A0A096NB76_PAPAN Loading...

Shisa like 2B

AlphaFold DB (A0A2K5Z881), UniProt , Accession A0A096NB76, Species PAPAN (Papio anubis, Olive baboon), Gene SHISAL2B, Length 160 aa.

						>A0A096NB76_PAPAN|A0A096NB76|SHISAL2B
MSEDSRLCSGYYSLNQSFVEPFQCPRRGEGAALQYCCGFADLKYCCSEPGSYFPYKHSYMWSLSIGALIGLGIAALVLLAFVISVCVLCYLFLYTKPQRLDTGLKLQHLEASSTQEGKSNEKTKALNSNAASNATNETYYEADDIIQEKTMDATQIYIAY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.7	Very low	71	Confident	222 Å²	222	88.7 Å²	88.7	100%	1.094	48%	0.482	S	S	*	.				0	95.1	0	-98.5	147.2	95.1	0	0	107.3
2	S	51.5	Low	72.6	Confident	110 Å²	110	94 Å²	94	77%	0.769	49%	0.492	S	S	*	.			trans	-116.3	61.5	174.8	-52.1	0	0	0	0	106.4
3	E	48.7	Very low	73.7	Confident	165 Å²	165	88.8 Å²	88.8	77%	0.771	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.8	132.1	176	-67.9	-160.7	104.7	0	0	108
4	D	54.7	Low	74.3	Confident	112 Å²	112	88.9 Å²	88.9	60%	0.599	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.4	43	-174.7	-53.8	-29	0	0	0	117.7	R6 L7	D4-R6 PolarHBondContact O-N 3.11Å; D4-L7 HydrophobicContact CB-CB 3.83Å; D4-L7 PolarHBondContact O-N 3.23Å
5	S	63.8	Low	75.2	Confident	63 Å²	63	92.3 Å²	92.3	44%	0.441	49%	0.487	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55	-12.9	168.2	45.4	0	0	0	0	115.1	Y35 C36	S5-Y35 CarbonylContact O-C 3.39Å; S5-Y35 WeakPolarHBondContact O-CA 3.43Å; S5-C36 PolarHBondContact O-N 3.28Å
6	R	80.3	Confident	75.8	Confident	116 Å²	116	96.9 Å²	96.9	44%	0.438	51%	0.505	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.4	-14.4	174.6	-56.4	-150.9	170.4	170.7	-3.1	114.9	D4 Q23 C24 Q34	D4-R6 PolarHBondContact O-N 3.11Å; R6-Q23 PolarHBondContact O-NE2 3.23Å; R6-Q23 VanDerWaalsContact O-NE2 3.16Å; R6-C24 PolarHBondContact O-N 2.83Å; R6-Q34 WeakPolarHBondContact CA-O 3.27Å; R6-Q34 VanDerWaalsContact CG-O 3.24Å; R6-Q34 WeakPolarHBondContact CG-O 3.24Å; R6-Q34 VanDerWaalsContact NH2-CD 3.31Å
7	L	88.1	Confident	76.8	Confident	71 Å²	71	94.6 Å²	94.6	37%	0.372	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	114.8	-178	-176	69.1	0	0	0	109.2	D4 Q23	D4-L7 HydrophobicContact CB-CB 3.83Å; D4-L7 PolarHBondContact O-N 3.23Å; L7-Q23 VanDerWaalsContact CD1-OE1 3.28Å
8	C	90.1	Very high	77.7	Confident	0 Å²	0	95.3 Å²	95.3	0%	0	50%	0.498	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	116.8	168.4	-69.6	0	0	0	0	109.5	P21 F22 C36 K43	C8-P21 CarbonylContact O-C 3.5Å; C8-P21 WeakPolarHBondContact O-CA 3.44Å; C8-P21 WeakPolarHBondContact O-CB 3.21Å; C8-F22 HydrophobicContact CB-CD1 3.89Å; C8-F22 HydrophobicContact CB-CD2 4.01Å; C8-F22 HydrophobicContact CB-CE1 3.55Å; C8-F22 HydrophobicContact CB-CE2 3.69Å; C8-F22 HydrophobicContact CB-CG 4.11Å; C8-F22 HydrophobicContact CB-CZ 3.45Å; C8-F22 VanDerWaalsContact CB-CZ 3.45Å; C8-F22 PolarHBondContact N-O 3.42Å; C8-F22 PolarHBondContact O-N 3.26Å; C8-F22 WeakPolarHBondContact SG-CE2 3.28Å; C8-F22 WeakPolarHBondContact SG-CZ 3.22Å; C8-C36 WeakPolarHBondContact CA-SG 3.29Å; C8-C36 HydrophobicContact CB-CB 4.18Å; C8-C36 WeakPolarHBondContact CB-SG 3.48Å; C8-C36 VanDerWaalsContact SG-CA 3.57Å; C8-C36 WeakPolarHBondContact SG-CB 3.35Å; C8-C36 CovalentContact SG-SG 2.03Å; C8-C36 PolarHBondContact SG-SG 2.97Å; C8-K43 HydrophobicContact CB-CB 4.43Å; C8-K43 HydrophobicContact CB-CD 4.41Å
9	S	89.8	Confident	78.4	Confident	70 Å²	70	92 Å²	92	49%	0.49	48%	0.482	S	S	.	.	P	Polyproline II helix	trans	-63.5	152.5	171.2	56.6	0	0	0	0	111.5	K43	S9-K43 WeakPolarHBondContact O-CD 3.42Å; S9-K43 PolarHBondContact O-NZ 3.24Å; S9-K43 PolarHBondContact OG-NZ 3.41Å
10	G	90.2	Very high	79.1	Confident	23 Å²	23	94.6 Å²	94.6	24%	0.237	49%	0.491	C	S	.	.	P	Polyproline II helix	trans	-58.2	152.1	177.6	0	0	0	0	0	112.3	V19 K43	G10-V19 CarbonylContact C-O 3.51Å; G10-V19 WeakPolarHBondContact CA-O 3.27Å; G10-K43 PolarHBondContact O-NZ 2.94Å
11	Y	88.8	Confident	79.8	Confident	24 Å²	24	93.8 Å²	93.8	9%	0.094	49%	0.492	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152	162.3	179.6	67.2	-82.4	0	0	0	112	V19 F22 A40 D41 K43	Y11-V19 HydrophobicContact CD1-CB 4.02Å; Y11-V19 HydrophobicContact CD1-CG1 4.28Å; Y11-V19 HydrophobicContact CE1-CB 3.73Å; Y11-V19 HydrophobicContact CE1-CG1 3.67Å; Y11-V19 HydrophobicContact CE1-CG2 4.21Å; Y11-V19 HydrophobicContact CE2-CB 4.3Å; Y11-V19 HydrophobicContact CE2-CG2 3.99Å; Y11-V19 HydrophobicContact CG-CB 4.43Å; Y11-V19 PolarHBondContact N-O 3.26Å; Y11-V19 PolarHBondContact O-N 2.65Å; Y11-F22 HydrophobicContact CE1-CE1 4.14Å; Y11-A40 VanDerWaalsContact CB-O 3.25Å; Y11-A40 WeakPolarHBondContact CB-O 3.41Å; Y11-D41 VanDerWaalsContact CD2-C 3.43Å; Y11-D41 WeakPolarHBondContact CD2-O 3.45Å; Y11-D41 VanDerWaalsContact CE2-C 3.42Å; Y11-D41 WeakPolarHBondContact CE2-O 2.95Å; Y11-K43 HydrophobicContact CD1-CB 4Å; Y11-K43 HydrophobicContact CD1-CD 3.7Å; Y11-K43 HydrophobicContact CD1-CG 3.85Å; Y11-K43 HydrophobicContact CE1-CB 3.67Å; Y11-K43 HydrophobicContact CE1-CD 4.27Å; Y11-K43 HydrophobicContact CE1-CG 4.03Å; Y11-K43 HydrophobicContact CG-CD 4.29Å; Y11-K43 HydrophobicContact CG-CG 4.35Å; Y11-K43 PolarHBondContact OH-O 3.48Å
