarHBondContact O-N 2.93Å; L61-K63 VanDerWaalsContact C-N 3.32Å; L61-K63 PolarHBondContact O-N 2.92Å; L61-K64 WeakPolarHBondContact O-CB 3.47Å; L61-K64 PolarHBondContact O-N 3.2Å; L61-K64 VanDerWaalsContact O-N 3.13Å; L61-Q65 WeakPolarHBondContact O-CG 3.28Å; L61-Q65 PolarHBondContact O-N 3.4Å
62	A	97.6	Very high	97	Very high	49 Å²	49	105.4 Å²	105.4	41%	0.405	54%	0.543	S	S	.	.	H	α-helix	trans	-59.6	-42.7	176.4	0	0	0	0	0	111.7	E58 L59 K64 Q65 L66	E58-A62 WeakPolarHBondContact O-CB 3.42Å; E58-A62 PolarHBondContact O-N 3.38Å; L59-A62 PolarHBondContact O-N 3.12Å; A62-K64 VanDerWaalsContact C-N 3.35Å; A62-K64 PolarHBondContact O-N 2.95Å; A62-Q65 PolarHBondContact O-N 3.47Å; A62-L66 WeakPolarHBondContact O-CB 3.41Å; A62-L66 PolarHBondContact O-N 3.48Å
63	K	97.7	Very high	97.3	Very high	140 Å²	140	102.4 Å²	102.4	61%	0.609	54%	0.536	S	S	*	.	H	α-helix	trans	-60.1	-43.9	174.5	-179.3	179.7	177.5	-179.4	0	111.6	L59 A60 L61 L66 L67	L59-K63 WeakPolarHBondContact O-CB 3.37Å; L59-K63 PolarHBondContact O-N 3.3Å; A60-K63 PolarHBondContact O-N 2.97Å; L61-K63 VanDerWaalsContact C-N 3.32Å; L61-K63 PolarHBondContact O-N 2.92Å; K63-L66 PolarHBondContact O-N 3.08Å; K63-L67 HydrophobicContact CG-CD1 4.3Å; K63-L67 WeakPolarHBondContact O-CG 3.46Å; K63-L67 PolarHBondContact O-N 2.88Å
64	K	97.8	Very high	97.6	Very high	125 Å²	125	102 Å²	102	54%	0.543	53%	0.534	S	S	.	.	H	α-helix	trans	-61.3	-45.8	177.9	-176.1	178.5	177.8	-179.2	0	111.2	A60 L61 A62 L67 M68	A60-K64 PolarHBondContact O-N 3.45Å; L61-K64 WeakPolarHBondContact O-CB 3.47Å; L61-K64 PolarHBondContact O-N 3.2Å; L61-K64 VanDerWaalsContact O-N 3.13Å; A62-K64 VanDerWaalsContact C-N 3.35Å; A62-K64 PolarHBondContact O-N 2.95Å; K64-L67 PolarHBondContact O-N 2.78Å; K64-M68 HydrophobicContact CD-CE 4.41Å; K64-M68 HydrophobicContact CG-CE 4.11Å; K64-M68 WeakPolarHBondContact O-CG 3.23Å; K64-M68 PolarHBondContact O-N 2.93Å; K64-M68 VanDerWaalsContact O-N 3.09Å
65	Q	97.6	Very high	97.7	Very high	132 Å²	132	103.8 Å²	103.8	62%	0.617	54%	0.536	S	S	*	.	H	α-helix	trans	-62.6	-45.3	177.2	-70.5	174.8	-16	0	0	111.7	L61 A62 L67 M68 V69	L61-Q65 WeakPolarHBondContact O-CG 3.28Å; L61-Q65 PolarHBondContact O-N 3.4Å; A62-Q65 PolarHBondContact O-N 3.47Å; Q65-L67 VanDerWaalsContact C-N 3.31Å; Q65-L67 PolarHBondContact O-N 3.27Å; Q65-M68 PolarHBondContact O-N 3.3Å; Q65-V69 WeakPolarHBondContact O-CG2 3.4Å; Q65-V69 PolarHBondContact O-N 3.49Å
66	L	98.1	Very high	97.8	Very high	120 Å²	120	103.6 Å²	103.6	63%	0.628	53%	0.534	S	S	*	.	H	α-helix	trans	-59.2	-42.4	177.4	-178.9	64.3	0	0	0	112	A62 K63 V69 R70	A62-L66 WeakPolarHBondContact O-CB 3.41Å; A62-L66 PolarHBondContact O-N 3.48Å; K63-L66 PolarHBondContact O-N 3.08Å; L66-V69 PolarHBondContact O-N 3.46Å; L66-R70 WeakPolarHBondContact O-CB 3.4Å; L66-R70 PolarHBondContact O-N 3.05Å
