A0A096N986_PAPAN Loading...

IQ motif containing F6

AlphaFold DB (A0A2K5UBB6), UniProt , Accession A0A096N986, Species PAPAN (Papio anubis, Olive baboon), Gene IQCF6, Length 146 aa.

						>A0A096N986_PAPAN|A0A096N986|IQCF6
MDTQNVSKALAGGTCLMGNEQCLKLEKTAIKIQSWWRGNMVRRTLLHAALRAWVIQCWWRSMQAKMLEQRRRLALRLYTCQEWAVVKVQAQVRMWQARRRFLQARQAACIIQSHWRWHASQTRGLIRGHYEVRASRLELDIEILMT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.7	Very low	51.1	Low	221 Å²	221	121.6 Å²	121.6	100%	1.089	68%	0.675	S	S	*	*				0	87.5	0	-84.5	-74.8	173.6	0	0	107	T3	M1-T3 PolarHBondContact O-N 3.36Å
2	D	48.5	Very low	51.3	Low	126 Å²	126	114.8 Å²	114.8	67%	0.674	65%	0.653	S	S	*	*			trans	-90.9	76.5	-158	-58.6	-81.3	0	0	0	111.8
3	T	50.8	Low	51.5	Low	115 Å²	115	108.8 Å²	108.8	71%	0.706	63%	0.633	S	S	*	*	H	α-helix	trans	-89.5	-20	-179.8	50.5	0	0	0	0	113.5	M1 S7	M1-T3 PolarHBondContact O-N 3.36Å; T3-S7 PolarHBondContact O-OG 3.41Å; T3-S7 VanDerWaalsContact O-OG 3.1Å
4	Q	54.7	Low	51.8	Low	166 Å²	166	108.6 Å²	108.6	78%	0.776	63%	0.634	S	S	*	*	H	α-helix	trans	-83.3	-19	178.5	-74	-178.3	-10.7	0	0	114.2	S7	Q4-S7 PolarHBondContact O-OG 3.42Å
5	N	51.4	Low	52	Low	119 Å²	119	107.3 Å²	107.3	64%	0.636	63%	0.632	S	S	*	*	H	α-helix	trans	-84.6	-28.5	-178.5	-146.5	5.8	0	0	0	112.4	A9	N5-A9 PolarHBondContact O-N 3.46Å
6	V	53.7	Low	52.4	Low	88 Å²	88	108.1 Å²	108.1	53%	0.533	63%	0.631	S	S	.	*	H	α-helix	trans	-74.4	-35.2	179.7	-180	0	0	0	0	112.2	A9 L10	V6-A9 PolarHBondContact O-N 3.1Å; V6-L10 HydrophobicContact CG1-CD1 4.03Å; V6-L10 WeakPolarHBondContact O-CG 3.31Å; V6-L10 PolarHBondContact O-N 3.29Å
7	S	53.2	Low	52.7	Low	70 Å²	70	108.2 Å²	108.2	49%	0.49	63%	0.626	S	S	.	*	H	α-helix	trans	-74	-32.6	-179.4	29.8	0	0	0	0	112.9	T3 Q4 A11	T3-S7 PolarHBondContact O-OG 3.41Å; T3-S7 VanDerWaalsContact O-OG 3.1Å; Q4-S7 PolarHBondContact O-OG 3.42Å; S7-A11 PolarHBondContact O-N 3.46Å
8	K	52.8	Low	53.6	Low	172 Å²	172	104.1 Å²	104.1	75%	0.748	61%	0.611	S	S	*	*	H	α-helix	trans	-70.7	-31.6	171.1	-84.5	-179.6	177.1	173.1	0	113.2
9	A	51.5	Low	54.7	Low	72 Å²	72	104.1 Å²	104.1	60%	0.595	61%	0.608	S	S	*	*	H	α-helix	trans	-72.9	-34.7	176.8	0	0	0	0	0	113.1	N5 V6	N5-A9 PolarHBondContact O-N 3.46Å; V6-A9 PolarHBondContact O-N 3.1Å
10	L	52	Low	56	Low	125 Å²	125	103.9 Å²	103.9	65%	0.654	60%	0.601	S	S	*	*	H	α-helix	trans	-76.7	-32.6	-179.9	-72.4	166.1	0	0	0	113.6	V6 T14	V6-L10 HydrophobicContact CG1-CD1 4.03Å; V6-L10 WeakPolarHBondContact O-CG 3.31Å; V6-L10 PolarHBondContact O-N 3.29Å; L10-T14 PolarHBondContact O-OG1 3.48Å
11	A	50.2	Low	57.2	Low	64 Å²	64	104.4 Å²	104.4	53%	0.529	60%	0.598	S	S	.	*	H	α-helix	trans	-75.9	-28.7	178.1	0	0	0	0	0	113.5	S7	S7-A11 PolarHBondContact O-N 3.46Å
12	G	52.7	Low	59.2	Low	40 Å²	40	96.8 Å²	96.8	41%	0.412	57%	0.566	S	S	.	*	H	α-helix	trans	-70	-32.1	175.3	0	0	0	0	0	113.6	L16	G12-L16 WeakPolarHBondContact O-CD1 3.31Å; G12-L16 WeakPolarHBondContact O-CG 3.46Å
13	G	54.7	Low	61.2	Low	37 Å²	37	94.9 Å²	94.9	38%	0.381	56%	0.555	S	S	.	*	H	α-helix	trans	-75.8	-33.2	-177.8	0	0	0	0	0	114.9	M17	G13-M17 VanDerWaalsContact O-CG 3.31Å; G13-M17 WeakPolarHBondContact O-CG 3.44Å; G13-M17 PolarHBondContact O-N 2.9Å
14	T	54.7	Low	63.2	Low	106 Å²	106	94.9 Å²	94.9	65%	0.65	55%	0.546	S	S	*	.	H	α-helix	trans	-74.7	-35.3	-176.7	-4.3	0	0	0	0	112.7	L10 G18	L10-T14 PolarHBondContact O-OG1 3.48Å; T14-G18 PolarHBondContact O-N 3.33Å
15	C	56	Low	65	Low	89 Å²	89	92.8 Å²	92.8	60%	0.601	54%	0.539	S	S	*	.	H	α-helix	trans	-71.4	-36.1	175.2	-83.2	0	0	0	0	113.3	G18 N19	C15-G18 PolarHBondContact O-N 3.01Å; C15-N19 PolarHBondContact O-N 3.31Å; C15-N19 VanDerWaalsContact O-N 3.11Å; C15-N19 PolarHBondContact O-ND2 2.71Å
16	L	58.3	Low	67	Low	120 Å²	120	92.1 Å²	92.1	63%	0.628	53%	0.532	S	S	*	.	H	α-helix	trans	-69	-39.6	178.4	-71.5	171.3	0	0	0	112	G12 G18 N19 E20	G12-L16 WeakPolarHBondContact O-CD1 3.31Å; G12-L16 WeakPolarHBondContact O-CG 3.46Å; L16-G18 VanDerWaalsContact C-N 3.35Å; L16-G18 PolarHBondContact O-N 3.46Å; L16-N19 PolarHBondContact O-N 3.21Å; L16-E20 PolarHBondContact O-N 3.15Å
17	M	57.2	Low	68.9	Low	109 Å²	109	94 Å²	94	54%	0.537	53%	0.533	S	S	.	.	H	α-helix	trans	-64.5	-37.5	175.9	-71.6	-65.8	-68.4	0	0	112.5	G13 Q21	G13-M17 VanDerWaalsContact O-CG 3.31Å; G13-M17 WeakPolarHBondContact O-CG 3.44Å; G13-M17 PolarHBondContact O-N 2.9Å; M17-Q21 WeakPolarHBondContact O-CB 3.47Å; M17-Q21 VanDerWaalsContact O-CG 3.27Å; M17-Q21 WeakPolarHBondContact O-CG 3.5Å; M17-Q21 PolarHBondContact O-N 3.47Å
18	G	68.1	Low	70.9	Confident	35 Å²	35	94.2 Å²	94.2	36%	0.361	53%	0.532	S	S	.	.	H	α-helix	trans	-65.8	-41.6	173.4	0	0	0	0	0	112.9	T14 C15 L16 Q21 C22	T14-G18 PolarHBondContact O-N 3.33Å; C15-G18 PolarHBondContact O-N 3.01Å; L16-G18 VanDerWaalsContact C-N 3.35Å; L16-G18 PolarHBondContact O-N 3.46Å; G18-Q21 PolarHBondContact O-N 3.3Å; G18-C22 VanDerWaalsContact O-CB 3.31Å; G18-C22 WeakPolarHBondContact O-CB 3.37Å; G18-C22 PolarHBondContact O-N 3.11Å
19	N	75.1	Confident	73	Confident	103 Å²	103	88 Å²	88	55%	0.551	51%	0.512	S	S	*	.	H	α-helix	trans	-65.9	-40.2	176.9	-73.6	-18	0	0	0	112.3	C15 L16 C22 L23	C15-N19 PolarHBondContact O-N 3.31Å; C15-N19 VanDerWaalsContact O-N 3.11Å; C15-N19 PolarHBondContact O-ND2 2.71Å; L16-N19 PolarHBondContact O-N 3.21Å; N19-C22 PolarHBondContact O-N 2.85Å; N19-L23 WeakPolarHBondContact O-CB 3.27Å; N19-L23 PolarHBondContact O-N 3.03Å
20	E	80.4	Confident	75.1	Confident	100 Å²	100	89.4 Å²	89.4	47%	0.467	51%	0.508	S	S	.	.	H	α-helix	trans	-70.3	-36.4	178.5	-152.2	-166.8	138.3	0	0	112.3	L16 K24	L16-E20 PolarHBondContact O-N 3.15Å; E20-K24 VanDerWaalsContact O-CG 3.28Å; E20-K24 WeakPolarHBondContact O-CG 3.25Å; E20-K24 PolarHBondContact O-N 3.11Å; E20-K24 VanDerWaalsContact O-N 3.13Å; E20-K24 WeakPolarHBondContact OE1-CE 3.48Å; E20-K24 IonicContact OE1-NZ 2.76Å; E20-K24 PolarHBondContact OE1-NZ 3.22Å
21	Q	82.4	Confident	77.2	Confident	115 Å²	115	91 Å²	91	54%	0.537	51%	0.51	S	S	.	.	H	α-helix	trans	-68.2	-40.9	172.6	-74.2	179.3	1	0	0	112.1	M17 G18 K24 L25	M17-Q21 WeakPolarHBondContact O-CB 3.47Å; M17-Q21 VanDerWaalsContact O-CG 3.27Å; M17-Q21 WeakPolarHBondContact O-CG 3.5Å; M17-Q21 PolarHBondContact O-N 3.47Å; G18-Q21 PolarHBondContact O-N 3.3Å; Q21-K24 WeakPolarHBondContact O-CB 3.46Å; Q21-K24 PolarHBondContact O-N 3.41Å; Q21-L25 PolarHBondContact O-N 3.06Å
22	C	85.4	Confident	79.4	Confident	62 Å²	62	93.1 Å²	93.1	42%	0.419	51%	0.512	S	S	.	.	H	α-helix	trans	-61.2	-47.4	175.4	-167.2	0	0	0	0	111.5	G18 N19 K24 L25 E26	G18-C22 VanDerWaalsContact O-CB 3.31Å; G18-C22 WeakPolarHBondContact O-CB 3.37Å; G18-C22 PolarHBondContact O-N 3.11Å; N19-C22 PolarHBondContact O-N 2.85Å; C22-K24 VanDerWaalsContact C-N 3.27Å; C22-K24 PolarHBondContact O-N 3.44Å; C22-L25 PolarHBondContact O-N 3.4Å; C22-L25 VanDerWaalsContact O-N 3.11Å; C22-E26 WeakPolarHBondContact O-CG 3.21Å; C22-E26 PolarHBondContact O-N 3.28Å
23	L	90.4	Very high	81.5	Confident	86 Å²	86	95.9 Å²	95.9	45%	0.45	51%	0.514	S	S	.	.	H	α-helix	trans	-58.4	-36.2	174.4	-94.6	155.7	0	0	0	113.1	N19 K27	N19-L23 WeakPolarHBondContact O-CB 3.27Å; N19-L23 PolarHBondContact O-N 3.03Å; L23-K27 WeakPolarHBondContact O-CB 3.41Å; L23-K27 WeakPolarHBondContact O-CD 3.48Å; L23-K27 WeakPolarHBondContact O-CG 3.23Å; L23-K27 PolarHBondContact O-N 2.97Å; L23-K27 VanDerWaalsContact O-N 3.1Å
24	K	91.2	Very high	83.5	Confident	115 Å²	115	97.3 Å²	97.3	50%	0.5	52%	0.518	S	S	.	.	H	α-helix	trans	-66.8	-44.5	175.4	-75.7	168.2	-173.3	163.7	0	110.9	E20 Q21 C22 K27 T28	E20-K24 VanDerWaalsContact O-CG 3.28Å; E20-K24 WeakPolarHBondContact O-CG 3.25Å; E20-K24 PolarHBondContact O-N 3.11Å; E20-K24 VanDerWaalsContact O-N 3.13Å; E20-K24 WeakPolarHBondContact OE1-CE 3.48Å; E20-K24 IonicContact OE1-NZ 2.76Å; E20-K24 PolarHBondContact OE1-NZ 3.22Å; Q21-K24 WeakPolarHBondContact O-CB 3.46Å; Q21-K24 PolarHBondContact O-N 3.41Å; C22-K24 VanDerWaalsContact C-N 3.27Å; C22-K24 PolarHBondContact O-N 3.44Å; K24-K27 PolarHBondContact O-N 3.12Å; K24-T28 WeakPolarHBondContact O-CG2 3.49Å; K24-T28 PolarHBondContact O-N 3.38Å; K24-T28 PolarHBondContact O-OG1 3.42Å