12	Y	90.1	Very high	82.4	Confident	152 Å²	152	84.3 Å²	84.3	60%	0.596	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.1	124.8	168	-73.1	-87.3	0	0	0	109.2	S17 F18 D41	Y12-S17 WeakPolarHBondContact CA-O 3.26Å; Y12-F18 HydrophobicContact CD1-CB 4.16Å; Y12-F18 HydrophobicContact CD1-CD2 4.39Å; Y12-F18 HydrophobicContact CD2-CD2 4.24Å; Y12-F18 HydrophobicContact CE1-CB 3.82Å; Y12-F18 HydrophobicContact CE1-CD2 4.08Å; Y12-F18 HydrophobicContact CE1-CG 4.4Å; Y12-F18 AromaticContact CE2-CD2 3.91Å; Y12-F18 HydrophobicContact CE2-CD2 3.91Å; Y12-F18 HydrophobicContact CE2-CE2 4.46Å; Y12-F18 HydrophobicContact CG-CD2 4.48Å; Y12-F18 AromaticContact CZ-CD2 3.83Å; Y12-D41 WeakPolarHBondContact O-CA 3.45Å; Y12-D41 WeakPolarHBondContact O-CB 3.28Å
13	S	85.9	Confident	84.2	Confident	26 Å²	26	84 Å²	84	18%	0.182	43%	0.431	C	S	.	.			trans	-66.5	167.3	175.1	-176.2	0	0	0	0	111.3	N15 Q16 S17	S13-N15 PolarHBondContact O-N 2.96Å; S13-N15 VanDerWaalsContact O-N 3.12Å; S13-Q16 WeakPolarHBondContact O-CA 3.47Å; S13-Q16 PolarHBondContact O-N 2.78Å; S13-S17 PolarHBondContact N-O 2.93Å
14	L	83.3	Confident	86.2	Confident	91 Å²	91	76.4 Å²	76.4	48%	0.476	40%	0.396	S	S	.	.	T	Hydrogen-bonded Turn	trans	-51.8	-31.6	169.6	-70	166.5	0	0	0	112.5	Q16 D41 H57	L14-Q16 PolarHBondContact O-N 3.05Å; L14-D41 WeakPolarHBondContact CD2-OD2 2.8Å; L14-H57 HydrophobicContact CD1-CB 4.44Å; L14-H57 HydrophobicContact CD2-CB 4.19Å
15	N	87.1	Confident	87.9	Confident	140 Å²	140	73.5 Å²	73.5	75%	0.749	38%	0.383	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.5	10.7	175.9	-66.1	-41.1	0	0	0	113.9	S13 S17	S13-N15 PolarHBondContact O-N 2.96Å; S13-N15 VanDerWaalsContact O-N 3.12Å; N15-S17 PolarHBondContact O-N 2.9Å
16	Q	85.4	Confident	88.9	Confident	165 Å²	165	75.7 Å²	75.7	77%	0.771	38%	0.382	S	S	*	.	S	Bend	trans	59.4	12.5	-177.2	-61.1	158.8	47.6	0	0	114.4	S13 L14	S13-Q16 WeakPolarHBondContact O-CA 3.47Å; S13-Q16 PolarHBondContact O-N 2.78Å; L14-Q16 PolarHBondContact O-N 3.05Å
17	S	91.9	Very high	88.9	Confident	59 Å²	59	82.6 Å²	82.6	41%	0.413	41%	0.408	S	S	.	.			trans	-75.7	134	168.8	55.5	0	0	0	0	109.9	Y12 S13 N15	Y12-S17 WeakPolarHBondContact CA-O 3.26Å; S13-S17 PolarHBondContact N-O 2.93Å; N15-S17 PolarHBondContact O-N 2.9Å
18	F	93.4	Very high	88.4	Confident	107 Å²	107	83.4 Å²	83.4	47%	0.469	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.3	131.3	172.3	-176.5	-110.3	0	0	0	109.6	Y12 E20	Y12-F18 HydrophobicContact CD1-CB 4.16Å; Y12-F18 HydrophobicContact CD1-CD2 4.39Å; Y12-F18 HydrophobicContact CD2-CD2 4.24Å; Y12-F18 HydrophobicContact CE1-CB 3.82Å; Y12-F18 HydrophobicContact CE1-CD2 4.08Å; Y12-F18 HydrophobicContact CE1-CG 4.4Å; Y12-F18 AromaticContact CE2-CD2 3.91Å; Y12-F18 HydrophobicContact CE2-CD2 3.91Å; Y12-F18 HydrophobicContact CE2-CE2 4.46Å; Y12-F18 HydrophobicContact CG-CD2 4.48Å; Y12-F18 AromaticContact CZ-CD2 3.83Å; F18-E20 HydrophobicContact CD1-CG 4.18Å; F18-E20 HydrophobicContact CE1-CG 3.8Å
19	V	91.8	Very high	87.8	Confident	32 Å²	32	87.4 Å²	87.4	19%	0.194	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	119.7	173.1	-177.3	0	0	0	0	107	G10 Y11	G10-V19 CarbonylContact C-O 3.51Å; G10-V19 WeakPolarHBondContact CA-O 3.27Å; Y11-V19 HydrophobicContact CD1-CB 4.02Å; Y11-V19 HydrophobicContact CD1-CG1 4.28Å; Y11-V19 HydrophobicContact CE1-CB 3.73Å; Y11-V19 HydrophobicContact CE1-CG1 3.67Å; Y11-V19 HydrophobicContact CE1-CG2 4.21Å; Y11-V19 HydrophobicContact CE2-CB 4.3Å; Y11-V19 HydrophobicContact CE2-CG2 3.99Å; Y11-V19 HydrophobicContact CG-CB 4.43Å; Y11-V19 PolarHBondContact N-O 3.26Å; Y11-V19 PolarHBondContact O-N 2.65Å
20	E	92.5	Very high	87.2	Confident	143 Å²	143	86.2 Å²	86.2	67%	0.668	45%	0.451	S	S	*	.			trans	-64.6	155.1	178.7	-74.1	135.3	-173	0	0	111.9	F18 F22	F18-E20 HydrophobicContact CD1-CG 4.18Å; F18-E20 HydrophobicContact CE1-CG 3.8Å; E20-F22 PolarHBondContact O-N 2.87Å
21	P	91.9	Very high	86.4	Confident	79 Å²	79	89 Å²	89	51%	0.513	47%	0.472	S	S	.	.			trans	-55.3	140.2	172.6	-18.4	28.2	0	0	0	111.4	C8	C8-P21 CarbonylContact O-C 3.5Å; C8-P21 WeakPolarHBondContact O-CA 3.44Å; C8-P21 WeakPolarHBondContact O-CB 3.21Å
22	F	90.4	Very high	85.9	Confident	23 Å²	23	90.7 Å²	90.7	10%	0.101	49%	0.491	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140	152.9	179	63.6	-88	0	0	0	111.8	C8 Y11 E20 R26 K43	C8-F22 HydrophobicContact CB-CD1 3.89Å; C8-F22 HydrophobicContact CB-CD2 4.01Å; C8-F22 HydrophobicContact CB-CE1 3.55Å; C8-F22 HydrophobicContact CB-CE2 3.69Å; C8-F22 HydrophobicContact CB-CG 4.11Å; C8-F22 HydrophobicContact CB-CZ 3.45Å; C8-F22 VanDerWaalsContact CB-CZ 3.45Å; C8-F22 PolarHBondContact N-O 3.42Å; C8-F22 PolarHBondContact O-N 3.26Å; C8-F22 WeakPolarHBondContact SG-CE2 3.28Å; C8-F22 WeakPolarHBondContact SG-CZ 3.22Å; Y11-F22 HydrophobicContact CE1-CE1 4.14Å; E20-F22 PolarHBondContact O-N 2.87Å; F22-R26 HydrophobicContact CD2-CG 4.25Å; F22-K43 HydrophobicContact CE1-CB 4.45Å; F22-K43 HydrophobicContact CZ-CB 4.26Å