67	L	98.4	Very high	97.9	Very high	86 Å²	86	103.9 Å²	103.9	45%	0.45	53%	0.532	S	S	.	.	H	α-helix	trans	-63.3	-43.2	176.8	-74.5	173	0	0	0	111.9	K63 K64 Q65 R70 Q71	K63-L67 HydrophobicContact CG-CD1 4.3Å; K63-L67 WeakPolarHBondContact O-CG 3.46Å; K63-L67 PolarHBondContact O-N 2.88Å; K64-L67 PolarHBondContact O-N 2.78Å; Q65-L67 VanDerWaalsContact C-N 3.31Å; Q65-L67 PolarHBondContact O-N 3.27Å; L67-R70 PolarHBondContact O-N 3.33Å; L67-Q71 WeakPolarHBondContact O-CB 3.45Å; L67-Q71 VanDerWaalsContact O-CG 3.3Å; L67-Q71 WeakPolarHBondContact O-CG 3.39Å; L67-Q71 PolarHBondContact O-N 2.9Å
68	M	98.1	Very high	98	Very high	104 Å²	104	103.1 Å²	103.1	51%	0.512	53%	0.527	S	S	.	.	H	α-helix	trans	-60.8	-46	176.7	-72.1	175.9	170.5	0	0	111.7	K64 Q65 R70 Q71 A72	K64-M68 HydrophobicContact CD-CE 4.41Å; K64-M68 HydrophobicContact CG-CE 4.11Å; K64-M68 WeakPolarHBondContact O-CG 3.23Å; K64-M68 PolarHBondContact O-N 2.93Å; K64-M68 VanDerWaalsContact O-N 3.09Å; Q65-M68 PolarHBondContact O-N 3.3Å; M68-R70 VanDerWaalsContact C-N 3.34Å; M68-R70 PolarHBondContact O-N 2.92Å; M68-Q71 PolarHBondContact O-N 2.99Å; M68-A72 WeakPolarHBondContact O-CB 3.44Å; M68-A72 PolarHBondContact O-N 3.28Å
69	V	98.2	Very high	98	Very high	102 Å²	102	102.7 Å²	102.7	62%	0.618	53%	0.525	S	S	*	.	H	α-helix	trans	-62.3	-43.6	177.6	173.8	0	0	0	0	110.8	Q65 L66 A72 A73	Q65-V69 WeakPolarHBondContact O-CG2 3.4Å; Q65-V69 PolarHBondContact O-N 3.49Å; L66-V69 PolarHBondContact O-N 3.46Å; V69-A72 PolarHBondContact O-N 3.39Å; V69-A73 WeakPolarHBondContact O-CB 3.45Å; V69-A73 PolarHBondContact O-N 2.97Å
70	R	98.2	Very high	97.9	Very high	182 Å²	182	104 Å²	104	69%	0.687	53%	0.526	S	S	*	.	H	α-helix	trans	-64.9	-42	178.8	-173.5	173.9	-177.8	170.9	0.9	112.2	L66 L67 M68 A73 L74	L66-R70 WeakPolarHBondContact O-CB 3.4Å; L66-R70 PolarHBondContact O-N 3.05Å; L67-R70 PolarHBondContact O-N 3.33Å; M68-R70 VanDerWaalsContact C-N 3.34Å; M68-R70 PolarHBondContact O-N 2.92Å; R70-A73 PolarHBondContact O-N 3.43Å; R70-L74 VanDerWaalsContact O-CB 3.3Å; R70-L74 WeakPolarHBondContact O-CB 3.42Å; R70-L74 PolarHBondContact O-N 3.26Å
71	Q	98.2	Very high	97.9	Very high	117 Å²	117	105.4 Å²	105.4	55%	0.547	52%	0.523	S	S	.	.	H	α-helix	trans	-62.1	-47.1	175.9	-76.5	174.4	-19.8	0	0	110.8	L67 M68 A73 L74 H75	L67-Q71 WeakPolarHBondContact O-CB 3.45Å; L67-Q71 VanDerWaalsContact O-CG 3.3Å; L67-Q71 WeakPolarHBondContact O-CG 3.39Å; L67-Q71 PolarHBondContact O-N 2.9Å; M68-Q71 PolarHBondContact O-N 2.99Å; Q71-A73 PolarHBondContact O-N 3.36Å; Q71-L74 PolarHBondContact O-N 2.87Å; Q71-H75 PolarHBondContact O-CD2 3.18Å; Q71-H75 PolarHBondContact O-N 2.98Å