25	L	92.6	Very high	85.5	Confident	122 Å²	122	100 Å²	100	64%	0.639	52%	0.516	S	S	*	.	H	α-helix	trans	-62.3	-46.6	176.9	-71.6	166.9	0	0	0	111.6	Q21 C22 K27 T28 A29	Q21-L25 PolarHBondContact O-N 3.06Å; C22-L25 PolarHBondContact O-N 3.4Å; C22-L25 VanDerWaalsContact O-N 3.11Å; L25-K27 PolarHBondContact O-N 3.1Å; L25-T28 WeakPolarHBondContact CA-OG1 3.49Å; L25-T28 PolarHBondContact O-N 3.36Å; L25-T28 VanDerWaalsContact O-N 3.15Å; L25-T28 PolarHBondContact O-OG1 2.87Å; L25-A29 WeakPolarHBondContact O-CB 3.36Å; L25-A29 PolarHBondContact O-N 2.93Å
26	E	93.8	Very high	87.5	Confident	104 Å²	104	102 Å²	102	49%	0.486	51%	0.511	S	S	.	.	H	α-helix	trans	-57.9	-46.8	176.5	-72.2	-179.6	167.7	0	0	112	C22 T28 A29 I30	C22-E26 WeakPolarHBondContact O-CG 3.21Å; C22-E26 PolarHBondContact O-N 3.28Å; E26-T28 VanDerWaalsContact C-N 3.31Å; E26-T28 PolarHBondContact O-N 3.13Å; E26-A29 PolarHBondContact O-N 2.88Å; E26-I30 WeakPolarHBondContact O-CB 3.44Å; E26-I30 WeakPolarHBondContact O-CD1 3.49Å; E26-I30 VanDerWaalsContact O-CG1 3.23Å; E26-I30 WeakPolarHBondContact O-CG1 3.38Å; E26-I30 PolarHBondContact O-N 2.99Å
27	K	95.1	Very high	89.4	Confident	129 Å²	129	104.1 Å²	104.1	56%	0.561	51%	0.511	S	S	*	.	H	α-helix	trans	-60.4	-39.5	176.7	-73.7	172	-176	178.3	0	112.2	L23 K24 L25 K31	L23-K27 WeakPolarHBondContact O-CB 3.41Å; L23-K27 WeakPolarHBondContact O-CD 3.48Å; L23-K27 WeakPolarHBondContact O-CG 3.23Å; L23-K27 PolarHBondContact O-N 2.97Å; L23-K27 VanDerWaalsContact O-N 3.1Å; K24-K27 PolarHBondContact O-N 3.12Å; L25-K27 PolarHBondContact O-N 3.1Å; K27-K31 WeakPolarHBondContact O-CG 3.43Å; K27-K31 PolarHBondContact O-N 2.84Å; K27-K31 VanDerWaalsContact O-N 3.1Å
28	T	95	Very high	91.3	Very high	74 Å²	74	100.9 Å²	100.9	45%	0.454	51%	0.505	S	S	.	.	H	α-helix	trans	-69.2	-40.6	175.9	59.7	0	0	0	0	112.4	K24 L25 E26 I30 K31 I32	K24-T28 WeakPolarHBondContact O-CG2 3.49Å; K24-T28 PolarHBondContact O-N 3.38Å; K24-T28 PolarHBondContact O-OG1 3.42Å; L25-T28 WeakPolarHBondContact CA-OG1 3.49Å; L25-T28 PolarHBondContact O-N 3.36Å; L25-T28 VanDerWaalsContact O-N 3.15Å; L25-T28 PolarHBondContact O-OG1 2.87Å; E26-T28 VanDerWaalsContact C-N 3.31Å; E26-T28 PolarHBondContact O-N 3.13Å; T28-I30 PolarHBondContact O-N 2.97Å; T28-K31 WeakPolarHBondContact O-CB 3.28Å; T28-K31 PolarHBondContact O-N 3.49Å; T28-I32 WeakPolarHBondContact O-CG1 3.41Å; T28-I32 PolarHBondContact O-N 3.16Å
29	A	95.4	Very high	92.7	Very high	41 Å²	41	101.3 Å²	101.3	34%	0.339	50%	0.499	S	S	.	.	H	α-helix	trans	-62.2	-44	175.9	0	0	0	0	0	111.1	L25 E26 K31 I32 Q33	L25-A29 WeakPolarHBondContact O-CB 3.36Å; L25-A29 PolarHBondContact O-N 2.93Å; E26-A29 PolarHBondContact O-N 2.88Å; A29-K31 VanDerWaalsContact C-N 3.32Å; A29-K31 PolarHBondContact O-N 3.46Å; A29-I32 PolarHBondContact O-N 3Å; A29-I32 VanDerWaalsContact O-N 3.16Å; A29-Q33 WeakPolarHBondContact O-CB 3.48Å; A29-Q33 VanDerWaalsContact O-CG 3.25Å; A29-Q33 WeakPolarHBondContact O-CG 3.43Å; A29-Q33 PolarHBondContact O-N 3.22Å
30	I	96	Very high	93.8	Very high	101 Å²	101	100.7 Å²	100.7	52%	0.518	49%	0.494	S	S	.	.	H	α-helix	trans	-61	-40.5	175.8	-68.2	164.1	0	0	0	111	E26 T28 Q33 S34	E26-I30 WeakPolarHBondContact O-CB 3.44Å; E26-I30 WeakPolarHBondContact O-CD1 3.49Å; E26-I30 VanDerWaalsContact O-CG1 3.23Å; E26-I30 WeakPolarHBondContact O-CG1 3.38Å; E26-I30 PolarHBondContact O-N 2.99Å; T28-I30 PolarHBondContact O-N 2.97Å; I30-Q33 PolarHBondContact O-N 3.22Å; I30-S34 WeakPolarHBondContact O-CB 3.38Å; I30-S34 PolarHBondContact O-N 3.49Å; I30-S34 PolarHBondContact O-OG 3.41Å
31	K	97.2	Very high	94.6	Very high	158 Å²	158	99.9 Å²	99.9	69%	0.687	50%	0.496	S	S	*	.	H	α-helix	trans	-60.7	-45.2	173.5	-80.6	-178.4	177.6	-179.8	0	112	K27 T28 A29 S34 W35	K27-K31 WeakPolarHBondContact O-CG 3.43Å; K27-K31 PolarHBondContact O-N 2.84Å; K27-K31 VanDerWaalsContact O-N 3.1Å; T28-K31 WeakPolarHBondContact O-CB 3.28Å; T28-K31 PolarHBondContact O-N 3.49Å; A29-K31 VanDerWaalsContact C-N 3.32Å; A29-K31 PolarHBondContact O-N 3.46Å; K31-S34 WeakPolarHBondContact CA-OG 3.47Å; K31-S34 PolarHBondContact O-OG 2.91Å; K31-W35 VanDerWaalsContact O-CB 3.26Å; K31-W35 WeakPolarHBondContact O-CB 3.41Å; K31-W35 PolarHBondContact O-N 3.4Å
32	I	95.9	Very high	95.3	Very high	110 Å²	110	103.6 Å²	103.6	56%	0.564	51%	0.505	S	S	*	.	H	α-helix	trans	-66	-44.7	179.3	-65.9	167.4	0	0	0	110.5	T28 A29 W35 W36	T28-I32 WeakPolarHBondContact O-CG1 3.41Å; T28-I32 PolarHBondContact O-N 3.16Å; A29-I32 PolarHBondContact O-N 3Å; A29-I32 VanDerWaalsContact O-N 3.16Å; I32-W35 PolarHBondContact O-N 3.41Å; I32-W36 WeakPolarHBondContact O-CB 3.45Å; I32-W36 PolarHBondContact O-N 3.15Å
33	Q	97.5	Very high	95.9	Very high	98 Å²	98	107.8 Å²	107.8	46%	0.458	51%	0.512	S	S	.	.	H	α-helix	trans	-64.2	-44.2	179.4	-72.4	175.2	-6.8	0	0	112.3	A29 I30 W36 R37	A29-Q33 WeakPolarHBondContact O-CB 3.48Å; A29-Q33 VanDerWaalsContact O-CG 3.25Å; A29-Q33 WeakPolarHBondContact O-CG 3.43Å; A29-Q33 PolarHBondContact O-N 3.22Å; I30-Q33 PolarHBondContact O-N 3.22Å; Q33-W36 PolarHBondContact O-N 2.99Å; Q33-R37 WeakPolarHBondContact O-CG 3.49Å; Q33-R37 PolarHBondContact O-N 2.77Å
34	S	95.8	Very high	96.3	Very high	67 Å²	67	107.7 Å²	107.7	47%	0.469	52%	0.515	S	S	.	.	H	α-helix	trans	-65.7	-41.9	176.9	54	0	0	0	0	111.5	I30 K31 W36 R37 G38	I30-S34 WeakPolarHBondContact O-CB 3.38Å; I30-S34 PolarHBondContact O-N 3.49Å; I30-S34 PolarHBondContact O-OG 3.41Å; K31-S34 WeakPolarHBondContact CA-OG 3.47Å; K31-S34 PolarHBondContact O-OG 2.91Å; S34-W36 PolarHBondContact O-N 3.29Å; S34-R37 PolarHBondContact O-N 2.87Å; S34-G38 PolarHBondContact O-N 3.1Å
35	W	97.6	Very high	96.6	Very high	162 Å²	162	107.6 Å²	107.6	61%	0.614	52%	0.519	S	S	*	.	H	α-helix	trans	-59.4	-45.9	173.6	176.5	85.8	0	0	0	112.2	K31 I32 G38 N39	K31-W35 VanDerWaalsContact O-CB 3.26Å; K31-W35 WeakPolarHBondContact O-CB 3.41Å; K31-W35 PolarHBondContact O-N 3.4Å; I32-W35 PolarHBondContact O-N 3.41Å; W35-G38 PolarHBondContact O-N 3.04Å; W35-N39 PolarHBondContact O-N 2.76Å
36	W	97.5	Very high	96.9	Very high	132 Å²	132	106.6 Å²	106.6	50%	0.5	51%	0.514	S	S	.	.	H	α-helix	trans	-62.1	-48	179	179.4	-105.7	0	0	0	112.3	I32 Q33 S34 G38 N39 M40	I32-W36 WeakPolarHBondContact O-CB 3.45Å; I32-W36 PolarHBondContact O-N 3.15Å; Q33-W36 PolarHBondContact O-N 2.99Å; S34-W36 PolarHBondContact O-N 3.29Å; W36-G38 VanDerWaalsContact C-N 3.29Å; W36-G38 PolarHBondContact O-N 3.46Å; W36-N39 WeakPolarHBondContact O-CB 3.38Å; W36-N39 PolarHBondContact O-N 3.01Å; W36-N39 VanDerWaalsContact O-N 3.12Å; W36-M40 HydrophobicContact CD2-CG 4.49Å; W36-M40 HydrophobicContact CZ2-CG 4.37Å; W36-M40 HydrophobicContact CZ2-SD 4.19Å; W36-M40 WeakPolarHBondContact O-CG 3.26Å; W36-M40 PolarHBondContact O-N 3.01Å
37	R	97.4	Very high	97.1	Very high	163 Å²	163	107.3 Å²	107.3	62%	0.615	52%	0.517	S	S	*	.	H	α-helix	trans	-58.7	-41.7	175.8	-72.8	178.5	176.9	117.5	-1.4	111.5	Q33 S34 M40 V41	Q33-R37 WeakPolarHBondContact O-CG 3.49Å; Q33-R37 PolarHBondContact O-N 2.77Å; S34-R37 PolarHBondContact O-N 2.87Å; R37-M40 PolarHBondContact O-N 3.04Å; R37-V41 WeakPolarHBondContact O-CG2 3.38Å; R37-V41 PolarHBondContact O-N 2.98Å; R37-V41 VanDerWaalsContact O-N 3.15Å
38	G	97.5	Very high	97.2	Very high	41 Å²	41	104 Å²	104	42%	0.423	51%	0.514	S	S	.	.	H	α-helix	trans	-62.4	-40.9	174.6	0	0	0	0	0	113.1	S34 W35 W36 R42	S34-G38 PolarHBondContact O-N 3.1Å; W35-G38 PolarHBondContact O-N 3.04Å; W36-G38 VanDerWaalsContact C-N 3.29Å; W36-G38 PolarHBondContact O-N 3.46Å; G38-R42 WeakPolarHBondContact O-CB 3.33Å; G38-R42 PolarHBondContact O-N 3.07Å
39	N	97.4	Very high	97.4	Very high	44 Å²	44	103.3 Å²	103.3	24%	0.235	52%	0.516	C	S	.	.	H	α-helix	trans	-64.5	-43.9	177.3	-163.4	-82	0	0	0	111.9	W35 W36 V41 R42 R43	W35-N39 PolarHBondContact O-N 2.76Å; W36-N39 WeakPolarHBondContact O-CB 3.38Å; W36-N39 PolarHBondContact O-N 3.01Å; W36-N39 VanDerWaalsContact O-N 3.12Å; N39-V41 PolarHBondContact O-N 3.29Å; N39-R42 PolarHBondContact O-N 3.41Å; N39-R43 PolarHBondContact O-N 3.32Å; N39-R43 PolarHBondContact OD1-NE 3.45Å
40	M	97.8	Very high	97.5	Very high	91 Å²	91	105.5 Å²	105.5	45%	0.448	52%	0.522	S	S	.	.	H	α-helix	trans	-57.9	-49.6	177.1	-67.5	-127.5	72.9	0	0	111.6	W36 R37 R42 R43 T44	W36-M40 HydrophobicContact CD2-CG 4.49Å; W36-M40 HydrophobicContact CZ2-CG 4.37Å; W36-M40 HydrophobicContact CZ2-SD 4.19Å; W36-M40 WeakPolarHBondContact O-CG 3.26Å; W36-M40 PolarHBondContact O-N 3.01Å; R37-M40 PolarHBondContact O-N 3.04Å; M40-R42 VanDerWaalsContact C-N 3.35Å; M40-R42 PolarHBondContact O-N 3.17Å; M40-R43 PolarHBondContact O-N 2.96Å; M40-T44 WeakPolarHBondContact O-CG2 3.22Å; M40-T44 PolarHBondContact O-N 3.43Å; M40-T44 PolarHBondContact O-OG1 3.34Å