23	Q	90.7	Very high	85.7	Confident	104 Å²	104	85.5 Å²	85.5	49%	0.486	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.4	138.1	177.7	-160.3	82.6	43.2	0	0	110.2	R6 L7	R6-Q23 PolarHBondContact O-NE2 3.23Å; R6-Q23 VanDerWaalsContact O-NE2 3.16Å; L7-Q23 VanDerWaalsContact CD1-OE1 3.28Å
24	C	90	Very high	85.8	Confident	4 Å²	4	87.2 Å²	87.2	3%	0.027	48%	0.479	C	S	.	.	S	Bend	trans	-89.9	141.8	172.6	-67.7	0	0	0	0	111.8	R6 L33 C45	R6-C24 PolarHBondContact O-N 2.83Å; C24-L33 WeakPolarHBondContact CB-O 3.45Å; C24-C45 WeakPolarHBondContact CA-SG 3.24Å; C24-C45 HydrophobicContact CB-CB 3.77Å; C24-C45 WeakPolarHBondContact CB-SG 3.38Å; C24-C45 WeakPolarHBondContact SG-CA 2.81Å; C24-C45 WeakPolarHBondContact SG-CB 3.2Å; C24-C45 CovalentContact SG-SG 2.04Å; C24-C45 PolarHBondContact SG-SG 2.77Å
25	P	89.8	Confident	86	Confident	52 Å²	52	86.1 Å²	86.1	34%	0.338	47%	0.469	S	S	.	.	S	Bend	cis	-78.8	152.6	-4.2	31.6	-34.5	0	0	0	112.7	L33	P25-L33 WeakPolarHBondContact CA-O 3.39Å; P25-L33 HydrophobicContact CB-CB 4.37Å; P25-L33 WeakPolarHBondContact CB-O 3.23Å
26	R	84.8	Confident	86.1	Confident	109 Å²	109	80.7 Å²	80.7	41%	0.411	44%	0.441	S	S	.	.	P	Polyproline II helix	trans	-71.4	160	174.6	-67.5	-164.4	174.3	-164.8	2.1	111.9	F22 G28 E29	F22-R26 HydrophobicContact CD2-CG 4.25Å; R26-G28 PolarHBondContact O-N 2.79Å; R26-G28 VanDerWaalsContact O-N 3.14Å; R26-E29 HydrophobicContact CB-CB 4.45Å; R26-E29 HydrophobicContact CB-CG 4.27Å; R26-E29 WeakPolarHBondContact CB-OE2 3.35Å; R26-E29 PolarHBondContact N-OE2 3.31Å; R26-E29 VanDerWaalsContact N-OE2 3.15Å; R26-E29 WeakPolarHBondContact O-CB 3.32Å; R26-E29 PolarHBondContact O-N 3.34Å
27	R	80.5	Confident	86.2	Confident	260 Å²	260	72.9 Å²	72.9	98%	0.981	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.5	119	170.3	-102	-173.3	175.7	120.7	-1.2	109.6
28	G	77.4	Confident	85.9	Confident	89 Å²	89	70 Å²	70	92%	0.918	39%	0.385	S	S	*	.	T	Hydrogen-bonded Turn	trans	94.2	-2.7	-179.9	0	0	0	0	0	115	R26	R26-G28 PolarHBondContact O-N 2.79Å; R26-G28 VanDerWaalsContact O-N 3.14Å
29	E	77.6	Confident	85.5	Confident	84 Å²	84	66.7 Å²	66.7	39%	0.393	37%	0.37	S	S	.	.	S	Bend	trans	-93.5	159.8	173.3	-84.6	176.3	179.8	0	0	111.8	R26 L33	R26-E29 HydrophobicContact CB-CB 4.45Å; R26-E29 HydrophobicContact CB-CG 4.27Å; R26-E29 WeakPolarHBondContact CB-OE2 3.35Å; R26-E29 PolarHBondContact N-OE2 3.31Å; R26-E29 VanDerWaalsContact N-OE2 3.15Å; R26-E29 WeakPolarHBondContact O-CB 3.32Å; R26-E29 PolarHBondContact O-N 3.34Å; E29-L33 HydrophobicContact CB-CD1 3.78Å; E29-L33 HydrophobicContact CG-CD1 4.06Å
30	G	77.6	Confident	85.2	Confident	44 Å²	44	66.7 Å²	66.7	45%	0.454	37%	0.374	S	S	.	.			trans	-63.7	138.1	178.3	0	0	0	0	0	112.6	A32 L33	G30-A32 PolarHBondContact O-N 2.96Å; G30-L33 WeakPolarHBondContact O-CB 3.49Å; G30-L33 PolarHBondContact O-N 3.22Å
31	A	73.4	Confident	84.9	Confident	81 Å²	81	60.3 Å²	60.3	67%	0.669	34%	0.344	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.2	-11.4	-178.7	0	0	0	0	0	115	Q34	A31-Q34 PolarHBondContact O-NE2 3.18Å; A31-Q34 VanDerWaalsContact O-NE2 3.1Å
32	A	79.2	Confident	84.6	Confident	61 Å²	61	60 Å²	60	50%	0.504	34%	0.337	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.8	-17.9	175.8	0	0	0	0	0	113.6	G30 Q34 S47	G30-A32 PolarHBondContact O-N 2.96Å; A32-Q34 VanDerWaalsContact C-N 3.27Å; A32-Q34 PolarHBondContact O-N 3.42Å; A32-S47 WeakPolarHBondContact O-CA 3.49Å; A32-S47 PolarHBondContact O-OG 2.79Å
33	L	84.6	Confident	84.6	Confident	43 Å²	43	59.6 Å²	59.6	23%	0.225	34%	0.336	C	S	.	.			trans	-81.1	72.1	-176.4	-62.4	161.8	0	0	0	110.3	C24 P25 E29 G30 C45 C46	C24-L33 WeakPolarHBondContact CB-O 3.45Å; P25-L33 WeakPolarHBondContact CA-O 3.39Å; P25-L33 HydrophobicContact CB-CB 4.37Å; P25-L33 WeakPolarHBondContact CB-O 3.23Å; E29-L33 HydrophobicContact CB-CD1 3.78Å; E29-L33 HydrophobicContact CG-CD1 4.06Å; G30-L33 WeakPolarHBondContact O-CB 3.49Å; G30-L33 PolarHBondContact O-N 3.22Å; L33-C45 HydrophobicContact CB-CB 3.82Å; L33-C45 WeakPolarHBondContact CD2-O 3.37Å; L33-C46 CarbonylContact C-O 3.58Å
34	Q	87.8	Confident	84.4	Confident	62 Å²	62	60 Å²	60	29%	0.29	33%	0.333	S	S	.	.			trans	-96.4	-13	-169.7	-64.7	179.9	16.9	0	0	113.6	R6 A31 A32 C46	R6-Q34 WeakPolarHBondContact CA-O 3.27Å; R6-Q34 VanDerWaalsContact CG-O 3.24Å; R6-Q34 WeakPolarHBondContact CG-O 3.24Å; R6-Q34 VanDerWaalsContact NH2-CD 3.31Å; A31-Q34 PolarHBondContact O-NE2 3.18Å; A31-Q34 VanDerWaalsContact O-NE2 3.1Å; A32-Q34 VanDerWaalsContact C-N 3.27Å; A32-Q34 PolarHBondContact O-N 3.42Å; Q34-C46 PolarHBondContact N-O 2.87Å; Q34-C46 VanDerWaalsContact N-O 3.17Å