72	A	98.2	Very high	97.8	Very high	52 Å²	52	105.1 Å²	105.1	43%	0.43	52%	0.519	S	S	.	.	H	α-helix	trans	-60.1	-44.8	177.5	0	0	0	0	0	112.1	M68 V69 L74 H75 Q76	M68-A72 WeakPolarHBondContact O-CB 3.44Å; M68-A72 PolarHBondContact O-N 3.28Å; V69-A72 PolarHBondContact O-N 3.39Å; A72-L74 VanDerWaalsContact C-N 3.32Å; A72-L74 PolarHBondContact O-N 2.84Å; A72-H75 PolarHBondContact O-N 3.4Å; A72-Q76 WeakPolarHBondContact O-CG 3.49Å; A72-Q76 PolarHBondContact O-N 3.32Å
73	A	98.2	Very high	97.7	Very high	45 Å²	45	108.2 Å²	108.2	37%	0.372	53%	0.525	S	S	.	.	H	α-helix	trans	-62.4	-39.9	176.4	0	0	0	0	0	112.3	V69 R70 Q71 Q76 L77	V69-A73 WeakPolarHBondContact O-CB 3.45Å; V69-A73 PolarHBondContact O-N 2.97Å; R70-A73 PolarHBondContact O-N 3.43Å; Q71-A73 PolarHBondContact O-N 3.36Å; A73-Q76 PolarHBondContact O-N 2.94Å; A73-L77 WeakPolarHBondContact O-CG 3.33Å; A73-L77 PolarHBondContact O-N 2.95Å; A73-L77 VanDerWaalsContact O-N 3.11Å
74	L	98.4	Very high	97.6	Very high	81 Å²	81	106.4 Å²	106.4	42%	0.424	52%	0.519	S	S	.	.	H	α-helix	trans	-67.5	-41.9	177.3	-177.9	133.1	0	0	0	112	R70 Q71 A72 Q76 L77 F78	R70-L74 VanDerWaalsContact O-CB 3.3Å; R70-L74 WeakPolarHBondContact O-CB 3.42Å; R70-L74 PolarHBondContact O-N 3.26Å; Q71-L74 PolarHBondContact O-N 2.87Å; A72-L74 VanDerWaalsContact C-N 3.32Å; A72-L74 PolarHBondContact O-N 2.84Å; L74-Q76 VanDerWaalsContact C-N 3.33Å; L74-Q76 PolarHBondContact O-N 2.94Å; L74-L77 PolarHBondContact O-N 3.07Å; L74-F78 HydrophobicContact CD2-CD2 3.71Å; L74-F78 HydrophobicContact CD2-CE2 3.37Å; L74-F78 HydrophobicContact CD2-CZ 4.16Å; L74-F78 HydrophobicContact CG-CD2 4.26Å; L74-F78 HydrophobicContact CG-CE2 3.94Å; L74-F78 HydrophobicContact CG-CZ 4.31Å; L74-F78 PolarHBondContact O-N 3.43Å
75	H	98.1	Very high	97.6	Very high	114 Å²	114	106.1 Å²	106.1	53%	0.528	52%	0.515	S	S	.	.	H	α-helix	trans	-58.3	-44.8	172.9	-82.5	-68.6	0	0	0	111.7	Q71 A72 L77 F78 E79	Q71-H75 PolarHBondContact O-CD2 3.18Å; Q71-H75 PolarHBondContact O-N 2.98Å; A72-H75 PolarHBondContact O-N 3.4Å; H75-L77 VanDerWaalsContact C-N 3.3Å; H75-L77 PolarHBondContact O-N 3.02Å; H75-F78 PolarHBondContact O-N 3.38Å; H75-E79 WeakPolarHBondContact O-CG 3.49Å; H75-E79 PolarHBondContact O-N 2.91Å
76	Q	98	Very high	97.4	Very high	116 Å²	116	103.9 Å²	103.9	54%	0.542	51%	0.505	S	S	.	.	H	α-helix	trans	-62.2	-36	177	-73.2	179.9	-7.1	0	0	113.2	A72 A73 L74 K80	A72-Q76 WeakPolarHBondContact O-CG 3.49Å; A72-Q76 PolarHBondContact O-N 3.32Å; A73-Q76 PolarHBondContact O-N 2.94Å; L74-Q76 VanDerWaalsContact C-N 3.33Å; L74-Q76 PolarHBondContact O-N 2.94Å; Q76-K80 WeakPolarHBondContact O-CG 3.47Å; Q76-K80 PolarHBondContact O-N 2.89Å