41	V	98.1	Very high	97.6	Very high	82 Å²	82	109.9 Å²	109.9	50%	0.497	53%	0.532	S	S	.	.	H	α-helix	trans	-63.7	-39.9	178.4	175.7	0	0	0	0	111.6	R37 N39 R43 T44 L45	R37-V41 WeakPolarHBondContact O-CG2 3.38Å; R37-V41 PolarHBondContact O-N 2.98Å; R37-V41 VanDerWaalsContact O-N 3.15Å; N39-V41 PolarHBondContact O-N 3.29Å; V41-R43 VanDerWaalsContact C-N 3.33Å; V41-R43 PolarHBondContact O-N 3.29Å; V41-T44 WeakPolarHBondContact CA-OG1 3.46Å; V41-T44 PolarHBondContact O-N 3.41Å; V41-T44 PolarHBondContact O-OG1 3.49Å; V41-L45 HydrophobicContact CG1-CD1 3.88Å; V41-L45 HydrophobicContact CG1-CG 4.27Å; V41-L45 WeakPolarHBondContact O-CB 3.44Å; V41-L45 WeakPolarHBondContact O-CG 3.49Å; V41-L45 PolarHBondContact O-N 2.91Å
42	R	97.7	Very high	97.7	Very high	193 Å²	193	104.6 Å²	104.6	73%	0.728	52%	0.517	S	S	*	.	H	α-helix	trans	-62.6	-40.4	177.8	-172.6	173.4	-67.6	178.2	-1.1	112	G38 N39 M40 L46	G38-R42 WeakPolarHBondContact O-CB 3.33Å; G38-R42 PolarHBondContact O-N 3.07Å; N39-R42 PolarHBondContact O-N 3.41Å; M40-R42 VanDerWaalsContact C-N 3.35Å; M40-R42 PolarHBondContact O-N 3.17Å; R42-L46 WeakPolarHBondContact O-CB 3.36Å; R42-L46 PolarHBondContact O-N 3.3Å
43	R	97.8	Very high	97.8	Very high	150 Å²	150	106.7 Å²	106.7	57%	0.566	52%	0.518	S	S	*	.	H	α-helix	trans	-64.4	-46	175.5	-76.4	-179.7	172.5	-169.1	-2.6	112	N39 M40 V41 L46 H47	N39-R43 PolarHBondContact O-N 3.32Å; N39-R43 PolarHBondContact OD1-NE 3.45Å; M40-R43 PolarHBondContact O-N 2.96Å; V41-R43 VanDerWaalsContact C-N 3.33Å; V41-R43 PolarHBondContact O-N 3.29Å; R43-L46 PolarHBondContact O-N 2.99Å; R43-H47 PolarHBondContact O-CD2 2.91Å; R43-H47 PolarHBondContact O-N 3.42Å
44	T	97.9	Very high	97.8	Very high	85 Å²	85	106.2 Å²	106.2	52%	0.521	52%	0.522	S	S	.	.	H	α-helix	trans	-65	-42.4	-179.5	56	0	0	0	0	111.7	M40 V41 L46 H47 A48	M40-T44 WeakPolarHBondContact O-CG2 3.22Å; M40-T44 PolarHBondContact O-N 3.43Å; M40-T44 PolarHBondContact O-OG1 3.34Å; V41-T44 WeakPolarHBondContact CA-OG1 3.46Å; V41-T44 PolarHBondContact O-N 3.41Å; V41-T44 PolarHBondContact O-OG1 3.49Å; T44-L46 PolarHBondContact O-N 3.27Å; T44-H47 PolarHBondContact O-N 3.5Å; T44-A48 WeakPolarHBondContact O-CB 3.41Å; T44-A48 PolarHBondContact O-N 3.5Å
45	L	98.3	Very high	97.9	Very high	112 Å²	112	108.3 Å²	108.3	59%	0.586	53%	0.527	S	S	*	.	H	α-helix	trans	-62.3	-42.4	174.9	-73	174.6	0	0	0	112.2	V41 A48 A49	V41-L45 HydrophobicContact CG1-CD1 3.88Å; V41-L45 HydrophobicContact CG1-CG 4.27Å; V41-L45 WeakPolarHBondContact O-CB 3.44Å; V41-L45 WeakPolarHBondContact O-CG 3.49Å; V41-L45 PolarHBondContact O-N 2.91Å; L45-A48 PolarHBondContact O-N 3.29Å; L45-A49 VanDerWaalsContact O-CB 3.29Å; L45-A49 WeakPolarHBondContact O-CB 3.37Å; L45-A49 PolarHBondContact O-N 3.33Å
46	L	98.3	Very high	98	Very high	101 Å²	101	105.6 Å²	105.6	53%	0.529	52%	0.521	S	S	.	.	H	α-helix	trans	-62.7	-43.9	176.8	-176.6	134.3	0	0	0	111.4	R42 R43 T44 A49 L50	R42-L46 WeakPolarHBondContact O-CB 3.36Å; R42-L46 PolarHBondContact O-N 3.3Å; R43-L46 PolarHBondContact O-N 2.99Å; T44-L46 PolarHBondContact O-N 3.27Å; L46-A49 PolarHBondContact O-N 3.33Å; L46-L50 HydrophobicContact CD2-CD1 3.66Å; L46-L50 HydrophobicContact CD2-CG 4.48Å; L46-L50 HydrophobicContact CG-CD1 4.32Å; L46-L50 WeakPolarHBondContact O-CB 3.47Å; L46-L50 VanDerWaalsContact O-CG 3.31Å; L46-L50 WeakPolarHBondContact O-CG 3.33Å; L46-L50 PolarHBondContact O-N 2.88Å
47	H	98	Very high	98	Very high	119 Å²	119	101.7 Å²	101.7	55%	0.551	51%	0.513	S	S	*	.	H	α-helix	trans	-61.1	-45.3	174.1	-79.5	-60.1	0	0	0	112.2	R43 T44 L50 R51	R43-H47 PolarHBondContact O-CD2 2.91Å; R43-H47 PolarHBondContact O-N 3.42Å; T44-H47 PolarHBondContact O-N 3.5Å; H47-L50 PolarHBondContact O-N 2.97Å; H47-R51 WeakPolarHBondContact O-CG 3.4Å; H47-R51 PolarHBondContact O-N 3.01Å
48	A	98.1	Very high	98.1	Very high	59 Å²	59	101 Å²	101	49%	0.488	51%	0.511	S	S	.	.	H	α-helix	trans	-62	-44.1	177.3	0	0	0	0	0	111.9	T44 L45 L50 R51 A52	T44-A48 WeakPolarHBondContact O-CB 3.41Å; T44-A48 PolarHBondContact O-N 3.5Å; L45-A48 PolarHBondContact O-N 3.29Å; A48-L50 PolarHBondContact O-N 2.99Å; A48-R51 PolarHBondContact O-N 3.23Å; A48-A52 WeakPolarHBondContact O-CB 3.43Å; A48-A52 PolarHBondContact O-N 3.2Å
49	A	98.3	Very high	98.1	Very high	60 Å²	60	105.6 Å²	105.6	50%	0.496	52%	0.515	S	S	.	.	H	α-helix	trans	-62.2	-43.5	177.9	0	0	0	0	0	111.9	L45 L46 R51 A52 W53	L45-A49 VanDerWaalsContact O-CB 3.29Å; L45-A49 WeakPolarHBondContact O-CB 3.37Å; L45-A49 PolarHBondContact O-N 3.33Å; L46-A49 PolarHBondContact O-N 3.33Å; A49-R51 PolarHBondContact O-N 3.25Å; A49-A52 PolarHBondContact O-N 3.47Å; A49-W53 VanDerWaalsContact O-CB 3.31Å; A49-W53 WeakPolarHBondContact O-CB 3.31Å; A49-W53 PolarHBondContact O-N 2.85Å
50	L	98.1	Very high	98.1	Very high	88 Å²	88	112 Å²	112	46%	0.461	54%	0.536	S	S	.	.	H	α-helix	trans	-63.1	-42	176.1	-73.6	172.9	0	0	0	112	L46 H47 A48 W53 V54	L46-L50 HydrophobicContact CD2-CD1 3.66Å; L46-L50 HydrophobicContact CD2-CG 4.48Å; L46-L50 HydrophobicContact CG-CD1 4.32Å; L46-L50 WeakPolarHBondContact O-CB 3.47Å; L46-L50 VanDerWaalsContact O-CG 3.31Å; L46-L50 WeakPolarHBondContact O-CG 3.33Å; L46-L50 PolarHBondContact O-N 2.88Å; H47-L50 PolarHBondContact O-N 2.97Å; A48-L50 PolarHBondContact O-N 2.99Å; L50-W53 PolarHBondContact O-N 3.38Å; L50-V54 WeakPolarHBondContact O-CG2 3.48Å; L50-V54 PolarHBondContact O-N 2.91Å
51	R	98.1	Very high	98.1	Very high	193 Å²	193	110.2 Å²	110.2	73%	0.728	53%	0.533	S	S	*	.	H	α-helix	trans	-62.6	-46.3	176.4	-66.8	-71.7	-177.1	-179.7	0.9	111.3	H47 A48 A49 W53 V54 I55	H47-R51 WeakPolarHBondContact O-CG 3.4Å; H47-R51 PolarHBondContact O-N 3.01Å; A48-R51 PolarHBondContact O-N 3.23Å; A49-R51 PolarHBondContact O-N 3.25Å; R51-W53 VanDerWaalsContact C-N 3.32Å; R51-W53 PolarHBondContact O-N 3.37Å; R51-V54 PolarHBondContact O-N 3.41Å; R51-I55 WeakPolarHBondContact O-CG1 3.29Å; R51-I55 PolarHBondContact O-N 2.94Å
52	A	98.3	Very high	98.1	Very high	47 Å²	47	109 Å²	109	39%	0.388	52%	0.522	S	S	.	.	H	α-helix	trans	-60.8	-43.1	176.1	0	0	0	0	0	111.4	A48 A49 V54 I55 Q56	A48-A52 WeakPolarHBondContact O-CB 3.43Å; A48-A52 PolarHBondContact O-N 3.2Å; A49-A52 PolarHBondContact O-N 3.47Å; A52-V54 PolarHBondContact O-N 3.47Å; A52-I55 PolarHBondContact O-N 3.37Å; A52-Q56 VanDerWaalsContact O-CG 3.31Å; A52-Q56 WeakPolarHBondContact O-CG 3.31Å; A52-Q56 PolarHBondContact O-N 2.83Å
53	W	98.4	Very high	98.1	Very high	153 Å²	153	103.8 Å²	103.8	58%	0.58	51%	0.506	S	S	*	.	H	α-helix	trans	-60.8	-44.3	178	179.7	70.9	0	0	0	112.4	A49 L50 R51 I55 Q56 C57	A49-W53 VanDerWaalsContact O-CB 3.31Å; A49-W53 WeakPolarHBondContact O-CB 3.31Å; A49-W53 PolarHBondContact O-N 2.85Å; L50-W53 PolarHBondContact O-N 3.38Å; R51-W53 VanDerWaalsContact C-N 3.32Å; R51-W53 PolarHBondContact O-N 3.37Å; W53-I55 VanDerWaalsContact C-N 3.33Å; W53-I55 PolarHBondContact O-N 3.49Å; W53-Q56 PolarHBondContact O-N 3.01Å; W53-C57 VanDerWaalsContact CE2-SG 3.52Å; W53-C57 PolarHBondContact NE1-SG 2.91Å; W53-C57 WeakPolarHBondContact O-CB 3.48Å; W53-C57 PolarHBondContact O-N 3.43Å; W53-C57 PolarHBondContact O-SG 3.47Å
54	V	98.3	Very high	98.1	Very high	88 Å²	88	99.6 Å²	99.6	53%	0.533	50%	0.503	S	S	.	.	H	α-helix	trans	-58.6	-45.3	175.8	170	0	0	0	0	111.3	L50 R51 A52 C57 W58	L50-V54 WeakPolarHBondContact O-CG2 3.48Å; L50-V54 PolarHBondContact O-N 2.91Å; R51-V54 PolarHBondContact O-N 3.41Å; A52-V54 PolarHBondContact O-N 3.47Å; V54-C57 PolarHBondContact O-N 2.88Å; V54-W58 WeakPolarHBondContact O-CB 3.46Å; V54-W58 PolarHBondContact O-N 3.17Å
55	I	98.2	Very high	98.1	Very high	112 Å²	112	101.5 Å²	101.5	57%	0.574	51%	0.505	S	S	*	.	H	α-helix	trans	-63.3	-44.5	178.1	-64.5	167.9	0	0	0	110.6	R51 A52 W53 W58 W59	R51-I55 WeakPolarHBondContact O-CG1 3.29Å; R51-I55 PolarHBondContact O-N 2.94Å; A52-I55 PolarHBondContact O-N 3.37Å; W53-I55 VanDerWaalsContact C-N 3.33Å; W53-I55 PolarHBondContact O-N 3.49Å; I55-W58 PolarHBondContact O-N 2.95Å; I55-W59 WeakPolarHBondContact O-CB 3.31Å; I55-W59 PolarHBondContact O-N 3.39Å