35	Y	87.6	Confident	84.4	Confident	68 Å²	68	60.2 Å²	60.2	27%	0.267	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	145.1	-171.9	-57.4	-73.8	0	0	0	112.5	S5 C37 C45 C46 S47 P49	S5-Y35 CarbonylContact O-C 3.39Å; S5-Y35 WeakPolarHBondContact O-CA 3.43Å; Y35-C37 PolarHBondContact O-SG 2.8Å; Y35-C37 VanDerWaalsContact O-SG 3.41Å; Y35-C45 CarbonylContact O-C 3.49Å; Y35-C45 VanDerWaalsContact O-CA 3.27Å; Y35-C45 WeakPolarHBondContact O-CA 3.24Å; Y35-C46 PolarHBondContact N-O 3.34Å; Y35-C46 PolarHBondContact O-N 3.44Å; Y35-S47 WeakPolarHBondContact CD2-O 3.4Å; Y35-S47 VanDerWaalsContact CE2-O 3.28Å; Y35-S47 WeakPolarHBondContact CE2-O 3.37Å; Y35-P49 HydrophobicContact CD1-CB 4.01Å; Y35-P49 HydrophobicContact CD2-CB 4.5Å; Y35-P49 HydrophobicContact CE1-CB 3.98Å; Y35-P49 HydrophobicContact CE1-CG 4.49Å; Y35-P49 HydrophobicContact CE2-CB 4.47Å; Y35-P49 HydrophobicContact CE2-CG 4.43Å; Y35-P49 HydrophobicContact CG-CB 4.26Å
36	C	89.4	Confident	84.4	Confident	25 Å²	25	58.5 Å²	58.5	17%	0.169	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.1	120.8	169	-165.6	0	0	0	0	110.9	S5 C8	S5-C36 PolarHBondContact O-N 3.28Å; C8-C36 WeakPolarHBondContact CA-SG 3.29Å; C8-C36 HydrophobicContact CB-CB 4.18Å; C8-C36 WeakPolarHBondContact CB-SG 3.48Å; C8-C36 VanDerWaalsContact SG-CA 3.57Å; C8-C36 WeakPolarHBondContact SG-CB 3.35Å; C8-C36 CovalentContact SG-SG 2.03Å; C8-C36 PolarHBondContact SG-SG 2.97Å
37	C	88.7	Confident	84.5	Confident	1 Å²	1	56.5 Å²	56.5	1%	0.007	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	169.3	-172.2	-48.8	0	0	0	0	110.9	Y35 K43 Y44 C46	Y35-C37 PolarHBondContact O-SG 2.8Å; Y35-C37 VanDerWaalsContact O-SG 3.41Å; C37-K43 WeakPolarHBondContact O-CA 3.3Å; C37-Y44 HydrophobicContact CB-CD2 4.27Å; C37-Y44 HydrophobicContact CB-CE2 3.86Å; C37-Y44 PolarHBondContact N-O 2.92Å; C37-Y44 PolarHBondContact O-N 2.85Å; C37-C46 HydrophobicContact CB-CB 3.65Å; C37-C46 WeakPolarHBondContact CB-SG 3.42Å; C37-C46 WeakPolarHBondContact SG-CB 2.9Å; C37-C46 CovalentContact SG-SG 2.01Å; C37-C46 PolarHBondContact SG-SG 3.49Å
38	G	85.9	Confident	84.7	Confident	0 Å²	0	50.6 Å²	50.6	0%	0	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	98.9	-141.7	178.8	0	0	0	0	0	112.8	S51 Y52 F53	G38-S51 PolarHBondContact N-O 3.31Å; G38-Y52 WeakPolarHBondContact O-CA 3.36Å; G38-Y52 WeakPolarHBondContact O-CD2 3.24Å; G38-F53 PolarHBondContact O-N 3.42Å
39	F	84.8	Confident	84.9	Confident	37 Å²	37	49.6 Å²	49.6	16%	0.162	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	169.1	-163.1	-68.7	-103.9	0	0	0	111.3	D41 L42 K43 F53 Y55 H57 M60	F39-D41 PolarHBondContact O-N 2.67Å; F39-D41 VanDerWaalsContact O-N 3.1Å; F39-L42 PolarHBondContact N-O 3.42Å; F39-L42 CarbonylContact O-C 3.52Å; F39-L42 PolarHBondContact O-N 2.86Å; F39-K43 VanDerWaalsContact O-CG 3.28Å; F39-K43 WeakPolarHBondContact O-CG 3.47Å; F39-F53 WeakPolarHBondContact CA-O 3.18Å; F39-F53 HydrophobicContact CD1-CB 3.82Å; F39-F53 HydrophobicContact CE1-CB 3.68Å; F39-F53 HydrophobicContact CE1-CD2 4.25Å; F39-F53 HydrophobicContact CE1-CG 4.16Å; F39-F53 HydrophobicContact CE2-CD2 4.14Å; F39-F53 HydrophobicContact CG-CB 4.45Å; F39-F53 HydrophobicContact CZ-CB 4.16Å; F39-F53 AromaticContact CZ-CD2 3.86Å; F39-F53 HydrophobicContact CZ-CD2 3.86Å; F39-F53 HydrophobicContact CZ-CG 4.22Å; F39-Y55 WeakPolarHBondContact CB-O 3.43Å; F39-Y55 WeakPolarHBondContact CD1-O 3.04Å; F39-H57 AromaticContact CD1-CE1 3.36Å; F39-H57 WeakPolarHBondContact CD1-CE1 3.27Å; F39-H57 AromaticContact CD1-ND1 3.18Å; F39-H57 WeakPolarHBondContact CD1-ND1 3.27Å; F39-H57 AromaticContact CD2-CD2 3.76Å; F39-H57 AromaticContact CD2-CE1 2.8Å; F39-H57 WeakPolarHBondContact CD2-CE1 3.46Å; F39-H57 AromaticContact CD2-ND1 3.47Å; F39-H57 WeakPolarHBondContact CD2-ND1 3.33Å; F39-H57 AromaticContact CD2-NE2 2.95Å; F39-H57 WeakPolarHBondContact CD2-NE2 3.28Å; F39-H57 AromaticContact CE1-CE1 3.42Å; F39-H57 VanDerWaalsContact CE1-CE1 3.42Å; F39-H57 WeakPolarHBondContact CE1-CE1 3.36Å; F39-H57 AromaticContact CE1-ND1 3.52Å; F39-H57 AromaticContact CE2-CE1 2.9Å; F39-H57 WeakPolarHBondContact CE2-CE1 3.31Å; F39-H57 AromaticContact CE2-ND1 3.81Å; F39-H57 AromaticContact CE2-NE2 3.37Å; F39-H57 WeakPolarHBondContact CE2-NE2 3.5Å; F39-H57 AromaticContact CG-CD2 3.8Å; F39-H57 AromaticContact CG-CE1 3.04Å; F39-H57 WeakPolarHBondContact CG-CE1 3.3Å; F39-H57 AromaticContact CG-CG 3.67Å; F39-H57 AromaticContact CG-ND1 3.13Å; F39-H57 WeakPolarHBondContact CG-ND1 3.31Å; F39-H57 AromaticContact CG-NE2 3.43Å; F39-H57 WeakPolarHBondContact CG-NE2 3.39Å; F39-H57 AromaticContact CZ-CE1 3.2Å; F39-H57 WeakPolarHBondContact CZ-CE1 3.12Å; F39-H57 AromaticContact CZ-ND1 3.82Å; F39-M60 HydrophobicContact CE1-SD 4.33Å
40	A	85.1	Confident	84.7	Confident	32 Å²	32	49.2 Å²	49.2	26%	0.264	31%	0.307	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.8	-29.1	-177.2	0	0	0	0	0	113.2	Y11 Y55 K56	Y11-A40 VanDerWaalsContact CB-O 3.25Å; Y11-A40 WeakPolarHBondContact CB-O 3.41Å; A40-Y55 PolarHBondContact N-O 3.39Å; A40-Y55 VanDerWaalsContact N-O 3.11Å; A40-K56 HydrophobicContact CB-CG 4.41Å