77	L	98.2	Very high	97.3	Very high	103 Å²	103	104.1 Å²	104.1	54%	0.539	50%	0.502	S	S	.	.	H	α-helix	trans	-66.8	-47.3	175.5	-72.5	171	0	0	0	110.8	A73 L74 H75 E79 K80 E81	A73-L77 WeakPolarHBondContact O-CG 3.33Å; A73-L77 PolarHBondContact O-N 2.95Å; A73-L77 VanDerWaalsContact O-N 3.11Å; L74-L77 PolarHBondContact O-N 3.07Å; H75-L77 VanDerWaalsContact C-N 3.3Å; H75-L77 PolarHBondContact O-N 3.02Å; L77-E79 VanDerWaalsContact C-N 3.33Å; L77-E79 PolarHBondContact O-N 3.06Å; L77-K80 PolarHBondContact O-N 3.43Å; L77-E81 WeakPolarHBondContact O-CG 3.26Å; L77-E81 PolarHBondContact O-N 2.92Å
78	F	97.6	Very high	97.2	Very high	113 Å²	113	103.9 Å²	103.9	50%	0.496	50%	0.499	S	S	.	.	H	α-helix	trans	-64.2	-35.6	177.7	-72.8	-25	0	0	0	113.4	L74 H75 K80 E81 H82	L74-F78 HydrophobicContact CD2-CD2 3.71Å; L74-F78 HydrophobicContact CD2-CE2 3.37Å; L74-F78 HydrophobicContact CD2-CZ 4.16Å; L74-F78 HydrophobicContact CG-CD2 4.26Å; L74-F78 HydrophobicContact CG-CE2 3.94Å; L74-F78 HydrophobicContact CG-CZ 4.31Å; L74-F78 PolarHBondContact O-N 3.43Å; H75-F78 PolarHBondContact O-N 3.38Å; F78-K80 VanDerWaalsContact C-N 3.33Å; F78-K80 PolarHBondContact O-N 3.45Å; F78-E81 PolarHBondContact O-N 3.21Å; F78-H82 WeakPolarHBondContact O-CB 3.42Å; F78-H82 PolarHBondContact O-N 3.11Å
79	E	96.9	Very high	97.1	Very high	116 Å²	116	100.9 Å²	100.9	54%	0.542	49%	0.485	S	S	.	.	H	α-helix	trans	-61.8	-42.6	174.2	-76.8	173.1	-177.2	0	0	111.7	H75 L77 H82 Q83	H75-E79 WeakPolarHBondContact O-CG 3.49Å; H75-E79 PolarHBondContact O-N 2.91Å; L77-E79 VanDerWaalsContact C-N 3.33Å; L77-E79 PolarHBondContact O-N 3.06Å; E79-H82 PolarHBondContact O-N 3.35Å; E79-Q83 VanDerWaalsContact O-CG 3.26Å; E79-Q83 WeakPolarHBondContact O-CG 3.42Å; E79-Q83 PolarHBondContact O-N 3.43Å
80	K	97.6	Very high	96.9	Very high	135 Å²	135	100.6 Å²	100.6	59%	0.587	48%	0.48	S	S	*	.	H	α-helix	trans	-65	-46.9	176.8	-70.8	173.4	-177.6	179.4	0	111.7	Q76 L77 F78 H82 Q83 Q84	Q76-K80 WeakPolarHBondContact O-CG 3.47Å; Q76-K80 PolarHBondContact O-N 2.89Å; L77-K80 PolarHBondContact O-N 3.43Å; F78-K80 VanDerWaalsContact C-N 3.33Å; F78-K80 PolarHBondContact O-N 3.45Å; K80-H82 VanDerWaalsContact C-N 3.34Å; K80-H82 PolarHBondContact O-N 2.98Å; K80-Q83 PolarHBondContact O-N 3.24Å; K80-Q84 PolarHBondContact O-N 3.16Å