56	Q	98.4	Very high	98.1	Very high	105 Å²	105	99.8 Å²	99.8	49%	0.491	50%	0.495	S	S	.	.	H	α-helix	trans	-62.9	-44.5	178.4	-73.1	175.4	-13	0	0	112.1	A52 W53 W59 R60	A52-Q56 VanDerWaalsContact O-CG 3.31Å; A52-Q56 WeakPolarHBondContact O-CG 3.31Å; A52-Q56 PolarHBondContact O-N 2.83Å; W53-Q56 PolarHBondContact O-N 3.01Å; Q56-W59 PolarHBondContact O-N 3.47Å; Q56-R60 WeakPolarHBondContact O-CB 3.42Å; Q56-R60 VanDerWaalsContact O-CG 3.3Å; Q56-R60 WeakPolarHBondContact O-CG 3.49Å; Q56-R60 PolarHBondContact O-N 2.93Å
57	C	98.1	Very high	98.1	Very high	50 Å²	50	100.9 Å²	100.9	34%	0.338	50%	0.5	S	S	.	.	H	α-helix	trans	-62.4	-44.8	176.3	-78	0	0	0	0	111.7	W53 V54 R60 S61	W53-C57 VanDerWaalsContact CE2-SG 3.52Å; W53-C57 PolarHBondContact NE1-SG 2.91Å; W53-C57 WeakPolarHBondContact O-CB 3.48Å; W53-C57 PolarHBondContact O-N 3.43Å; W53-C57 PolarHBondContact O-SG 3.47Å; V54-C57 PolarHBondContact O-N 2.88Å; C57-R60 PolarHBondContact O-N 3.4Å; C57-S61 WeakPolarHBondContact O-CB 3.36Å; C57-S61 PolarHBondContact O-N 3.22Å
58	W	98.3	Very high	98.1	Very high	149 Å²	149	98.9 Å²	98.9	56%	0.564	49%	0.491	S	S	*	.	H	α-helix	trans	-59.7	-47.2	175.1	174	83.5	0	0	0	111.6	V54 I55 R60 S61 M62	V54-W58 WeakPolarHBondContact O-CB 3.46Å; V54-W58 PolarHBondContact O-N 3.17Å; I55-W58 PolarHBondContact O-N 2.95Å; W58-R60 PolarHBondContact O-N 3.37Å; W58-S61 WeakPolarHBondContact O-CB 3.38Å; W58-S61 PolarHBondContact O-N 2.87Å; W58-M62 HydrophobicContact CH2-CE 4.33Å; W58-M62 HydrophobicContact CZ2-CE 3.56Å; W58-M62 PolarHBondContact O-N 2.97Å
59	W	98.3	Very high	98.1	Very high	137 Å²	137	101.2 Å²	101.2	52%	0.519	49%	0.492	S	S	.	.	H	α-helix	trans	-60.8	-46.3	178.8	-179.3	-110.8	0	0	0	112.1	I55 Q56 S61 M62 Q63	I55-W59 WeakPolarHBondContact O-CB 3.31Å; I55-W59 PolarHBondContact O-N 3.39Å; Q56-W59 PolarHBondContact O-N 3.47Å; W59-S61 VanDerWaalsContact C-N 3.31Å; W59-S61 PolarHBondContact O-N 3.42Å; W59-M62 WeakPolarHBondContact O-CB 3.4Å; W59-M62 PolarHBondContact O-N 3.46Å; W59-Q63 HydrophobicContact CD2-CG 4.32Å; W59-Q63 VanDerWaalsContact CH2-NE2 3.35Å; W59-Q63 HydrophobicContact CZ2-CG 4.31Å; W59-Q63 WeakPolarHBondContact O-CG 3.48Å; W59-Q63 PolarHBondContact O-N 3.29Å
60	R	98.2	Very high	98	Very high	177 Å²	177	107 Å²	107	67%	0.668	50%	0.501	S	S	*	.	H	α-helix	trans	-59.8	-41.7	176	-72.3	174.9	-176.2	-175.3	2.4	111.9	Q56 C57 W58 Q63 A64	Q56-R60 WeakPolarHBondContact O-CB 3.42Å; Q56-R60 VanDerWaalsContact O-CG 3.3Å; Q56-R60 WeakPolarHBondContact O-CG 3.49Å; Q56-R60 PolarHBondContact O-N 2.93Å; C57-R60 PolarHBondContact O-N 3.4Å; W58-R60 PolarHBondContact O-N 3.37Å; R60-Q63 PolarHBondContact O-N 2.93Å; R60-A64 PolarHBondContact O-N 3.22Å
61	S	97.9	Very high	98	Very high	55 Å²	55	110.6 Å²	110.6	39%	0.385	51%	0.508	S	S	.	.	H	α-helix	trans	-63.4	-42.9	175.1	-173.7	0	0	0	0	111.8	C57 W58 W59 A64 K65	C57-S61 WeakPolarHBondContact O-CB 3.36Å; C57-S61 PolarHBondContact O-N 3.22Å; W58-S61 WeakPolarHBondContact O-CB 3.38Å; W58-S61 PolarHBondContact O-N 2.87Å; W59-S61 VanDerWaalsContact C-N 3.31Å; W59-S61 PolarHBondContact O-N 3.42Å; S61-A64 PolarHBondContact O-N 2.93Å; S61-K65 WeakPolarHBondContact O-CG 3.34Å; S61-K65 PolarHBondContact O-N 3.43Å
62	M	97.9	Very high	97.9	Very high	56 Å²	56	106.9 Å²	106.9	28%	0.276	49%	0.494	S	S	.	.	H	α-helix	trans	-62.4	-45.1	176.9	-172.5	64.4	81.5	0	0	111.5	W58 W59 A64 K65 M66	W58-M62 HydrophobicContact CH2-CE 4.33Å; W58-M62 HydrophobicContact CZ2-CE 3.56Å; W58-M62 PolarHBondContact O-N 2.97Å; W59-M62 WeakPolarHBondContact O-CB 3.4Å; W59-M62 PolarHBondContact O-N 3.46Å; M62-A64 PolarHBondContact O-N 3.45Å; M62-K65 WeakPolarHBondContact O-CB 3.3Å; M62-K65 PolarHBondContact O-N 3.44Å; M62-M66 HydrophobicContact CG-CE 3.9Å; M62-M66 HydrophobicContact CG-SD 4.48Å; M62-M66 WeakPolarHBondContact O-CG 3.35Å; M62-M66 PolarHBondContact O-N 2.85Å; M62-M66 HydrophobicContact SD-CE 4.17Å
63	Q	98.1	Very high	97.9	Very high	84 Å²	84	109.5 Å²	109.5	39%	0.393	50%	0.501	S	S	.	.	H	α-helix	trans	-59.6	-45.6	176.6	-72.6	-62.6	-33.7	0	0	112	W59 R60 K65 M66 L67	W59-Q63 HydrophobicContact CD2-CG 4.32Å; W59-Q63 VanDerWaalsContact CH2-NE2 3.35Å; W59-Q63 HydrophobicContact CZ2-CG 4.31Å; W59-Q63 WeakPolarHBondContact O-CG 3.48Å; W59-Q63 PolarHBondContact O-N 3.29Å; R60-Q63 PolarHBondContact O-N 2.93Å; Q63-K65 VanDerWaalsContact C-N 3.34Å; Q63-K65 PolarHBondContact O-N 3.03Å; Q63-M66 PolarHBondContact O-N 3.03Å; Q63-L67 WeakPolarHBondContact O-CB 3.49Å; Q63-L67 PolarHBondContact O-N 2.98Å
64	A	97.8	Very high	97.8	Very high	61 Å²	61	105 Å²	105	50%	0.504	50%	0.497	S	S	.	.	H	α-helix	trans	-60.5	-42.8	175.8	0	0	0	0	0	112.1	R60 S61 M62 L67 E68	R60-A64 PolarHBondContact O-N 3.22Å; S61-A64 PolarHBondContact O-N 2.93Å; M62-A64 PolarHBondContact O-N 3.45Å; A64-L67 PolarHBondContact O-N 3.41Å; A64-E68 WeakPolarHBondContact O-CB 3.48Å; A64-E68 PolarHBondContact O-N 2.99Å
65	K	97.8	Very high	97.8	Very high	126 Å²	126	105.6 Å²	105.6	55%	0.548	50%	0.497	S	S	.	.	H	α-helix	trans	-61.7	-44.9	175.9	-73.6	173.6	-176.7	178.4	0	112.2	S61 M62 Q63 E68 Q69	S61-K65 WeakPolarHBondContact O-CG 3.34Å; S61-K65 PolarHBondContact O-N 3.43Å; M62-K65 WeakPolarHBondContact O-CB 3.3Å; M62-K65 PolarHBondContact O-N 3.44Å; Q63-K65 VanDerWaalsContact C-N 3.34Å; Q63-K65 PolarHBondContact O-N 3.03Å; K65-E68 PolarHBondContact O-N 3.42Å; K65-Q69 WeakPolarHBondContact O-CB 3.34Å; K65-Q69 WeakPolarHBondContact O-CG 3.42Å; K65-Q69 PolarHBondContact O-N 3.39Å
66	M	97.8	Very high	97.7	Very high	76 Å²	76	108.4 Å²	108.4	37%	0.374	50%	0.5	S	S	.	.	H	α-helix	trans	-63.8	-42.9	178.6	-73.7	-176.4	176.5	0	0	111.8	M62 Q63 E68 Q69 R70	M62-M66 HydrophobicContact CG-CE 3.9Å; M62-M66 HydrophobicContact CG-SD 4.48Å; M62-M66 WeakPolarHBondContact O-CG 3.35Å; M62-M66 PolarHBondContact O-N 2.85Å; M62-M66 HydrophobicContact SD-CE 4.17Å; Q63-M66 PolarHBondContact O-N 3.03Å; M66-E68 PolarHBondContact O-N 3.27Å; M66-Q69 PolarHBondContact O-N 3.48Å; M66-R70 WeakPolarHBondContact O-CG 3.39Å; M66-R70 PolarHBondContact O-N 3.46Å
67	L	97.8	Very high	97.7	Very high	123 Å²	123	108.9 Å²	108.9	64%	0.644	51%	0.505	S	S	*	.	H	α-helix	trans	-61.1	-45.9	177	-178	62.1	0	0	0	111.3	Q63 A64 Q69 R70 R71	Q63-L67 WeakPolarHBondContact O-CB 3.49Å; Q63-L67 PolarHBondContact O-N 2.98Å; A64-L67 PolarHBondContact O-N 3.41Å; L67-Q69 PolarHBondContact O-N 3.31Å; L67-R70 PolarHBondContact O-N 3.34Å; L67-R71 PolarHBondContact O-N 3.49Å
68	E	97.7	Very high	97.6	Very high	77 Å²	77	112.8 Å²	112.8	36%	0.36	51%	0.514	S	S	.	.	H	α-helix	trans	-66.6	-37.7	179.3	-175	57	-148.7	0	0	112	A64 K65 M66 R71 R72	A64-E68 WeakPolarHBondContact O-CB 3.48Å; A64-E68 PolarHBondContact O-N 2.99Å; K65-E68 PolarHBondContact O-N 3.42Å; M66-E68 PolarHBondContact O-N 3.27Å; E68-R71 PolarHBondContact O-N 2.95Å; E68-R72 WeakPolarHBondContact O-CB 3.36Å; E68-R72 WeakPolarHBondContact O-CG 3.37Å; E68-R72 PolarHBondContact O-N 3.5Å; E68-R72 IonicContact OE1-NH1 3.77Å
69	Q	97.5	Very high	97.4	Very high	109 Å²	109	108.5 Å²	108.5	51%	0.509	50%	0.504	S	S	.	.	H	α-helix	trans	-61.1	-46	171.9	-77.4	179.5	-22.9	0	0	112.1	K65 M66 L67 R71 R72 L73	K65-Q69 WeakPolarHBondContact O-CB 3.34Å; K65-Q69 WeakPolarHBondContact O-CG 3.42Å; K65-Q69 PolarHBondContact O-N 3.39Å; M66-Q69 PolarHBondContact O-N 3.48Å; L67-Q69 PolarHBondContact O-N 3.31Å; Q69-R71 PolarHBondContact O-N 2.95Å; Q69-R72 PolarHBondContact O-N 2.98Å; Q69-L73 WeakPolarHBondContact O-CG 3.47Å; Q69-L73 PolarHBondContact O-N 3.36Å
70	R	97.4	Very high	97.3	Very high	180 Å²	180	106 Å²	106	68%	0.679	51%	0.506	S	S	*	.	H	α-helix	trans	-60.5	-44.8	176.2	-73	175.8	-178.2	-179.4	0.9	111.6	M66 L67 R72 L73 A74	M66-R70 WeakPolarHBondContact O-CG 3.39Å; M66-R70 PolarHBondContact O-N 3.46Å; L67-R70 PolarHBondContact O-N 3.34Å; R70-R72 PolarHBondContact O-N 3.41Å; R70-L73 PolarHBondContact O-N 2.95Å; R70-A74 PolarHBondContact O-N 2.96Å
71	R	97.1	Very high	97.2	Very high	165 Å²	165	103.6 Å²	103.6	62%	0.623	50%	0.503	S	S	*	.	H	α-helix	trans	-59.1	-47.3	176.8	-172.1	178.7	-176.1	172.7	1.9	111.7	L67 E68 Q69 L73 A74 L75	L67-R71 PolarHBondContact O-N 3.49Å; E68-R71 PolarHBondContact O-N 2.95Å; Q69-R71 PolarHBondContact O-N 2.95Å; R71-L73 PolarHBondContact O-N 3.49Å; R71-A74 PolarHBondContact O-N 3.21Å; R71-L75 HydrophobicContact CG-CD1 4.34Å; R71-L75 WeakPolarHBondContact O-CG 3.5Å; R71-L75 PolarHBondContact O-N 2.94Å