41	D	85.4	Confident	84.7	Confident	9 Å²	9	49.2 Å²	49.2	5%	0.048	30%	0.299	C	S	.	.	T	Hydrogen-bonded Turn	trans	-114	7.3	-177.9	57.9	-25.4	0	0	0	114.1	Y11 Y12 L14 F39 K56 H57	Y11-D41 VanDerWaalsContact CD2-C 3.43Å; Y11-D41 WeakPolarHBondContact CD2-O 3.45Å; Y11-D41 VanDerWaalsContact CE2-C 3.42Å; Y11-D41 WeakPolarHBondContact CE2-O 2.95Å; Y12-D41 WeakPolarHBondContact O-CA 3.45Å; Y12-D41 WeakPolarHBondContact O-CB 3.28Å; L14-D41 WeakPolarHBondContact CD2-OD2 2.8Å; F39-D41 PolarHBondContact O-N 2.67Å; F39-D41 VanDerWaalsContact O-N 3.1Å; D41-K56 WeakPolarHBondContact OD1-CA 3.13Å; D41-H57 WeakPolarHBondContact OD1-CA 3.31Å; D41-H57 VanDerWaalsContact OD1-CB 3.31Å; D41-H57 WeakPolarHBondContact OD1-CB 3.18Å; D41-H57 IonicContact OD1-CG 3.78Å; D41-H57 PolarHBondContact OD1-N 3.01Å; D41-H57 VanDerWaalsContact OD2-CA 3.25Å; D41-H57 WeakPolarHBondContact OD2-CA 3.25Å
42	L	86.6	Confident	85	Confident	71 Å²	71	49.9 Å²	49.9	37%	0.372	29%	0.285	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.9	88.3	173.5	-173.9	73.2	0	0	0	110.1	F39	F39-L42 PolarHBondContact N-O 3.42Å; F39-L42 CarbonylContact O-C 3.52Å; F39-L42 PolarHBondContact O-N 2.86Å
43	K	88.9	Confident	85	Confident	16 Å²	16	51.8 Å²	51.8	7%	0.07	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	137.1	177.8	-57.4	177	-167.2	158.3	0	110.5	C8 S9 G10 Y11 F22 C37 F39 Y52	C8-K43 HydrophobicContact CB-CB 4.43Å; C8-K43 HydrophobicContact CB-CD 4.41Å; S9-K43 WeakPolarHBondContact O-CD 3.42Å; S9-K43 PolarHBondContact O-NZ 3.24Å; S9-K43 PolarHBondContact OG-NZ 3.41Å; G10-K43 PolarHBondContact O-NZ 2.94Å; Y11-K43 HydrophobicContact CD1-CB 4Å; Y11-K43 HydrophobicContact CD1-CD 3.7Å; Y11-K43 HydrophobicContact CD1-CG 3.85Å; Y11-K43 HydrophobicContact CE1-CB 3.67Å; Y11-K43 HydrophobicContact CE1-CD 4.27Å; Y11-K43 HydrophobicContact CE1-CG 4.03Å; Y11-K43 HydrophobicContact CG-CD 4.29Å; Y11-K43 HydrophobicContact CG-CG 4.35Å; Y11-K43 PolarHBondContact OH-O 3.48Å; F22-K43 HydrophobicContact CE1-CB 4.45Å; F22-K43 HydrophobicContact CZ-CB 4.26Å; C37-K43 WeakPolarHBondContact O-CA 3.3Å; F39-K43 VanDerWaalsContact O-CG 3.28Å; F39-K43 WeakPolarHBondContact O-CG 3.47Å; K43-Y52 HydrophobicContact CG-CE2 4.45Å
44	Y	87.4	Confident	84.4	Confident	111 Å²	111	53.9 Å²	53.9	44%	0.435	30%	0.299	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.4	160.1	178.4	60.7	-89.1	0	0	0	111.2	C37 C46	C37-Y44 HydrophobicContact CB-CD2 4.27Å; C37-Y44 HydrophobicContact CB-CE2 3.86Å; C37-Y44 PolarHBondContact N-O 2.92Å; C37-Y44 PolarHBondContact O-N 2.85Å; Y44-C46 HydrophobicContact CD2-CB 4.21Å; Y44-C46 HydrophobicContact CE2-CB 3.88Å
45	C	90.1	Very high	83.8	Confident	9 Å²	9	58.9 Å²	58.9	6%	0.061	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80	134.7	175.7	-59.4	0	0	0	0	110.3	C24 L33 Y35	C24-C45 WeakPolarHBondContact CA-SG 3.24Å; C24-C45 HydrophobicContact CB-CB 3.77Å; C24-C45 WeakPolarHBondContact CB-SG 3.38Å; C24-C45 WeakPolarHBondContact SG-CA 2.81Å; C24-C45 WeakPolarHBondContact SG-CB 3.2Å; C24-C45 CovalentContact SG-SG 2.04Å; C24-C45 PolarHBondContact SG-SG 2.77Å; L33-C45 HydrophobicContact CB-CB 3.82Å; L33-C45 WeakPolarHBondContact CD2-O 3.37Å; Y35-C45 CarbonylContact O-C 3.49Å; Y35-C45 VanDerWaalsContact O-CA 3.27Å; Y35-C45 WeakPolarHBondContact O-CA 3.24Å
46	C	89.1	Confident	82.8	Confident	16 Å²	16	62.3 Å²	62.3	11%	0.108	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.2	166.5	175.2	90.3	0	0	0	0	112.5	L33 Q34 Y35 C37 Y44 E48	L33-C46 CarbonylContact C-O 3.58Å; Q34-C46 PolarHBondContact N-O 2.87Å; Q34-C46 VanDerWaalsContact N-O 3.17Å; Y35-C46 PolarHBondContact N-O 3.34Å; Y35-C46 PolarHBondContact O-N 3.44Å; C37-C46 HydrophobicContact CB-CB 3.65Å; C37-C46 WeakPolarHBondContact CB-SG 3.42Å; C37-C46 WeakPolarHBondContact SG-CB 2.9Å; C37-C46 CovalentContact SG-SG 2.01Å; C37-C46 PolarHBondContact SG-SG 3.49Å; Y44-C46 HydrophobicContact CD2-CB 4.21Å; Y44-C46 HydrophobicContact CE2-CB 3.88Å; C46-E48 PolarHBondContact SG-O 3.44Å
47	S	88	Confident	81.8	Confident	68 Å²	68	63.3 Å²	63.3	48%	0.476	34%	0.335	S	S	.	.	S	Bend	trans	-88.9	-14.3	-174	-52.6	0	0	0	0	114.3	A32 Y35	A32-S47 WeakPolarHBondContact O-CA 3.49Å; A32-S47 PolarHBondContact O-OG 2.79Å; Y35-S47 WeakPolarHBondContact CD2-O 3.4Å; Y35-S47 VanDerWaalsContact CE2-O 3.28Å; Y35-S47 WeakPolarHBondContact CE2-O 3.37Å
48	E	83.9	Confident	80.7	Confident	136 Å²	136	66.1 Å²	66.1	64%	0.636	35%	0.354	S	S	*	.	S	Bend	trans	-116.1	130.6	-176	-165.1	77.4	-85.9	0	0	110.7	C46	C46-E48 PolarHBondContact SG-O 3.44Å
49	P	81.3	Confident	79.7	Confident	68 Å²	68	74.5 Å²	74.5	44%	0.442	39%	0.387	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.1	162	175.6	30.3	-33.7	0	0	0	111.8	Y35 S51	Y35-P49 HydrophobicContact CD1-CB 4.01Å; Y35-P49 HydrophobicContact CD2-CB 4.5Å; Y35-P49 HydrophobicContact CE1-CB 3.98Å; Y35-P49 HydrophobicContact CE1-CG 4.49Å; Y35-P49 HydrophobicContact CE2-CB 4.47Å; Y35-P49 HydrophobicContact CE2-CG 4.43Å; Y35-P49 HydrophobicContact CG-CB 4.26Å; P49-S51 PolarHBondContact O-N 3.23Å