81	E	97.3	Very high	96.7	Very high	86 Å²	86	99.7 Å²	99.7	40%	0.402	48%	0.483	S	S	.	.	H	α-helix	trans	-61.8	-43.1	177	-72.5	178	177.5	0	0	111.2	L77 F78 Q83 Q84 Y85	L77-E81 WeakPolarHBondContact O-CG 3.26Å; L77-E81 PolarHBondContact O-N 2.92Å; F78-E81 PolarHBondContact O-N 3.21Å; E81-Q83 PolarHBondContact O-N 3.45Å; E81-Q84 WeakPolarHBondContact O-CB 3.48Å; E81-Q84 PolarHBondContact O-N 2.95Å; E81-Y85 HydrophobicContact CB-CD2 4.4Å; E81-Y85 HydrophobicContact CB-CE2 4.16Å; E81-Y85 WeakPolarHBondContact O-CD2 3.38Å; E81-Y85 PolarHBondContact O-N 2.7Å
82	H	95.6	Very high	96.5	Very high	90 Å²	90	100.4 Å²	100.4	42%	0.417	49%	0.488	S	S	.	.	H	α-helix	trans	-60.9	-45	177.9	-173.6	72.2	0	0	0	111.7	F78 E79 K80 Q84 Y85 Q86 F96	F78-H82 WeakPolarHBondContact O-CB 3.42Å; F78-H82 PolarHBondContact O-N 3.11Å; E79-H82 PolarHBondContact O-N 3.35Å; K80-H82 VanDerWaalsContact C-N 3.34Å; K80-H82 PolarHBondContact O-N 2.98Å; H82-Q84 VanDerWaalsContact C-N 3.34Å; H82-Q84 PolarHBondContact O-N 2.77Å; H82-Y85 PolarHBondContact O-N 2.88Å; H82-Q86 VanDerWaalsContact O-CB 3.3Å; H82-Q86 WeakPolarHBondContact O-CB 3.4Å; H82-Q86 PolarHBondContact O-N 3.4Å; H82-F96 AromaticContact CE1-CD2 3.52Å; H82-F96 AromaticContact CE1-CE2 3.55Å; H82-F96 AromaticContact ND1-CE2 3.7Å; H82-F96 AromaticContact ND1-CZ 3.97Å
83	Q	95.2	Very high	96.3	Very high	114 Å²	114	101.4 Å²	101.4	53%	0.533	50%	0.504	S	S	.	.	H	α-helix	trans	-61	-43.7	175.6	-73.8	172.6	8.5	0	0	111.8	E79 K80 E81 Q86 Q87	E79-Q83 VanDerWaalsContact O-CG 3.26Å; E79-Q83 WeakPolarHBondContact O-CG 3.42Å; E79-Q83 PolarHBondContact O-N 3.43Å; K80-Q83 PolarHBondContact O-N 3.24Å; E81-Q83 PolarHBondContact O-N 3.45Å; Q83-Q86 PolarHBondContact O-N 3.44Å; Q83-Q87 WeakPolarHBondContact O-CG 3.41Å; Q83-Q87 PolarHBondContact O-N 3.24Å; Q83-Q87 VanDerWaalsContact O-N 3.11Å
84	Q	96.5	Very high	96.1	Very high	102 Å²	102	105 Å²	105	48%	0.477	51%	0.511	S	S	.	.	H	α-helix	trans	-60.1	-52.6	176.7	-178.9	-177.9	-21.7	0	0	111	K80 E81 H82 Q86 Q87 E88	K80-Q84 PolarHBondContact O-N 3.16Å; E81-Q84 WeakPolarHBondContact O-CB 3.48Å; E81-Q84 PolarHBondContact O-N 2.95Å; H82-Q84 VanDerWaalsContact C-N 3.34Å; H82-Q84 PolarHBondContact O-N 2.77Å; Q84-Q86 VanDerWaalsContact C-N 3.27Å; Q84-Q86 PolarHBondContact O-N 3.48Å; Q84-Q87 WeakPolarHBondContact O-CB 3.46Å; Q84-Q87 PolarHBondContact O-N 3.41Å; Q84-Q87 VanDerWaalsContact O-N 3.11Å; Q84-E88 WeakPolarHBondContact CG-OE1 3.34Å; Q84-E88 PolarHBondContact NE2-OE1 3.38Å; Q84-E88 PolarHBondContact O-N 3.49Å