72	R	97.5	Very high	97.2	Very high	114 Å²	114	105.3 Å²	105.3	43%	0.43	51%	0.505	S	S	.	.	H	α-helix	trans	-63	-40.5	177.9	-75	-174	-68.7	-125.1	1	112.8	E68 Q69 R70 L75 R76	E68-R72 WeakPolarHBondContact O-CB 3.36Å; E68-R72 WeakPolarHBondContact O-CG 3.37Å; E68-R72 PolarHBondContact O-N 3.5Å; E68-R72 IonicContact OE1-NH1 3.77Å; Q69-R72 PolarHBondContact O-N 2.98Å; R70-R72 PolarHBondContact O-N 3.41Å; R72-L75 PolarHBondContact O-N 3.49Å; R72-R76 WeakPolarHBondContact O-CG 3.4Å; R72-R76 PolarHBondContact O-N 3.37Å
73	L	97.6	Very high	97.1	Very high	102 Å²	102	112 Å²	112	53%	0.534	53%	0.527	S	S	.	.	H	α-helix	trans	-63.5	-46.3	176.1	-73.6	169.4	0	0	0	111.3	Q69 R70 R71 L75 R76 L77	Q69-L73 WeakPolarHBondContact O-CG 3.47Å; Q69-L73 PolarHBondContact O-N 3.36Å; R70-L73 PolarHBondContact O-N 2.95Å; R71-L73 PolarHBondContact O-N 3.49Å; L73-L75 VanDerWaalsContact C-N 3.34Å; L73-L75 PolarHBondContact O-N 2.95Å; L73-R76 PolarHBondContact O-N 3.34Å; L73-L77 WeakPolarHBondContact O-CG 3.33Å; L73-L77 PolarHBondContact O-N 3.02Å
74	A	96.9	Very high	97.1	Very high	60 Å²	60	110.4 Å²	110.4	50%	0.496	53%	0.529	S	S	.	.	H	α-helix	trans	-58	-45.4	176.7	0	0	0	0	0	111.9	R70 R71 R76 L77 Y78	R70-A74 PolarHBondContact O-N 2.96Å; R71-A74 PolarHBondContact O-N 3.21Å; A74-R76 PolarHBondContact O-N 3.41Å; A74-L77 PolarHBondContact O-N 2.92Å; A74-Y78 WeakPolarHBondContact O-CB 3.37Å; A74-Y78 PolarHBondContact O-N 3.48Å
75	L	97.3	Very high	97.1	Very high	99 Å²	99	111.2 Å²	111.2	52%	0.518	53%	0.527	S	S	.	.	H	α-helix	trans	-63.2	-40.5	176.6	-72	172.2	0	0	0	112.8	R71 R72 L73 T79	R71-L75 HydrophobicContact CG-CD1 4.34Å; R71-L75 WeakPolarHBondContact O-CG 3.5Å; R71-L75 PolarHBondContact O-N 2.94Å; R72-L75 PolarHBondContact O-N 3.49Å; L73-L75 VanDerWaalsContact C-N 3.34Å; L73-L75 PolarHBondContact O-N 2.95Å; L75-T79 WeakPolarHBondContact O-CB 3.3Å; L75-T79 WeakPolarHBondContact O-CG2 3.39Å; L75-T79 PolarHBondContact O-N 3.15Å; L75-T79 PolarHBondContact O-OG1 2.87Å
76	R	97.5	Very high	97.1	Very high	172 Å²	172	109.3 Å²	109.3	65%	0.649	53%	0.526	S	S	*	.	H	α-helix	trans	-64.7	-42.8	176.5	-76.9	178.1	-180	179.7	-0.7	112.1	R72 L73 A74 T79 C80	R72-R76 WeakPolarHBondContact O-CG 3.4Å; R72-R76 PolarHBondContact O-N 3.37Å; L73-R76 PolarHBondContact O-N 3.34Å; A74-R76 PolarHBondContact O-N 3.41Å; R76-T79 WeakPolarHBondContact CA-OG1 3.38Å; R76-T79 PolarHBondContact O-OG1 3.23Å; R76-C80 WeakPolarHBondContact O-CB 3.48Å; R76-C80 PolarHBondContact O-N 2.97Å; R76-C80 PolarHBondContact O-SG 2.94Å
77	L	96.8	Very high	97.1	Very high	114 Å²	114	112.8 Å²	112.8	60%	0.597	54%	0.539	S	S	*	.	H	α-helix	trans	-64.2	-46.4	177.8	-70.5	173.3	0	0	0	111	L73 A74 C80 Q81	L73-L77 WeakPolarHBondContact O-CG 3.33Å; L73-L77 PolarHBondContact O-N 3.02Å; A74-L77 PolarHBondContact O-N 2.92Å; L77-C80 PolarHBondContact O-N 3.38Å; L77-Q81 WeakPolarHBondContact O-CG 3.43Å; L77-Q81 PolarHBondContact O-N 3.47Å
78	Y	95.6	Very high	97.1	Very high	133 Å²	133	111.4 Å²	111.4	52%	0.522	54%	0.535	S	S	.	.	H	α-helix	trans	-58.2	-50.9	177.2	-178.3	-101.1	0	0	0	111.7	A74 C80 Q81 E82	A74-Y78 WeakPolarHBondContact O-CB 3.37Å; A74-Y78 PolarHBondContact O-N 3.48Å; Y78-C80 PolarHBondContact O-N 3.2Å; Y78-Q81 WeakPolarHBondContact O-CB 3.35Å; Y78-Q81 PolarHBondContact O-N 2.88Å; Y78-Q81 VanDerWaalsContact O-N 3.15Å; Y78-E82 HydrophobicContact CD1-CG 4.29Å; Y78-E82 HydrophobicContact CE1-CG 3.91Å; Y78-E82 WeakPolarHBondContact CE1-OE2 3.33Å; Y78-E82 HydrophobicContact CE2-CG 4.47Å; Y78-E82 PolarHBondContact O-N 3.42Å; Y78-E82 PolarHBondContact OH-OE1 2.95Å
79	T	96.1	Very high	97.1	Very high	58 Å²	58	111.9 Å²	111.9	36%	0.356	54%	0.537	S	S	.	.	H	α-helix	trans	-61.8	-43.6	178.5	50.1	0	0	0	0	111.7	L75 R76 Q81 E82 W83	L75-T79 WeakPolarHBondContact O-CB 3.3Å; L75-T79 WeakPolarHBondContact O-CG2 3.39Å; L75-T79 PolarHBondContact O-N 3.15Å; L75-T79 PolarHBondContact O-OG1 2.87Å; R76-T79 WeakPolarHBondContact CA-OG1 3.38Å; R76-T79 PolarHBondContact O-OG1 3.23Å; T79-Q81 VanDerWaalsContact C-N 3.28Å; T79-Q81 PolarHBondContact O-N 3.34Å; T79-E82 PolarHBondContact O-N 3.33Å; T79-W83 PolarHBondContact O-N 2.98Å
80	C	96.1	Very high	97.1	Very high	84 Å²	84	109 Å²	109	57%	0.568	53%	0.532	S	S	*	.	H	α-helix	trans	-58.2	-40.7	175.5	-71.8	0	0	0	0	112.3	R76 L77 Y78 A84	R76-C80 WeakPolarHBondContact O-CB 3.48Å; R76-C80 PolarHBondContact O-N 2.97Å; R76-C80 PolarHBondContact O-SG 2.94Å; L77-C80 PolarHBondContact O-N 3.38Å; Y78-C80 PolarHBondContact O-N 3.2Å; C80-A84 WeakPolarHBondContact O-CB 3.31Å; C80-A84 PolarHBondContact O-N 2.9Å
81	Q	96.1	Very high	97.2	Very high	128 Å²	128	105.3 Å²	105.3	60%	0.598	52%	0.523	S	S	*	.	H	α-helix	trans	-64.2	-46.7	175.8	-73.8	177.8	-13.5	0	0	111.5	L77 Y78 T79 W83 A84 V85	L77-Q81 WeakPolarHBondContact O-CG 3.43Å; L77-Q81 PolarHBondContact O-N 3.47Å; Y78-Q81 WeakPolarHBondContact O-CB 3.35Å; Y78-Q81 PolarHBondContact O-N 2.88Å; Y78-Q81 VanDerWaalsContact O-N 3.15Å; T79-Q81 VanDerWaalsContact C-N 3.28Å; T79-Q81 PolarHBondContact O-N 3.34Å; Q81-W83 PolarHBondContact O-N 3.15Å; Q81-A84 PolarHBondContact O-N 2.95Å; Q81-V85 VanDerWaalsContact O-CG2 3.3Å; Q81-V85 WeakPolarHBondContact O-CG2 3.43Å; Q81-V85 PolarHBondContact O-N 2.96Å
82	E	96.9	Very high	97.2	Very high	90 Å²	90	100.6 Å²	100.6	42%	0.421	51%	0.512	S	S	.	.	H	α-helix	trans	-59.2	-47.6	176.8	-70.5	-165.8	114.3	0	0	111.9	Y78 T79 A84 V85 V86	Y78-E82 HydrophobicContact CD1-CG 4.29Å; Y78-E82 HydrophobicContact CE1-CG 3.91Å; Y78-E82 WeakPolarHBondContact CE1-OE2 3.33Å; Y78-E82 HydrophobicContact CE2-CG 4.47Å; Y78-E82 PolarHBondContact O-N 3.42Å; Y78-E82 PolarHBondContact OH-OE1 2.95Å; T79-E82 PolarHBondContact O-N 3.33Å; E82-A84 VanDerWaalsContact C-N 3.3Å; E82-A84 PolarHBondContact O-N 3.36Å; E82-V85 PolarHBondContact O-N 2.92Å; E82-V86 WeakPolarHBondContact O-CG2 3.35Å; E82-V86 PolarHBondContact O-N 3.21Å
83	W	96.9	Very high	97.3	Very high	196 Å²	196	102.6 Å²	102.6	74%	0.742	52%	0.52	S	S	*	.	H	α-helix	trans	-58.5	-42.7	176.4	-81.6	106.3	0	0	0	112	T79 Q81 K87	T79-W83 PolarHBondContact O-N 2.98Å; Q81-W83 PolarHBondContact O-N 3.15Å; W83-K87 VanDerWaalsContact O-CB 3.31Å; W83-K87 WeakPolarHBondContact O-CB 3.31Å; W83-K87 PolarHBondContact O-N 3.26Å
84	A	96.6	Very high	97.3	Very high	52 Å²	52	102.5 Å²	102.5	43%	0.43	52%	0.518	S	S	.	.	H	α-helix	trans	-63	-45.8	176.3	0	0	0	0	0	111.6	C80 Q81 E82 K87 V88	C80-A84 WeakPolarHBondContact O-CB 3.31Å; C80-A84 PolarHBondContact O-N 2.9Å; Q81-A84 PolarHBondContact O-N 2.95Å; E82-A84 VanDerWaalsContact C-N 3.3Å; E82-A84 PolarHBondContact O-N 3.36Å; A84-K87 PolarHBondContact O-N 2.92Å; A84-V88 WeakPolarHBondContact O-CG2 3.13Å; A84-V88 PolarHBondContact O-N 3Å
85	V	97.6	Very high	97.4	Very high	77 Å²	77	106.7 Å²	106.7	47%	0.467	52%	0.521	S	S	.	.	H	α-helix	trans	-61	-49.5	178.1	170.4	0	0	0	0	110.8	Q81 E82 K87 V88 Q89	Q81-V85 VanDerWaalsContact O-CG2 3.3Å; Q81-V85 WeakPolarHBondContact O-CG2 3.43Å; Q81-V85 PolarHBondContact O-N 2.96Å; E82-V85 PolarHBondContact O-N 2.92Å; V85-K87 VanDerWaalsContact C-N 3.29Å; V85-K87 PolarHBondContact O-N 3.04Å; V85-V88 PolarHBondContact O-N 3.36Å; V85-Q89 HydrophobicContact CG1-CG 4.21Å; V85-Q89 WeakPolarHBondContact O-CB 3.37Å; V85-Q89 VanDerWaalsContact O-CG 3.26Å; V85-Q89 WeakPolarHBondContact O-CG 3.26Å; V85-Q89 PolarHBondContact O-N 2.85Å
86	V	97.9	Very high	97.5	Very high	87 Å²	87	105.6 Å²	105.6	53%	0.527	51%	0.513	S	S	.	.	H	α-helix	trans	-59.2	-43.1	178.7	171.2	0	0	0	0	110.8	E82 Q89 A90	E82-V86 WeakPolarHBondContact O-CG2 3.35Å; E82-V86 PolarHBondContact O-N 3.21Å; V86-Q89 PolarHBondContact O-N 3.39Å; V86-A90 WeakPolarHBondContact O-CB 3.42Å; V86-A90 PolarHBondContact O-N 3.3Å
87	K	97.6	Very high	97.5	Very high	149 Å²	149	100.2 Å²	100.2	65%	0.648	51%	0.506	S	S	*	.	H	α-helix	trans	-62.6	-47.9	177.9	-170.6	172.6	-175.6	177.3	0	111.6	W83 A84 V85 A90 Q91	W83-K87 VanDerWaalsContact O-CB 3.31Å; W83-K87 WeakPolarHBondContact O-CB 3.31Å; W83-K87 PolarHBondContact O-N 3.26Å; A84-K87 PolarHBondContact O-N 2.92Å; V85-K87 VanDerWaalsContact C-N 3.29Å; V85-K87 PolarHBondContact O-N 3.04Å; K87-A90 PolarHBondContact O-N 3.35Å; K87-Q91 VanDerWaalsContact O-CG 3.31Å; K87-Q91 WeakPolarHBondContact O-CG 3.4Å; K87-Q91 PolarHBondContact O-N 3.33Å