50	G	75	Confident	79.1	Confident	76 Å²	76	78.8 Å²	78.8	78%	0.784	41%	0.409	S	S	*	.	T	Hydrogen-bonded Turn	trans	85.5	1.1	171.1	0	0	0	0	0	115.9	Y52	G50-Y52 VanDerWaalsContact C-N 3.25Å; G50-Y52 PolarHBondContact O-N 3.31Å
51	S	76.7	Confident	78.5	Confident	43 Å²	43	86 Å²	86	30%	0.301	43%	0.43	S	S	.	.			trans	-89.6	26.6	177.2	-61.7	0	0	0	0	113.6	G38 P49	G38-S51 PolarHBondContact N-O 3.31Å; P49-S51 PolarHBondContact O-N 3.23Å
52	Y	80.1	Confident	78	Confident	95 Å²	95	89.1 Å²	89.1	37%	0.373	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	120.3	175.7	-179.3	-106.5	0	0	0	110.6	G38 K43 G50 P54	G38-Y52 WeakPolarHBondContact O-CA 3.36Å; G38-Y52 WeakPolarHBondContact O-CD2 3.24Å; K43-Y52 HydrophobicContact CG-CE2 4.45Å; G50-Y52 VanDerWaalsContact C-N 3.25Å; G50-Y52 PolarHBondContact O-N 3.31Å; Y52-P54 HydrophobicContact CE1-CB 4.02Å
53	F	78.4	Confident	77.7	Confident	101 Å²	101	91.1 Å²	91.1	44%	0.443	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	114.1	178.8	-61.7	-82.2	0	0	0	108.6	G38 F39 Y55	G38-F53 PolarHBondContact O-N 3.42Å; F39-F53 WeakPolarHBondContact CA-O 3.18Å; F39-F53 HydrophobicContact CD1-CB 3.82Å; F39-F53 HydrophobicContact CE1-CB 3.68Å; F39-F53 HydrophobicContact CE1-CD2 4.25Å; F39-F53 HydrophobicContact CE1-CG 4.16Å; F39-F53 HydrophobicContact CE2-CD2 4.14Å; F39-F53 HydrophobicContact CG-CB 4.45Å; F39-F53 HydrophobicContact CZ-CB 4.16Å; F39-F53 AromaticContact CZ-CD2 3.86Å; F39-F53 HydrophobicContact CZ-CD2 3.86Å; F39-F53 HydrophobicContact CZ-CG 4.22Å; F53-Y55 HydrophobicContact CB-CD2 4.38Å; F53-Y55 PolarHBondContact O-N 2.82Å
54	P	72.7	Confident	77.6	Confident	87 Å²	87	93.5 Å²	93.5	57%	0.565	48%	0.481	S	S	*	.			trans	-76.1	41.7	-178	33.9	-37.5	0	0	0	112.5	Y52	Y52-P54 HydrophobicContact CE1-CB 4.02Å
55	Y	74.6	Confident	77.7	Confident	168 Å²	168	91.1 Å²	91.1	66%	0.659	48%	0.475	S	S	*	.	S	Bend	trans	-118.8	151.8	177	-60.3	-69	0	0	0	109.4	F39 A40 F53 H57	F39-Y55 WeakPolarHBondContact CB-O 3.43Å; F39-Y55 WeakPolarHBondContact CD1-O 3.04Å; A40-Y55 PolarHBondContact N-O 3.39Å; A40-Y55 VanDerWaalsContact N-O 3.11Å; F53-Y55 HydrophobicContact CB-CD2 4.38Å; F53-Y55 PolarHBondContact O-N 2.82Å; Y55-H57 PolarHBondContact O-N 3.44Å
56	K	67.5	Low	77.7	Confident	140 Å²	140	92.7 Å²	92.7	61%	0.609	49%	0.493	S	S	*	.			trans	-77.4	114.3	171	-72.9	-174.8	175.5	179.6	0	109.1	A40 D41 S58 Y59	A40-K56 HydrophobicContact CB-CG 4.41Å; D41-K56 WeakPolarHBondContact OD1-CA 3.13Å; K56-S58 VanDerWaalsContact C-N 3.34Å; K56-S58 PolarHBondContact O-N 2.9Å; K56-Y59 WeakPolarHBondContact O-CB 3.33Å; K56-Y59 PolarHBondContact O-N 3.43Å
57	H	66.8	Low	77.9	Confident	46 Å²	46	94.4 Å²	94.4	21%	0.213	51%	0.508	C	S	.	.	H	α-helix		34.5	-97.2	117.9	-30.9	-38.8	0	0	0	120.2	L14 F39 D41 Y55 Y59 M60	L14-H57 HydrophobicContact CD1-CB 4.44Å; L14-H57 HydrophobicContact CD2-CB 4.19Å; F39-H57 AromaticContact CD1-CE1 3.36Å; F39-H57 WeakPolarHBondContact CD1-CE1 3.27Å; F39-H57 AromaticContact CD1-ND1 3.18Å; F39-H57 WeakPolarHBondContact CD1-ND1 3.27Å; F39-H57 AromaticContact CD2-CD2 3.76Å; F39-H57 AromaticContact CD2-CE1 2.8Å; F39-H57 WeakPolarHBondContact CD2-CE1 3.46Å; F39-H57 AromaticContact CD2-ND1 3.47Å; F39-H57 WeakPolarHBondContact CD2-ND1 3.33Å; F39-H57 AromaticContact CD2-NE2 2.95Å; F39-H57 WeakPolarHBondContact CD2-NE2 3.28Å; F39-H57 AromaticContact CE1-CE1 3.42Å; F39-H57 VanDerWaalsContact CE1-CE1 3.42Å; F39-H57 WeakPolarHBondContact CE1-CE1 3.36Å; F39-H57 AromaticContact CE1-ND1 3.52Å; F39-H57 AromaticContact CE2-CE1 2.9Å; F39-H57 WeakPolarHBondContact CE2-CE1 3.31Å; F39-H57 AromaticContact CE2-ND1 3.81Å; F39-H57 AromaticContact CE2-NE2 3.37Å; F39-H57 WeakPolarHBondContact CE2-NE2 3.5Å; F39-H57 AromaticContact CG-CD2 3.8Å; F39-H57 AromaticContact CG-CE1 3.04Å; F39-H57 WeakPolarHBondContact CG-CE1 3.3Å; F39-H57 AromaticContact CG-CG 3.67Å; F39-H57 AromaticContact CG-ND1 3.13Å; F39-H57 WeakPolarHBondContact CG-ND1 3.31Å; F39-H57 AromaticContact CG-NE2 3.43Å; F39-H57 WeakPolarHBondContact CG-NE2 3.39Å; F39-H57 AromaticContact CZ-CE1 3.2Å; F39-H57 WeakPolarHBondContact CZ-CE1 3.12Å; F39-H57 AromaticContact CZ-ND1 3.82Å; D41-H57 WeakPolarHBondContact OD1-CA 3.31Å; D41-H57 VanDerWaalsContact OD1-CB 3.31Å; D41-H57 WeakPolarHBondContact OD1-CB 3.18Å; D41-H57 IonicContact OD1-CG 3.78Å; D41-H57 PolarHBondContact OD1-N 3.01Å; D41-H57 VanDerWaalsContact OD2-CA 3.25Å; D41-H57 WeakPolarHBondContact OD2-CA 3.25Å; Y55-H57 PolarHBondContact O-N 3.44Å; H57-Y59 PolarHBondContact O-N 3.38Å; H57-Y59 VanDerWaalsContact O-N 3.17Å; H57-M60 PolarHBondContact O-N 3.25Å
58	S	66.1	Low	78.2	Confident	60 Å²	60	97 Å²	97	42%	0.42	52%	0.516	S	S	.	.	H	α-helix	trans	-53.9	-29.4	-175.6	-174.2	0	0	0	0	114.2	K56 M60 W61 S62	K56-S58 VanDerWaalsContact C-N 3.34Å; K56-S58 PolarHBondContact O-N 2.9Å; S58-M60 PolarHBondContact O-N 2.89Å; S58-W61 PolarHBondContact O-N 2.85Å; S58-S62 WeakPolarHBondContact O-CB 3.45Å; S58-S62 PolarHBondContact O-N 2.96Å