85	Y	96.3	Very high	95.8	Very high	118 Å²	118	104.9 Å²	104.9	46%	0.463	52%	0.521	S	S	.	.	H	α-helix	trans	-63.3	-34.4	-179.9	-70.5	-50.2	0	0	0	112.8	E81 H82 Q87 E88 L89	E81-Y85 HydrophobicContact CB-CD2 4.4Å; E81-Y85 HydrophobicContact CB-CE2 4.16Å; E81-Y85 WeakPolarHBondContact O-CD2 3.38Å; E81-Y85 PolarHBondContact O-N 2.7Å; H82-Y85 PolarHBondContact O-N 2.88Å; Y85-Q87 VanDerWaalsContact C-N 3.31Å; Y85-Q87 PolarHBondContact O-N 2.97Å; Y85-E88 PolarHBondContact O-N 3.04Å; Y85-L89 WeakPolarHBondContact O-CB 3.45Å; Y85-L89 VanDerWaalsContact O-CG 3.26Å; Y85-L89 WeakPolarHBondContact O-CG 3.46Å; Y85-L89 PolarHBondContact O-N 3.01Å
86	Q	95.1	Very high	95.6	Very high	86 Å²	86	103.5 Å²	103.5	40%	0.402	51%	0.514	S	S	.	.	H	α-helix	trans	-64.6	-39.1	176.1	-169.9	166.5	9.6	0	0	111.4	H82 Q83 Q84 N90 F96	H82-Q86 VanDerWaalsContact O-CB 3.3Å; H82-Q86 WeakPolarHBondContact O-CB 3.4Å; H82-Q86 PolarHBondContact O-N 3.4Å; Q83-Q86 PolarHBondContact O-N 3.44Å; Q84-Q86 VanDerWaalsContact C-N 3.27Å; Q84-Q86 PolarHBondContact O-N 3.48Å; Q86-N90 WeakPolarHBondContact O-CB 3.45Å; Q86-N90 PolarHBondContact O-N 3.27Å; Q86-N90 PolarHBondContact O-ND2 2.91Å; Q86-F96 HydrophobicContact CB-CD2 4.27Å; Q86-F96 HydrophobicContact CB-CE2 3.98Å; Q86-F96 HydrophobicContact CG-CD2 4.46Å
87	Q	95	Very high	95.2	Very high	124 Å²	124	107 Å²	107	58%	0.579	52%	0.524	S	S	*	.	H	α-helix	trans	-64.6	-45.4	174	-68.8	173.6	9.9	0	0	111.6	Q83 Q84 Y85 N90 Q91	Q83-Q87 WeakPolarHBondContact O-CG 3.41Å; Q83-Q87 PolarHBondContact O-N 3.24Å; Q83-Q87 VanDerWaalsContact O-N 3.11Å; Q84-Q87 WeakPolarHBondContact O-CB 3.46Å; Q84-Q87 PolarHBondContact O-N 3.41Å; Q84-Q87 VanDerWaalsContact O-N 3.11Å; Y85-Q87 VanDerWaalsContact C-N 3.31Å; Y85-Q87 PolarHBondContact O-N 2.97Å; Q87-N90 PolarHBondContact O-N 3.31Å; Q87-Q91 WeakPolarHBondContact O-CG 3.49Å; Q87-Q91 PolarHBondContact O-N 3.38Å
88	E	96.3	Very high	94.7	Very high	82 Å²	82	108.4 Å²	108.4	38%	0.383	53%	0.53	S	S	.	.	H	α-helix	trans	-61.3	-44.4	177.6	-69.3	174.6	-169.3	0	0	111.8	Q84 Y85 Q91 M92	Q84-E88 WeakPolarHBondContact CG-OE1 3.34Å; Q84-E88 PolarHBondContact NE2-OE1 3.38Å; Q84-E88 PolarHBondContact O-N 3.49Å; Y85-E88 PolarHBondContact O-N 3.04Å; E88-Q91 WeakPolarHBondContact O-CB 3.28Å; E88-Q91 PolarHBondContact O-N 3.22Å; E88-M92 PolarHBondContact O-N 3.4Å
89	L	95.7	Very high	94.4	Very high	41 Å²	41	108.6 Å²	108.6	22%	0.215	53%	0.533	C	S	.	.	H	α-helix	trans	-63	-44.1	176.4	-74.1	172.6	0	0	0	111.7	Y85 Q91 M92 G93 K94 F96	Y85-L89 WeakPolarHBondContact O-CB 3.45Å; Y85-L89 VanDerWaalsContact O-CG 3.26Å; Y85-L89 WeakPolarHBondContact O-CG 3.46Å; Y85-L89 PolarHBondContact O-N 3.01Å; L89-Q91 VanDerWaalsContact C-N 3.28Å; L89-Q91 PolarHBondContact O-N 3.42Å; L89-M92 CarbonylContact O-C 3.07Å; L89-M92 WeakPolarHBondContact O-CA 3.3Å; L89-M92 WeakPolarHBondContact O-CB 3.42Å; L89-M92 PolarHBondContact