88	V	98.1	Very high	97.6	Very high	93 Å²	93	102.7 Å²	102.7	56%	0.564	51%	0.507	S	S	*	.	H	α-helix	trans	-61.3	-46.9	177.4	170.8	0	0	0	0	110.6	A84 V85 A90 Q91 V92	A84-V88 WeakPolarHBondContact O-CG2 3.13Å; A84-V88 PolarHBondContact O-N 3Å; V85-V88 PolarHBondContact O-N 3.36Å; V88-A90 VanDerWaalsContact C-N 3.33Å; V88-A90 PolarHBondContact O-N 2.86Å; V88-Q91 PolarHBondContact O-N 3.2Å; V88-V92 HydrophobicContact CG1-CG2 4.39Å; V88-V92 WeakPolarHBondContact O-CG2 3.35Å; V88-V92 PolarHBondContact O-N 2.89Å
89	Q	98.4	Very high	97.7	Very high	87 Å²	87	102.5 Å²	102.5	41%	0.407	51%	0.505	S	S	.	.	H	α-helix	trans	-60.5	-42.1	178.4	-71.8	-178.9	-3.4	0	0	112.3	V85 V86 V92 R93	V85-Q89 HydrophobicContact CG1-CG 4.21Å; V85-Q89 WeakPolarHBondContact O-CB 3.37Å; V85-Q89 VanDerWaalsContact O-CG 3.26Å; V85-Q89 WeakPolarHBondContact O-CG 3.26Å; V85-Q89 PolarHBondContact O-N 2.85Å; V86-Q89 PolarHBondContact O-N 3.39Å; Q89-V92 PolarHBondContact O-N 2.86Å; Q89-R93 WeakPolarHBondContact O-CG 3.39Å; Q89-R93 PolarHBondContact O-N 3.33Å
90	A	97.8	Very high	97.8	Very high	49 Å²	49	107.8 Å²	107.8	41%	0.405	52%	0.519	S	S	.	.	H	α-helix	trans	-61.9	-43.1	176.5	0	0	0	0	0	111.7	V86 K87 V88 R93 M94	V86-A90 WeakPolarHBondContact O-CB 3.42Å; V86-A90 PolarHBondContact O-N 3.3Å; K87-A90 PolarHBondContact O-N 3.35Å; V88-A90 VanDerWaalsContact C-N 3.33Å; V88-A90 PolarHBondContact O-N 2.86Å; A90-R93 PolarHBondContact O-N 3.43Å; A90-M94 WeakPolarHBondContact O-CB 3.43Å; A90-M94 PolarHBondContact O-N 3.46Å
91	Q	98.3	Very high	97.9	Very high	103 Å²	103	110 Å²	110	48%	0.481	52%	0.519	S	S	.	.	H	α-helix	trans	-62.7	-44.1	175.9	-68.7	-60.6	-46.8	0	0	111.9	K87 V88 R93 M94 W95	K87-Q91 VanDerWaalsContact O-CG 3.31Å; K87-Q91 WeakPolarHBondContact O-CG 3.4Å; K87-Q91 PolarHBondContact O-N 3.33Å; V88-Q91 PolarHBondContact O-N 3.2Å; Q91-R93 PolarHBondContact O-N 3.37Å; Q91-M94 PolarHBondContact O-N 2.91Å; Q91-M94 VanDerWaalsContact OE1-CE 3.28Å; Q91-W95 WeakPolarHBondContact O-CB 3.35Å; Q91-W95 PolarHBondContact O-N 3.5Å
92	V	98.4	Very high	98	Very high	66 Å²	66	107 Å²	107	40%	0.4	51%	0.507	S	S	.	.	H	α-helix	trans	-61.3	-46.3	177.1	170.9	0	0	0	0	110.9	V88 Q89 M94 W95 Q96	V88-V92 HydrophobicContact CG1-CG2 4.39Å; V88-V92 WeakPolarHBondContact O-CG2 3.35Å; V88-V92 PolarHBondContact O-N 2.89Å; Q89-V92 PolarHBondContact O-N 2.86Å; V92-M94 PolarHBondContact O-N 3.32Å; V92-W95 PolarHBondContact O-N 3.39Å; V92-Q96 HydrophobicContact CG1-CG 4.47Å; V92-Q96 VanDerWaalsContact O-CG 3.31Å; V92-Q96 WeakPolarHBondContact O-CG 3.35Å; V92-Q96 PolarHBondContact O-N 3.42Å
93	R	98.3	Very high	98.1	Very high	156 Å²	156	107.6 Å²	107.6	59%	0.589	51%	0.509	S	S	*	.	H	α-helix	trans	-60.4	-45	177.2	-72.3	-179.6	-175.4	108	2.3	111.7	Q89 A90 Q91 Q96 A97	Q89-R93 WeakPolarHBondContact O-CG 3.39Å; Q89-R93 PolarHBondContact O-N 3.33Å; A90-R93 PolarHBondContact O-N 3.43Å; Q91-R93 PolarHBondContact O-N 3.37Å; R93-Q96 PolarHBondContact O-N 3.5Å; R93-A97 PolarHBondContact O-N 2.95Å
94	M	98.5	Very high	98.1	Very high	100 Å²	100	101.2 Å²	101.2	49%	0.493	50%	0.499	S	S	.	.	H	α-helix	trans	-62.1	-45.5	177	178.7	-95.9	-77.6	0	0	111.8	A90 Q91 V92 Q96 A97 R98	A90-M94 WeakPolarHBondContact O-CB 3.43Å; A90-M94 PolarHBondContact O-N 3.46Å; Q91-M94 PolarHBondContact O-N 2.91Å; Q91-M94 VanDerWaalsContact OE1-CE 3.28Å; V92-M94 PolarHBondContact O-N 3.32Å; M94-Q96 PolarHBondContact O-N 3.33Å; M94-A97 PolarHBondContact O-N 3.47Å; M94-R98 WeakPolarHBondContact O-CB 3.31Å; M94-R98 PolarHBondContact O-N 2.96Å
95	W	98.4	Very high	98.2	Very high	147 Å²	147	105.7 Å²	105.7	56%	0.557	50%	0.504	S	S	*	.	H	α-helix	trans	-60.3	-44.9	177.2	174.8	83.9	0	0	0	112.1	Q91 V92 A97 R98 R99	Q91-W95 WeakPolarHBondContact O-CB 3.35Å; Q91-W95 PolarHBondContact O-N 3.5Å; V92-W95 PolarHBondContact O-N 3.39Å; W95-A97 PolarHBondContact O-N 2.9Å; W95-R98 PolarHBondContact O-N 2.9Å; W95-R99 WeakPolarHBondContact O-CB 3.36Å; W95-R99 PolarHBondContact O-N 3.43Å
96	Q	98.5	Very high	98.2	Very high	77 Å²	77	108.3 Å²	108.3	36%	0.36	51%	0.512	S	S	.	.	H	α-helix	trans	-60.8	-46.5	177.1	-71.9	176.7	6.3	0	0	111.7	V92 R93 M94 R99 R100	V92-Q96 HydrophobicContact CG1-CG 4.47Å; V92-Q96 VanDerWaalsContact O-CG 3.31Å; V92-Q96 WeakPolarHBondContact O-CG 3.35Å; V92-Q96 PolarHBondContact O-N 3.42Å; R93-Q96 PolarHBondContact O-N 3.5Å; M94-Q96 PolarHBondContact O-N 3.33Å; Q96-R99 PolarHBondContact O-N 2.93Å; Q96-R100 WeakPolarHBondContact O-CG 3.36Å; Q96-R100 PolarHBondContact O-N 3.33Å
97	A	98.3	Very high	98.2	Very high	59 Å²	59	106.5 Å²	106.5	49%	0.488	51%	0.506	S	S	.	.	H	α-helix	trans	-61.3	-46.9	178	0	0	0	0	0	111.5	R93 M94 W95 R99 R100 F101	R93-A97 PolarHBondContact O-N 2.95Å; M94-A97 PolarHBondContact O-N 3.47Å; W95-A97 PolarHBondContact O-N 2.9Å; A97-R99 VanDerWaalsContact C-N 3.34Å; A97-R99 PolarHBondContact O-N 3.5Å; A97-R100 PolarHBondContact O-N 3.4Å; A97-F101 PolarHBondContact O-N 2.95Å
98	R	98.1	Very high	98.2	Very high	165 Å²	165	101.5 Å²	101.5	62%	0.623	49%	0.492	S	S	*	.	H	α-helix	trans	-60.3	-43.5	177.4	-174.1	177.7	-177.4	-143.3	0.4	111.7	M94 W95 F101 L102	M94-R98 WeakPolarHBondContact O-CB 3.31Å; M94-R98 PolarHBondContact O-N 2.96Å; W95-R98 PolarHBondContact O-N 2.9Å; R98-F101 PolarHBondContact O-N 3.32Å; R98-L102 HydrophobicContact CG-CD1 4.07Å; R98-L102 HydrophobicContact CG-CG 4.42Å; R98-L102 WeakPolarHBondContact O-CB 3.5Å; R98-L102 VanDerWaalsContact O-CG 3.31Å; R98-L102 WeakPolarHBondContact O-CG 3.32Å; R98-L102 PolarHBondContact O-N 3.32Å
99	R	98.3	Very high	98.2	Very high	130 Å²	130	100.2 Å²	100.2	49%	0.491	49%	0.487	S	S	.	.	H	α-helix	trans	-60.6	-47.5	178.3	-177.6	176.5	174.5	-140.5	-0.8	111.4	W95 Q96 A97 F101 L102 Q103	W95-R99 WeakPolarHBondContact O-CB 3.36Å; W95-R99 PolarHBondContact O-N 3.43Å; Q96-R99 PolarHBondContact O-N 2.93Å; A97-R99 VanDerWaalsContact C-N 3.34Å; A97-R99 PolarHBondContact O-N 3.5Å; R99-F101 PolarHBondContact O-N 2.85Å; R99-L102 PolarHBondContact O-N 2.99Å; R99-Q103 VanDerWaalsContact O-CG 3.31Å; R99-Q103 WeakPolarHBondContact O-CG 3.31Å; R99-Q103 PolarHBondContact O-N 2.99Å
100	R	98.3	Very high	98.2	Very high	168 Å²	168	100.9 Å²	100.9	63%	0.634	49%	0.492	S	S	*	.	H	α-helix	trans	-60.3	-45	177.3	-69.9	176.3	-170.1	157	4	111.7	Q96 A97 L102 Q103 A104	Q96-R100 WeakPolarHBondContact O-CG 3.36Å; Q96-R100 PolarHBondContact O-N 3.33Å; A97-R100 PolarHBondContact O-N 3.4Å; R100-L102 PolarHBondContact O-N 2.99Å; R100-Q103 PolarHBondContact O-N 3.48Å; R100-A104 PolarHBondContact O-N 3.45Å
101	F	98.3	Very high	98.1	Very high	130 Å²	130	104.2 Å²	104.2	57%	0.57	50%	0.502	S	S	*	.	H	α-helix	trans	-59.9	-47.3	176.9	172.3	-101.2	0	0	0	112.1	A97 R98 R99 Q103 A104 R105	A97-F101 PolarHBondContact O-N 2.95Å; R98-F101 PolarHBondContact O-N 3.32Å; R99-F101 PolarHBondContact O-N 2.85Å; F101-Q103 VanDerWaalsContact C-N 3.33Å; F101-Q103 PolarHBondContact O-N 3.32Å; F101-A104 PolarHBondContact O-N 3.36Å; F101-R105 WeakPolarHBondContact O-CB 3.31Å; F101-R105 PolarHBondContact O-N 3.39Å
102	L	98.4	Very high	98	Very high	67 Å²	67	104.8 Å²	104.8	35%	0.351	51%	0.505	S	S	.	.	H	α-helix	trans	-62.9	-40.4	179.3	-71.5	174.3	0	0	0	112	R98 R99 R100 R105 Q106	R98-L102 HydrophobicContact CG-CD1 4.07Å; R98-L102 HydrophobicContact CG-CG 4.42Å; R98-L102 WeakPolarHBondContact O-CB 3.5Å; R98-L102 VanDerWaalsContact O-CG 3.31Å; R98-L102 WeakPolarHBondContact O-CG 3.32Å; R98-L102 PolarHBondContact O-N 3.32Å; R99-L102 PolarHBondContact O-N 2.99Å; R100-L102 PolarHBondContact O-N 2.99Å; L102-R105 PolarHBondContact O-N 3.36Å; L102-Q106 WeakPolarHBondContact O-CB 3.35Å; L102-Q106 PolarHBondContact O-N 3.11Å
103	Q	98.3	Very high	97.9	Very high	101 Å²	101	105 Å²	105	47%	0.472	51%	0.509	S	S	.	.	H	α-helix	trans	-61.4	-48.9	175	-73.9	174.1	-30.9	0	0	111.7	R99 R100 F101 R105 Q106 A107	R99-Q103 VanDerWaalsContact O-CG 3.31Å; R99-Q103 WeakPolarHBondContact O-CG 3.31Å; R99-Q103 PolarHBondContact O-N 2.99Å; R100-Q103 PolarHBondContact O-N 3.48Å; F101-Q103 VanDerWaalsContact C-N 3.33Å; F101-Q103 PolarHBondContact O-N 3.32Å; Q103-R105 VanDerWaalsContact C-N 3.35Å; Q103-R105 PolarHBondContact O-N 3.06Å; Q103-Q106 PolarHBondContact O-N 2.84Å; Q103-A107 PolarHBondContact O-N 2.98Å