59	Y	64.6	Low	78.8	Confident	175 Å²	175	95.1 Å²	95.1	69%	0.686	51%	0.51	S	S	*	.	H	α-helix	trans	-69.7	-35.3	-178	-126.1	-88.6	0	0	0	112.1	K56 H57 L63	K56-Y59 WeakPolarHBondContact O-CB 3.33Å; K56-Y59 PolarHBondContact O-N 3.43Å; H57-Y59 PolarHBondContact O-N 3.38Å; H57-Y59 VanDerWaalsContact O-N 3.17Å; Y59-L63 HydrophobicContact CD1-CD1 3.63Å; Y59-L63 HydrophobicContact CE1-CD1 4.12Å; Y59-L63 WeakPolarHBondContact O-CD1 3.28Å; Y59-L63 PolarHBondContact O-N 3.01Å
60	M	72.8	Confident	79.5	Confident	128 Å²	128	93.8 Å²	93.8	63%	0.631	51%	0.508	S	S	*	.	H	α-helix	trans	-69.4	-38.4	176.5	-72.1	176.7	71.7	0	0	112	F39 H57 S58 L63 S64	F39-M60 HydrophobicContact CE1-SD 4.33Å; H57-M60 PolarHBondContact O-N 3.25Å; S58-M60 PolarHBondContact O-N 2.89Å; M60-L63 PolarHBondContact O-N 3.47Å; M60-S64 PolarHBondContact O-N 3.37Å; M60-S64 VanDerWaalsContact O-N 3.14Å
61	W	72.4	Confident	80.4	Confident	184 Å²	184	96.2 Å²	96.2	70%	0.697	50%	0.502	S	S	*	.	H	α-helix	trans	-66.6	-42.9	176.4	-175.1	62.3	0	0	0	111.8	S58 L63 S64 I65	S58-W61 PolarHBondContact O-N 2.85Å; W61-L63 PolarHBondContact O-N 3.49Å; W61-S64 PolarHBondContact O-N 3.27Å; W61-I65 HydrophobicContact CD2-CD1 3.5Å; W61-I65 HydrophobicContact CE3-CD1 3.92Å; W61-I65 HydrophobicContact CG-CD1 4.07Å; W61-I65 HydrophobicContact CH2-CD1 3.79Å; W61-I65 HydrophobicContact CZ2-CD1 3.36Å; W61-I65 HydrophobicContact CZ3-CD1 4.05Å; W61-I65 WeakPolarHBondContact O-CG1 3.39Å; W61-I65 PolarHBondContact O-N 3.42Å
62	S	76.1	Confident	81.5	Confident	73 Å²	73	95.7 Å²	95.7	51%	0.51	50%	0.504	S	S	.	.	H	α-helix	trans	-63.2	-40.5	177	-171.3	0	0	0	0	112.4	S58 I65 G66	S58-S62 WeakPolarHBondContact O-CB 3.45Å; S58-S62 PolarHBondContact O-N 2.96Å; S62-I65 PolarHBondContact O-N 3.35Å; S62-G66 PolarHBondContact O-N 3.32Å
63	L	80.3	Confident	82.3	Confident	114 Å²	114	95.9 Å²	95.9	60%	0.597	51%	0.51	S	S	*	.	H	α-helix	trans	-62.1	-43.7	174.2	-98.1	90.4	0	0	0	112.5	Y59 M60 W61 G66 A67	Y59-L63 HydrophobicContact CD1-CD1 3.63Å; Y59-L63 HydrophobicContact CE1-CD1 4.12Å; Y59-L63 WeakPolarHBondContact O-CD1 3.28Å; Y59-L63 PolarHBondContact O-N 3.01Å; M60-L63 PolarHBondContact O-N 3.47Å; W61-L63 PolarHBondContact O-N 3.49Å; L63-G66 PolarHBondContact O-N 3.47Å; L63-A67 WeakPolarHBondContact O-CB 3.38Å; L63-A67 PolarHBondContact O-N 2.89Å
64	S	85.1	Confident	83.2	Confident	66 Å²	66	93.4 Å²	93.4	46%	0.462	51%	0.508	S	S	.	.	H	α-helix	trans	-63.7	-42.5	179.1	-172.3	0	0	0	0	111.8	M60 W61 A67 L68	M60-S64 PolarHBondContact O-N 3.37Å; M60-S64 VanDerWaalsContact O-N 3.14Å; W61-S64 PolarHBondContact O-N 3.27Å; S64-A67 PolarHBondContact O-N 2.93Å; S64-L68 VanDerWaalsContact O-CG 3.31Å; S64-L68 WeakPolarHBondContact O-CG 3.07Å; S64-L68 PolarHBondContact O-N 2.92Å
65	I	90.1	Very high	84.4	Confident	60 Å²	60	92 Å²	92	31%	0.308	50%	0.504	S	S	.	.	H	α-helix	trans	-66.1	-45.3	177.1	-71.2	166.8	0	0	0	110.7	W61 S62 A67 L68 I69	W61-I65 HydrophobicContact CD2-CD1 3.5Å; W61-I65 HydrophobicContact CE3-CD1 3.92Å; W61-I65 HydrophobicContact CG-CD1 4.07Å; W61-I65 HydrophobicContact CH2-CD1 3.79Å; W61-I65 HydrophobicContact CZ2-CD1 3.36Å; W61-I65 HydrophobicContact CZ3-CD1 4.05Å; W61-I65 WeakPolarHBondContact O-CG1 3.39Å; W61-I65 PolarHBondContact O-N 3.42Å; S62-I65 PolarHBondContact O-N 3.35Å; I65-A67 VanDerWaalsContact C-N 3.3Å; I65-A67 PolarHBondContact O-N 2.87Å; I65-L68 PolarHBondContact O-N 3.33Å; I65-I69 HydrophobicContact CG2-CD1 3.54Å; I65-I69 HydrophobicContact CG2-CG1 4.31Å; I65-I69 VanDerWaalsContact O-CG1 3.28Å; I65-I69 WeakPolarHBondContact O-CG1 3.27Å; I65-I69 PolarHBondContact O-N 2.78Å
66	G	90.3	Very high	85.5	Confident	42 Å²	42	89.7 Å²	89.7	43%	0.433	50%	0.502	S	S	.	.	H	α-helix	trans	-58.6	-42.7	177.3	0	0	0	0	0	112.1	S62 L63 G70	S62-G66 PolarHBondContact O-N 3.32Å; L63-G66 PolarHBondContact O-N 3.47Å; G66-G70 PolarHBondContact O-N 3.41Å
67	A	93.1	Very high	87	Confident	52 Å²	52	87.5 Å²	87.5	43%	0.43	50%	0.501	S	S	.	.	H	α-helix	trans	-65.5	-45.1	176.6	0	0	0	0	0	112.5	L63 S64 I65 I69 G70 L71	L63-A67 WeakPolarHBondContact O-CB 3.38Å; L63-A67 PolarHBondContact O-N 2.89Å; S64-A67 PolarHBondContact O-N 2.93Å; I65-A67 VanDerWaalsContact C-N 3.3Å; I65-A67 PolarHBondContact O-N 2.87Å; A67-I69 PolarHBondContact O-N 3.44Å; A67-G70 PolarHBondContact O-N 2.93Å; A67-L71 VanDerWaalsContact O-CB 3.3Å; A67-L71 WeakPolarHBondContact O-CB 3.35Å; A67-L71 VanDerWaalsContact O-CG 3.31Å; A67-L71 WeakPolarHBondContact O-CG 3.06Å; A67-L71 PolarHBondContact O-N 2.95Å
68	L	94.2	Very high	88.5	Confident	122 Å²	122	90.9 Å²	90.9	64%	0.639	52%	0.52	S	S	*	.	H	α-helix	trans	-59.3	-46	177	-76.5	164.6	0	0	0	111.8	S64 I65 G72	S64-L68 VanDerWaalsContact O-CG 3.31Å; S64-L68 WeakPolarHBondContact O-CG 3.07Å; S64-L68 PolarHBondContact O-N 2.92Å; I65-L68 PolarHBondContact O-N 3.33Å; L68-G72 PolarHBondContact O-N 3.49Å