O-N 2.96Å; L89-G93 PolarHBondContact O-N 3.05Å; L89-G93 VanDerWaalsContact O-N 3.12Å; L89-K94 CarbonylContact C-O 3.43Å; L89-K94 HydrophobicContact CB-CB 4.36Å; L89-K94 WeakPolarHBondContact CB-O 3.46Å; L89-K94 HydrophobicContact CD2-CB 3.93Å; L89-K94 CarbonylContact O-C 3.6Å; L89-K94 PolarHBondContact O-N 2.91Å; L89-F96 HydrophobicContact CD1-CD1 3.92Å; L89-F96 HydrophobicContact CD1-CD2 3.81Å; L89-F96 HydrophobicContact CD1-CE1 3.82Å; L89-F96 HydrophobicContact CD1-CE2 3.71Å; L89-F96 HydrophobicContact CD1-CG 3.92Å; L89-F96 HydrophobicContact CD1-CZ 3.72Å
90	N	93.6	Very high	93.9	Very high	95 Å²	95	114.4 Å²	114.4	51%	0.508	55%	0.549	S	S	.	.	H	α-helix	trans	-61	-37.6	178.3	-72.8	-19.6	0	0	0	111.8	Q86 Q87 M92 G93 K94	Q86-N90 WeakPolarHBondContact O-CB 3.45Å; Q86-N90 PolarHBondContact O-N 3.27Å; Q86-N90 PolarHBondContact O-ND2 2.91Å; Q87-N90 PolarHBondContact O-N 3.31Å; N90-M92 PolarHBondContact O-N 3.11Å; N90-G93 PolarHBondContact O-N 3.29Å; N90-K94 PolarHBondContact N-O 3.2Å
91	Q	94.6	Very high	92.4	Very high	164 Å²	164	119.8 Å²	119.8	77%	0.766	57%	0.573	S	S	*	*	H	α-helix	trans	-62.7	-32.3	173.8	-69.7	171.4	19.1	0	0	112.2	Q87 E88 L89 G93	Q87-Q91 WeakPolarHBondContact O-CG 3.49Å; Q87-Q91 PolarHBondContact O-N 3.38Å; E88-Q91 WeakPolarHBondContact O-CB 3.28Å; E88-Q91 PolarHBondContact O-N 3.22Å; L89-Q91 VanDerWaalsContact C-N 3.28Å; L89-Q91 PolarHBondContact O-N 3.42Å; Q91-G93 VanDerWaalsContact C-N 3.28Å
92	M	95.1	Very high	92.2	Very high	132 Å²	132	121.5 Å²	121.5	65%	0.65	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.7	0.9	174.3	-61.4	-175.3	73.1	0	0	113.6	E88 L89 N90 K94	E88-M92 PolarHBondContact O-N 3.4Å; L89-M92 CarbonylContact O-C 3.07Å; L89-M92 WeakPolarHBondContact O-CA 3.3Å; L89-M92 WeakPolarHBondContact O-CB 3.42Å; L89-M92 PolarHBondContact O-N 2.96Å; N90-M92 PolarHBondContact O-N 3.11Å; M92-K94 HydrophobicContact CB-CG 4.39Å; M92-K94 PolarHBondContact O-N 3.04Å
93	G	92.8	Very high	92	Very high	73 Å²	73	123.1 Å²	123.1	75%	0.753	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	68.3	19.4	-173.2	0	0	0	0	0	114.1	L89 N90 Q91	L89-G93 PolarHBondContact O-N 3.05Å; L89-G93 VanDerWaalsContact O-N 3.12Å; N90-G93 PolarHBondContact O-N 3.29Å; Q91-G93 VanDerWaalsContact C-N 3.28Å
94	K	94.7	Very high	91.8	Very high	121 Å²	121	123.6 Å²	123.6	53%	0.526	59%	0.594	S	S	.	*			trans	-107.4	163.6	177.4	-64.4	-178.5	-178.6	179.2	0	110.1	L89 N90 M92	L89-K94 CarbonylContact C-O 3.43Å; L89-K94 HydrophobicContact CB-CB 4.36Å; L89-K94 WeakPolarHBondContact CB-O 3.46Å; L89-K94 HydrophobicContact CD2-CB 3.93Å; L89-K94 CarbonylContact O-C 3.6Å; L89-K94 PolarHBondContact O-N 2.91Å; N90-K94 PolarHBondContact N-O 3.2Å; M92-K94 HydrophobicContact CB-CG 4.39Å; M92-K94 PolarHBondContact O-N 3.04Å