104	A	98.1	Very high	97.7	Very high	63 Å²	63	103.6 Å²	103.6	52%	0.521	51%	0.509	S	S	.	.	H	α-helix	trans	-62.1	-42.3	177.7	0	0	0	0	0	111.8	R100 F101 A107 A108	R100-A104 PolarHBondContact O-N 3.45Å; F101-A104 PolarHBondContact O-N 3.36Å; A104-A107 PolarHBondContact O-N 2.84Å; A104-A108 WeakPolarHBondContact O-CB 3.46Å; A104-A108 PolarHBondContact O-N 3.47Å
105	R	98.1	Very high	97.5	Very high	145 Å²	145	106.7 Å²	106.7	55%	0.547	52%	0.515	S	S	.	.	H	α-helix	trans	-62.2	-44.3	176.8	-168	-176.7	85.7	172.1	7	111.7	F101 L102 Q103 A108 C109	F101-R105 WeakPolarHBondContact O-CB 3.31Å; F101-R105 PolarHBondContact O-N 3.39Å; L102-R105 PolarHBondContact O-N 3.36Å; Q103-R105 VanDerWaalsContact C-N 3.35Å; Q103-R105 PolarHBondContact O-N 3.06Å; R105-A108 PolarHBondContact O-N 3.04Å; R105-C109 WeakPolarHBondContact O-CB 3.21Å; R105-C109 PolarHBondContact O-N 2.89Å
106	Q	98.1	Very high	97.2	Very high	132 Å²	132	108.2 Å²	108.2	62%	0.617	52%	0.521	S	S	*	.	H	α-helix	trans	-63	-45.7	178.2	-175.1	170.1	9.1	0	0	111.1	L102 Q103 A108 C109 I110	L102-Q106 WeakPolarHBondContact O-CB 3.35Å; L102-Q106 PolarHBondContact O-N 3.11Å; Q103-Q106 PolarHBondContact O-N 2.84Å; Q106-A108 PolarHBondContact O-N 3.39Å; Q106-C109 PolarHBondContact O-N 3.33Å; Q106-I110 HydrophobicContact CG-CD1 4.16Å; Q106-I110 WeakPolarHBondContact O-CG1 3.34Å; Q106-I110 PolarHBondContact O-N 3.36Å
107	A	97.8	Very high	96.9	Very high	50 Å²	50	112.3 Å²	112.3	41%	0.413	53%	0.533	S	S	.	.	H	α-helix	trans	-59	-46.3	174.9	0	0	0	0	0	111.8	Q103 A104 C109 I110 I111	Q103-A107 PolarHBondContact O-N 2.98Å; A104-A107 PolarHBondContact O-N 2.84Å; A107-C109 PolarHBondContact O-N 3.45Å; A107-I110 PolarHBondContact O-N 3.46Å; A107-I111 WeakPolarHBondContact O-CG1 3.4Å; A107-I111 PolarHBondContact O-N 2.98Å
108	A	98	Very high	96.4	Very high	43 Å²	43	114.5 Å²	114.5	36%	0.355	53%	0.533	S	S	.	.	H	α-helix	trans	-60.9	-44.4	177.1	0	0	0	0	0	112.3	A104 R105 Q106 I110 I111 Q112	A104-A108 WeakPolarHBondContact O-CB 3.46Å; A104-A108 PolarHBondContact O-N 3.47Å; R105-A108 PolarHBondContact O-N 3.04Å; Q106-A108 PolarHBondContact O-N 3.39Å; A108-I110 PolarHBondContact O-N 3.34Å; A108-I111 PolarHBondContact O-N 3.48Å; A108-Q112 WeakPolarHBondContact O-CB 3.47Å; A108-Q112 WeakPolarHBondContact O-CG 3.5Å; A108-Q112 PolarHBondContact O-N 3.32Å
109	C	97.8	Very high	95.8	Very high	66 Å²	66	107.6 Å²	107.6	45%	0.446	51%	0.511	S	S	.	.	H	α-helix	trans	-59.8	-43.6	176.6	-82.2	0	0	0	0	112.2	R105 Q106 A107 Q112 S113	R105-C109 WeakPolarHBondContact O-CB 3.21Å; R105-C109 PolarHBondContact O-N 2.89Å; Q106-C109 PolarHBondContact O-N 3.33Å; A107-C109 PolarHBondContact O-N 3.45Å; C109-Q112 PolarHBondContact O-N 2.86Å; C109-S113 WeakPolarHBondContact O-CB 3.38Å; C109-S113 PolarHBondContact O-N 3.07Å; C109-S113 PolarHBondContact O-OG 3.48Å; C109-S113 VanDerWaalsContact O-OG 3.11Å
110	I	97.3	Very high	95	Very high	102 Å²	102	104.9 Å²	104.9	52%	0.523	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-46.7	178.4	-68	165.4	0	0	0	110.6	Q106 A107 A108 Q112 S113 H114	Q106-I110 HydrophobicContact CG-CD1 4.16Å; Q106-I110 WeakPolarHBondContact O-CG1 3.34Å; Q106-I110 PolarHBondContact O-N 3.36Å; A107-I110 PolarHBondContact O-N 3.46Å; A108-I110 PolarHBondContact O-N 3.34Å; I110-Q112 PolarHBondContact O-N 3.34Å; I110-S113 WeakPolarHBondContact CA-OG 3.42Å; I110-S113 PolarHBondContact O-N 3.3Å; I110-S113 PolarHBondContact O-OG 2.9Å; I110-H114 WeakPolarHBondContact O-CB 3.35Å; I110-H114 PolarHBondContact O-N 3.39Å
111	I	96.6	Very high	93.9	Very high	119 Å²	119	103 Å²	103	61%	0.61	51%	0.51	S	S	*	.	H	α-helix	trans	-61.6	-46.9	177.8	-66	166.4	0	0	0	110.1	A107 A108 S113 H114 W115	A107-I111 WeakPolarHBondContact O-CG1 3.4Å; A107-I111 PolarHBondContact O-N 2.98Å; A108-I111 PolarHBondContact O-N 3.48Å; I111-S113 PolarHBondContact O-N 3.06Å; I111-H114 PolarHBondContact O-N 2.68Å; I111-W115 WeakPolarHBondContact O-CB 3.49Å; I111-W115 PolarHBondContact O-N 3.39Å
112	Q	96.6	Very high	92.4	Very high	115 Å²	115	101.5 Å²	101.5	54%	0.537	51%	0.512	S	S	.	.	H	α-helix	trans	-62.4	-41.6	179.5	-74.4	174.1	-18.6	0	0	112.1	A108 C109 I110 R116	A108-Q112 WeakPolarHBondContact O-CB 3.47Å; A108-Q112 WeakPolarHBondContact O-CG 3.5Å; A108-Q112 PolarHBondContact O-N 3.32Å; C109-Q112 PolarHBondContact O-N 2.86Å; I110-Q112 PolarHBondContact O-N 3.34Å; Q112-R116 WeakPolarHBondContact O-CB 3.37Å; Q112-R116 VanDerWaalsContact O-CG 3.24Å; Q112-R116 WeakPolarHBondContact O-CG 3.26Å; Q112-R116 PolarHBondContact O-N 3.37Å
113	S	95.6	Very high	90.7	Very high	70 Å²	70	107.8 Å²	107.8	49%	0.49	53%	0.531	S	S	.	.	H	α-helix	trans	-66	-43	177.3	55.7	0	0	0	0	111.6	C109 I110 I111 R116 W117	C109-S113 WeakPolarHBondContact O-CB 3.38Å; C109-S113 PolarHBondContact O-N 3.07Å; C109-S113 PolarHBondContact O-OG 3.48Å; C109-S113 VanDerWaalsContact O-OG 3.11Å; I110-S113 WeakPolarHBondContact CA-OG 3.42Å; I110-S113 PolarHBondContact O-N 3.3Å; I110-S113 PolarHBondContact O-OG 2.9Å; I111-S113 PolarHBondContact O-N 3.06Å; S113-R116 PolarHBondContact O-N 2.94Å; S113-W117 WeakPolarHBondContact O-CB 3.24Å; S113-W117 PolarHBondContact O-N 2.99Å
114	H	95.2	Very high	88.7	Confident	127 Å²	127	104.7 Å²	104.7	59%	0.588	53%	0.527	S	S	*	.	H	α-helix	trans	-64.6	-43.9	178.2	-172.6	-82.5	0	0	0	111.3	I110 I111 W117 H118	I110-H114 WeakPolarHBondContact O-CB 3.35Å; I110-H114 PolarHBondContact O-N 3.39Å; I111-H114 PolarHBondContact O-N 2.68Å; H114-W117 PolarHBondContact O-N 3.39Å; H114-H118 WeakPolarHBondContact O-CB 3.39Å; H114-H118 PolarHBondContact O-N 3.5Å
115	W	93.8	Very high	86.8	Confident	165 Å²	165	109 Å²	109	63%	0.625	54%	0.54	S	S	*	.	H	α-helix	trans	-62.5	-44.6	176.1	179.9	85.8	0	0	0	112.1	I111 H118 A119	I111-W115 WeakPolarHBondContact O-CB 3.49Å; I111-W115 PolarHBondContact O-N 3.39Å; W115-H118 PolarHBondContact O-N 2.98Å; W115-A119 HydrophobicContact CZ2-CB 4.44Å; W115-A119 VanDerWaalsContact O-CB 3.26Å; W115-A119 WeakPolarHBondContact O-CB 3.41Å; W115-A119 PolarHBondContact O-N 3.1Å
116	R	92.9	Very high	84.8	Confident	178 Å²	178	107.7 Å²	107.7	67%	0.672	54%	0.543	S	S	*	.	H	α-helix	trans	-61.6	-44.5	177.3	-76.9	176.2	177.6	-125.6	0	111.8	Q112 S113 A119 S120	Q112-R116 WeakPolarHBondContact O-CB 3.37Å; Q112-R116 VanDerWaalsContact O-CG 3.24Å; Q112-R116 WeakPolarHBondContact O-CG 3.26Å; Q112-R116 PolarHBondContact O-N 3.37Å; S113-R116 PolarHBondContact O-N 2.94Å; R116-A119 PolarHBondContact O-N 3.42Å; R116-S120 WeakPolarHBondContact O-CB 3.25Å; R116-S120 PolarHBondContact O-N 3.5Å; R116-S120 PolarHBondContact O-OG 2.87Å
117	W	91.4	Very high	82.7	Confident	164 Å²	164	110.6 Å²	110.6	62%	0.621	55%	0.548	S	S	*	.	H	α-helix	trans	-57.8	-54.7	174.2	172.2	-94.2	0	0	0	111	S113 H114 A119 S120 Q121	S113-W117 WeakPolarHBondContact O-CB 3.24Å; S113-W117 PolarHBondContact O-N 2.99Å; H114-W117 PolarHBondContact O-N 3.39Å; W117-A119 PolarHBondContact O-N 2.93Å; W117-S120 PolarHBondContact O-N 2.83Å; W117-S120 VanDerWaalsContact O-N 3.1Å; W117-S120 PolarHBondContact O-OG 2.96Å; W117-Q121 VanDerWaalsContact NE1-OE1 3.12Å; W117-Q121 PolarHBondContact O-N 3.37Å
118	H	87.8	Confident	80.7	Confident	104 Å²	104	109 Å²	109	48%	0.481	54%	0.536	S	S	.	.	H	α-helix	trans	-57.4	-47.1	179.3	-176.8	-79.1	0	0	0	111.8	H114 W115 S120 Q121 T122	H114-H118 WeakPolarHBondContact O-CB 3.39Å; H114-H118 PolarHBondContact O-N 3.5Å; W115-H118 PolarHBondContact O-N 2.98Å; H118-S120 VanDerWaalsContact C-N 3.29Å; H118-S120 PolarHBondContact O-N 2.92Å; H118-Q121 PolarHBondContact O-N 3.5Å; H118-Q121 VanDerWaalsContact O-N 3.08Å; H118-T122 PolarHBondContact CE1-OG1 3.08Å; H118-T122 VanDerWaalsContact CE1-OG1 3.29Å; H118-T122 PolarHBondContact ND1-OG1 2.89Å; H118-T122 PolarHBondContact O-N 2.95Å; H118-T122 PolarHBondContact O-OG1 3.3Å
119	A	84.9	Confident	78.6	Confident	21 Å²	21	114.9 Å²	114.9	17%	0.174	56%	0.556	C	S	.	*	H	α-helix	trans	-63	-32.4	178.6	0	0	0	0	0	113.2	W115 R116 W117 R123	W115-A119 HydrophobicContact CZ2-CB 4.44Å; W115-A119 VanDerWaalsContact O-CB 3.26Å; W115-A119 WeakPolarHBondContact O-CB 3.41Å; W115-A119 PolarHBondContact O-N 3.1Å; R116-A119 PolarHBondContact O-N 3.42Å; W117-A119 PolarHBondContact O-N 2.93Å; A119-R123 VanDerWaalsContact O-CG 3.25Å; A119-R123 WeakPolarHBondContact O-CG 3.36Å; A119-R123 PolarHBondContact O-N 3.33Å
120	S	80.9	Confident	76.5	Confident	73 Å²	73	119 Å²	119	51%	0.51	56%	0.563	S	S	.	*	H	α-helix	trans	-72.3	-33.2	172.6	69.8	0	0	0	0	112.7	R116 W117 H118	R116-S120 WeakPolarHBondContact O-CB 3.25Å; R116-S120 PolarHBondContact O-N 3.5Å; R116-S120 PolarHBondContact O-OG 2.87Å; W117-S120 PolarHBondContact O-N 2.83Å; W117-S120 VanDerWaalsContact O-N 3.1Å; W117-S120 PolarHBondContact O-OG 2.96Å; H118-S120 VanDerWaalsContact C-N 3.29Å; H118-S120 PolarHBondContact O-N 2.92Å
121	Q	76.8	Confident	74.4	Confident	127 Å²	127	119.9 Å²	119.9	59%	0.593	57%	0.565	S	S	*	*	H	α-helix	trans	-75.2	-37.7	178.6	-163.9	166.6	20.4	0	0	112.2	W117 H118 R123	W117-Q121 VanDerWaalsContact NE1-OE1 3.12Å; W117-Q121 PolarHBondContact O-N 3.37Å; H118-Q121 PolarHBondContact O-N 3.5Å; H118-Q121 VanDerWaalsContact O-N 3.08Å; Q121-R123 VanDerWaalsContact C-N 3.33Å
122	T	66.4	Low	72.4	Confident	100 Å²	100	119.7 Å²	119.7	61%	0.613	57%	0.569	S	S	*	*	H	α-helix	trans	-72.1	-25.6	175.5	-45.1	0	0	0	0	112.7	H118 G124	H118-T122 PolarHBondContact CE1-OG1 3.08Å; H118-T122 VanDerWaalsContact CE1-OG1 3.29Å; H118-T122 PolarHBondContact ND1-OG1 2.89Å; H118-T122 PolarHBondContact O-N 2.95Å; H118-T122 PolarHBondContact O-OG1 3.3Å; T122-G124 PolarHBondContact O-N 3.29Å
123	R	62.3	Low	70.5	Confident	199 Å²	199	122.5 Å²	122.5	75%	0.751	58%	0.575	S	S	*	*	S	Bend	trans	-79.6	55.1	168.1	-68.3	174.5	-162.5	-123.2	2.5	109.8	A119 Q121 L125	A119-R123 VanDerWaalsContact O-CG 3.25Å; A119-R123 WeakPolarHBondContact O-CG 3.36Å; A119-R123 PolarHBondContact O-N 3.33Å; Q121-R123 VanDerWaalsContact C-N 3.33Å; R123-L125 PolarHBondContact O-N 2.98Å
124	G	56.3	Low	68.8	Low	36 Å²	36	124.7 Å²	124.7	37%	0.371	60%	0.597	S	S	.	*			trans	-39.4	140.8	179.4	0	0	0	0	0	111	T122 I126	T122-G124 PolarHBondContact O-N 3.29Å; G124-I126 VanDerWaalsContact C-N 3.31Å; G124-I126 VanDerWaalsContact O-CG1 3.32Å; G124-I126 WeakPolarHBondContact O-CG1 3.37Å; G124-I126 PolarHBondContact O-N 3.47Å
125	L	58.5	Low	67.3	Low	152 Å²	152	124.3 Å²	124.3	80%	0.796	61%	0.609	S	S	*	*			trans	-48.6	89	-173.9	-176.9	72.6	0	0	0	111.3	R123 R127	R123-L125 PolarHBondContact O-N 2.98Å; L125-R127 VanDerWaalsContact C-N 3.33Å; L125-R127 PolarHBondContact O-N 3.4Å
126	I	55.4	Low	65.4	Low	118 Å²	118	125.7 Å²	125.7	61%	0.605	61%	0.614	S	S	*	*			trans	-75.1	94.1	173.7	-55.7	-177.5	0	0	0	105.8	G124 G128 I141	G124-I126 VanDerWaalsContact C-N 3.31Å; G124-I126 VanDerWaalsContact O-CG1 3.32Å; G124-I126 WeakPolarHBondContact O-CG1 3.37Å; G124-I126 PolarHBondContact O-N 3.47Å; I126-G128 PolarHBondContact O-N 2.69Å; I126-I141 HydrophobicContact CG2-CG2 4.16Å
127	R	53.8	Low	63.8	Low	194 Å²	194	122.6 Å²	122.6	73%	0.732	61%	0.61	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-92.2	92.8	172.1	-150	178.3	-162.6	-168	3.3	107.2	L125	L125-R127 VanDerWaalsContact C-N 3.33Å; L125-R127 PolarHBondContact O-N 3.4Å
128	G	56.4	Low	62.1	Low	16 Å²	16	121.6 Å²	121.6	17%	0.165	61%	0.612	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.7	129.7	173.6	0	0	0	0	0	110.5	I126 Y130	I126-G128 PolarHBondContact O-N 2.69Å; G128-Y130 WeakPolarHBondContact O-CE2 3.32Å
129	H	53.1	Low	60.8	Low	166 Å²	166	120.8 Å²	120.8	77%	0.769	61%	0.611	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-88.6	126	160.1	-92.4	-90.4	0	0	0	107.7
130	Y	54.8	Low	59.5	Low	154 Å²	154	126.1 Å²	126.1	60%	0.604	64%	0.637	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-116.8	118.4	177.5	-30.9	-81.3	0	0	0	108.2	G128 L139	G128-Y130 WeakPolarHBondContact O-CE2 3.32Å; Y130-L139 HydrophobicContact CD1-CD2 3.73Å; Y130-L139 HydrophobicContact CD1-CG 4.28Å; Y130-L139 HydrophobicContact CE1-CD2 3.93Å
131	E	53.7	Low	58.7	Low	120 Å²	120	127.5 Å²	127.5	56%	0.561	64%	0.637	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-112.4	112	171.2	-162.3	-177.5	147.8	0	0	108.6	R133	E131-R133 PolarHBondContact O-N 3.34Å; E131-R133 IonicContact OE1-CZ 3.41Å; E131-R133 IonicContact OE1-NE 2.97Å; E131-R133 PolarHBondContact OE1-NE 2.97Å; E131-R133 IonicContact OE1-NH2 2.93Å; E131-R133 PolarHBondContact OE1-NH2 3.44Å
132	V	54.7	Low	57.7	Low	114 Å²	114	128.5 Å²	128.5	69%	0.691	64%	0.642	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-88.5	106.2	179.9	-175.9	0	0	0	0	108.8	L137	V132-L137 HydrophobicContact CB-CD1 4.43Å; V132-L137 HydrophobicContact CG1-CD1 4.28Å; V132-L137 HydrophobicContact CG2-CD1 3.83Å
133	R	56.2	Low	57.4	Low	174 Å²	174	130 Å²	130	66%	0.657	65%	0.645	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-99.8	142.5	168.2	-74.3	-174.1	-176.9	-163	3.4	110.7	E131 S135 R136	E131-R133 PolarHBondContact O-N 3.34Å; E131-R133 IonicContact OE1-CZ 3.41Å; E131-R133 IonicContact OE1-NE 2.97Å; E131-R133 PolarHBondContact OE1-NE 2.97Å; E131-R133 IonicContact OE1-NH2 2.93Å; E131-R133 PolarHBondContact OE1-NH2 3.44Å; R133-S135 PolarHBondContact O-N 2.77Å; R133-R136 PolarHBondContact O-N 2.93Å; R133-R136 VanDerWaalsContact O-N 3.13Å; R133-R136 VanDerWaalsContact O-O 3.07Å
134	A	60	Low	56.9	Low	116 Å²	116	127 Å²	127	96%	0.959	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-4.2	-163.4	0	0	0	0	0	116.9
135	S	62.7	Low	56.5	Low	120 Å²	120	133.4 Å²	133.4	84%	0.839	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-137.5	-3.3	179.4	50.8	0	0	0	0	115.2	R133	R133-S135 PolarHBondContact O-N 2.77Å
136	R	54.8	Low	56	Low	194 Å²	194	135.7 Å²	135.7	73%	0.732	69%	0.686	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-158.3	134.4	174.8	-107	177.1	-178.8	-165.2	-0.9	110.9	R133	R133-R136 PolarHBondContact O-N 2.93Å; R133-R136 VanDerWaalsContact O-N 3.13Å; R133-R136 VanDerWaalsContact O-O 3.07Å
137	L	58.6	Low	56.1	Low	112 Å²	112	136.6 Å²	136.6	59%	0.586	69%	0.69	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-92.8	111.6	172.6	-165.8	84.4	0	0	0	108.1	V132 L139	V132-L137 HydrophobicContact CB-CD1 4.43Å; V132-L137 HydrophobicContact CG1-CD1 4.28Å; V132-L137 HydrophobicContact CG2-CD1 3.83Å; L137-L139 HydrophobicContact CD2-CD1 3.52Å; L137-L139 HydrophobicContact CG-CD1 4.18Å
138	E	56.4	Low	56.2	Low	144 Å²	144	133.5 Å²	133.5	67%	0.673	69%	0.688	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-100.1	129.4	171	-70	-177.6	174.9	0	0	108.5
139	L	60.2	Low	56.2	Low	86 Å²	86	140.1 Å²	140.1	45%	0.45	72%	0.717	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-131	101.4	-170.7	-120.2	148.2	0	0	0	108.3	Y130 L137 I141	Y130-L139 HydrophobicContact CD1-CD2 3.73Å; Y130-L139 HydrophobicContact CD1-CG 4.28Å; Y130-L139 HydrophobicContact CE1-CD2 3.93Å; L137-L139 HydrophobicContact CD2-CD1 3.52Å; L137-L139 HydrophobicContact CG-CD1 4.18Å; L139-I141 HydrophobicContact CD2-CD1 4.14Å; L139-I141 HydrophobicContact CD2-CG1 3.99Å
140	D	58	Low	56.3	Low	134 Å²	134	138.5 Å²	138.5	72%	0.717	71%	0.714	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-94.3	119.5	172.4	-78.6	-23.7	0	0	0	109.4
141	I	64.5	Low	56.4	Low	102 Å²	102	137.6 Å²	137.6	52%	0.523	72%	0.72	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116	109.4	179	-55.4	177.8	0	0	0	108.3	I126 L139 I143	I126-I141 HydrophobicContact CG2-CG2 4.16Å; L139-I141 HydrophobicContact CD2-CD1 4.14Å; L139-I141 HydrophobicContact CD2-CG1 3.99Å; I141-I143 HydrophobicContact CG2-CG1 3.94Å
142	E	55.9	Low	56.6	Low	147 Å²	147	138.7 Å²	138.7	69%	0.687	73%	0.731	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-86.7	113.9	168.9	-69.1	-177.6	178.9	0	0	109.6
143	I	58.5	Low	56.8	Low	132 Å²	132	140.5 Å²	140.5	68%	0.677	73%	0.734	S	S	*	*			trans	-99.3	98.6	174.8	-52.7	178.1	0	0	0	108	I141 M145	I141-I143 HydrophobicContact CG2-CG1 3.94Å; I143-M145 HydrophobicContact CG2-CG 4.04Å; I143-M145 HydrophobicContact CG2-SD 4.3Å; I143-M145 PolarHBondContact O-N 3.13Å
144	L	53.2	Low	56.8	Low	137 Å²	137	137.9 Å²	137.9	72%	0.717	74%	0.74	S	S	*	*			trans	-83.7	102.5	171.4	-122.7	120.2	0	0	0	109.2
145	M	47.1	Very low	56.5	Low	170 Å²	170	139.8 Å²	139.8	84%	0.837	72%	0.722	S	S	*	*			trans	-89	111	169.9	-65.3	-79	-71.5	0	0	107.9	I143	I143-M145 HydrophobicContact CG2-CG 4.04Å; I143-M145 HydrophobicContact CG2-SD 4.3Å; I143-M145 PolarHBondContact O-N 3.13Å
146	T	48.7	Very low	56	Low	199 Å²	199	141.5 Å²	141.5	100%	1.221	71%	0.711	S	S	*	*			trans	-93.1	0	164.8	52.4	0	0	0	0	110.5

Retrieved 146 of 146 residues in 66.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).