95	A	92.7	Very high	91.5	Very high	78 Å²	78	124.9 Å²	124.9	65%	0.645	60%	0.601	S	S	*	*			trans	-142.3	161.6	174.9	0	0	0	0	0	110.5
96	F	92.6	Very high	91.2	Very high	84 Å²	84	125.3 Å²	125.3	37%	0.368	61%	0.609	S	S	.	*			trans	-64.3	140.9	171.7	-76.4	-69.9	0	0	0	111.1	H82 Q86 L89	H82-F96 AromaticContact CE1-CD2 3.52Å; H82-F96 AromaticContact CE1-CE2 3.55Å; H82-F96 AromaticContact ND1-CE2 3.7Å; H82-F96 AromaticContact ND1-CZ 3.97Å; Q86-F96 HydrophobicContact CB-CD2 4.27Å; Q86-F96 HydrophobicContact CB-CE2 3.98Å; Q86-F96 HydrophobicContact CG-CD2 4.46Å; L89-F96 HydrophobicContact CD1-CD1 3.92Å; L89-F96 HydrophobicContact CD1-CD2 3.81Å; L89-F96 HydrophobicContact CD1-CE1 3.82Å; L89-F96 HydrophobicContact CD1-CE2 3.71Å; L89-F96 HydrophobicContact CD1-CG 3.92Å; L89-F96 HydrophobicContact CD1-CZ 3.72Å
97	Y	90.5	Very high	91	Very high	191 Å²	191	127.9 Å²	127.9	75%	0.749	62%	0.623	S	S	*	*			trans	-72.8	133.4	170.9	-179.5	-110.2	0	0	0	109.9	E99	Y97-E99 HydrophobicContact CD1-CG 4.16Å; Y97-E99 HydrophobicContact CE1-CB 4.46Å; Y97-E99 HydrophobicContact CE1-CG 3.26Å
98	I	88.3	Confident	90.7	Very high	131 Å²	131	128.2 Å²	128.2	67%	0.672	63%	0.626	S	S	*	*			trans	-128.9	111.9	177.6	-58.2	173.7	0	0	0	106.9	R100	I98-R100 PolarHBondContact O-N 3.41Å
99	E	89.9	Confident	90.3	Very high	117 Å²	117	131.8 Å²	131.8	55%	0.547	65%	0.645	S	S	.	*			trans	-66.2	120.5	170.3	-69.8	-175.7	165.3	0	0	109	Y97 F101	Y97-E99 HydrophobicContact CD1-CG 4.16Å; Y97-E99 HydrophobicContact CE1-CB 4.46Å; Y97-E99 HydrophobicContact CE1-CG 3.26Å; E99-F101 HydrophobicContact CB-CD2 4.3Å; E99-F101 HydrophobicContact CB-CE2 3.77Å; E99-F101 HydrophobicContact CB-CZ 4.27Å; E99-F101 WeakPolarHBondContact OE2-CE2 3.34Å; E99-F101 VanDerWaalsContact OE2-CZ 3.26Å; E99-F101 WeakPolarHBondContact OE2-CZ 3.41Å
100	R	86	Confident	89.8	Confident	238 Å²	238	139.3 Å²	139.3	90%	0.898	68%	0.681	S	S	*	*			trans	-97.5	106.9	169.9	-65.3	-173.7	-179.1	-170.2	0.3	107.3	I98	I98-R100 PolarHBondContact O-N 3.41Å
101	F	66.9	Low	89.5	Confident	248 Å²	248	143.4 Å²	143.4	100%	1.088	70%	0.697	S	S	*	*			trans	-87.3	0	167.8	-67	-77.6	0	0	0	110.2	E99	E99-F101 HydrophobicContact CB-CD2 4.3Å; E99-F101 HydrophobicContact CB-CE2 3.77Å; E99-F101 HydrophobicContact CB-CZ 4.27Å; E99-F101 WeakPolarHBondContact OE2-CE2 3.34Å; E99-F101 VanDerWaalsContact OE2-CZ 3.26Å; E99-F101 WeakPolarHBondContact OE2-CZ 3.41Å

Retrieved 101 of 101 residues in 371.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).