69	I	96.1	Very high	90	Very high	98 Å²	98	92.6 Å²	92.6	50%	0.503	52%	0.523	S	S	.	.	H	α-helix	trans	-66.5	-46.3	178.4	-63.9	168	0	0	0	110.4	I65 A67 G72 I73	I65-I69 HydrophobicContact CG2-CD1 3.54Å; I65-I69 HydrophobicContact CG2-CG1 4.31Å; I65-I69 VanDerWaalsContact O-CG1 3.28Å; I65-I69 WeakPolarHBondContact O-CG1 3.27Å; I65-I69 PolarHBondContact O-N 2.78Å; A67-I69 PolarHBondContact O-N 3.44Å; I69-G72 PolarHBondContact O-N 3.03Å; I69-I73 HydrophobicContact CG2-CD1 3.8Å; I69-I73 HydrophobicContact CG2-CG1 4.48Å; I69-I73 WeakPolarHBondContact O-CG1 3.05Å; I69-I73 PolarHBondContact O-N 3.28Å
70	G	95.8	Very high	91.6	Very high	39 Å²	39	87.2 Å²	87.2	40%	0.402	52%	0.515	S	S	.	.	H	α-helix	trans	-63	-48.4	-178.9	0	0	0	0	0	113	G66 A67 G72 I73 A74	G66-G70 PolarHBondContact O-N 3.41Å; A67-G70 PolarHBondContact O-N 2.93Å; G70-G72 VanDerWaalsContact C-N 3.32Å; G70-G72 PolarHBondContact O-N 3.44Å; G70-I73 PolarHBondContact O-N 2.93Å; G70-A74 WeakPolarHBondContact O-CB 3.38Å; G70-A74 PolarHBondContact O-N 3.5Å
71	L	95.9	Very high	92.8	Very high	128 Å²	128	87.8 Å²	87.8	67%	0.67	51%	0.514	S	S	*	.	H	α-helix	trans	-64.7	-37.5	175.7	-69.4	174.6	0	0	0	111.6	A67 A74 A75	A67-L71 VanDerWaalsContact O-CB 3.3Å; A67-L71 WeakPolarHBondContact O-CB 3.35Å; A67-L71 VanDerWaalsContact O-CG 3.31Å; A67-L71 WeakPolarHBondContact O-CG 3.06Å; A67-L71 PolarHBondContact O-N 2.95Å; L71-A74 PolarHBondContact O-N 3.14Å; L71-A75 VanDerWaalsContact O-CB 3.27Å; L71-A75 WeakPolarHBondContact O-CB 2.96Å; L71-A75 PolarHBondContact O-N 3.22Å
72	G	97.8	Very high	94	Very high	32 Å²	32	82.8 Å²	82.8	33%	0.33	50%	0.504	S	S	.	.	H	α-helix	trans	-60.4	-50.8	175.1	0	0	0	0	0	112.2	L68 I69 G70 A75 L76	L68-G72 PolarHBondContact O-N 3.49Å; I69-G72 PolarHBondContact O-N 3.03Å; G70-G72 VanDerWaalsContact C-N 3.32Å; G70-G72 PolarHBondContact O-N 3.44Å; G72-A75 PolarHBondContact O-N 3.48Å; G72-L76 WeakPolarHBondContact O-CB 3.41Å; G72-L76 VanDerWaalsContact O-CG 3.28Å; G72-L76 WeakPolarHBondContact O-CG 3.37Å; G72-L76 PolarHBondContact O-N 2.89Å
73	I	97.9	Very high	95	Very high	99 Å²	99	83.6 Å²	83.6	51%	0.508	50%	0.502	S	S	.	.	H	α-helix	trans	-63	-45.2	178	-65.3	168	0	0	0	110.6	I69 G70 A75 L76 V77	I69-I73 HydrophobicContact CG2-CD1 3.8Å; I69-I73 HydrophobicContact CG2-CG1 4.48Å; I69-I73 WeakPolarHBondContact O-CG1 3.05Å; I69-I73 PolarHBondContact O-N 3.28Å; G70-I73 PolarHBondContact O-N 2.93Å; I73-A75 VanDerWaalsContact C-N 3.33Å; I73-A75 PolarHBondContact O-N 3.06Å; I73-L76 PolarHBondContact O-N 2.97Å; I73-V77 HydrophobicContact CG2-CG2 4.25Å; I73-V77 VanDerWaalsContact O-CG2 3.29Å; I73-V77 WeakPolarHBondContact O-CG2 3.28Å; I73-V77 PolarHBondContact O-N 3.4Å
74	A	97.7	Very high	95.7	Very high	48 Å²	48	81.2 Å²	81.2	40%	0.397	49%	0.494	S	S	.	.	H	α-helix	trans	-58.3	-46	177.8	0	0	0	0	0	111.7	G70 L71 V77 L78	G70-A74 WeakPolarHBondContact O-CB 3.38Å; G70-A74 PolarHBondContact O-N 3.5Å; L71-A74 PolarHBondContact O-N 3.14Å; A74-V77 PolarHBondContact O-N 3.02Å; A74-L78 WeakPolarHBondContact O-CB 3.25Å; A74-L78 VanDerWaalsContact O-CG 3.32Å; A74-L78 WeakPolarHBondContact O-CG 3.17Å; A74-L78 PolarHBondContact O-N 3.29Å
75	A	97.9	Very high	96.3	Very high	58 Å²	58	81 Å²	81	48%	0.479	49%	0.49	S	S	.	.	H	α-helix	trans	-63.4	-43.3	177.2	0	0	0	0	0	112.2	L71 G72 I73 L78 L79	L71-A75 VanDerWaalsContact O-CB 3.27Å; L71-A75 WeakPolarHBondContact O-CB 2.96Å; L71-A75 PolarHBondContact O-N 3.22Å; G72-A75 PolarHBondContact O-N 3.48Å; I73-A75 VanDerWaalsContact C-N 3.33Å; I73-A75 PolarHBondContact O-N 3.06Å; A75-L78 PolarHBondContact O-N 3.48Å; A75-L79 VanDerWaalsContact O-CB 3.27Å; A75-L79 WeakPolarHBondContact O-CB 3.39Å; A75-L79 PolarHBondContact O-N 3.11Å
76	L	97.8	Very high	96.5	Very high	120 Å²	120	81.8 Å²	81.8	63%	0.628	50%	0.5	S	S	*	.	H	α-helix	trans	-62.5	-43	177.3	-73.8	173.1	0	0	0	112.3	G72 I73 L79 A80	G72-L76 WeakPolarHBondContact O-CB 3.41Å; G72-L76 VanDerWaalsContact O-CG 3.28Å; G72-L76 WeakPolarHBondContact O-CG 3.37Å; G72-L76 PolarHBondContact O-N 2.89Å; I73-L76 PolarHBondContact O-N 2.97Å; L76-L79 PolarHBondContact O-N 3.39Å; L76-A80 WeakPolarHBondContact O-CB 3.16Å; L76-A80 PolarHBondContact O-N 3.4Å
77	V	98.4	Very high	96.7	Very high	94 Å²	94	83.1 Å²	83.1	57%	0.57	50%	0.499	S	S	*	.	H	α-helix	trans	-64.9	-44.9	177.8	171.3	0	0	0	0	111	I73 A74 A80 F81	I73-V77 HydrophobicContact CG2-CG2 4.25Å; I73-V77 VanDerWaalsContact O-CG2 3.29Å; I73-V77 WeakPolarHBondContact O-CG2 3.28Å; I73-V77 PolarHBondContact O-N 3.4Å; A74-V77 PolarHBondContact O-N 3.02Å; V77-A80 PolarHBondContact O-N 3.17Å; V77-F81 PolarHBondContact O-N 3.39Å
78	L	98.1	Very high	96.6	Very high	117 Å²	117	85.9 Å²	85.9	61%	0.613	51%	0.507	S	S	*	.	H	α-helix	trans	-62.2	-44.8	175.9	-72.5	174.7	0	0	0	111.6	A74 A75 A80 F81 V82	A74-L78 WeakPolarHBondContact O-CB 3.25Å; A74-L78 VanDerWaalsContact O-CG 3.32Å; A74-L78 WeakPolarHBondContact O-CG 3.17Å; A74-L78 PolarHBondContact O-N 3.29Å; A75-L78 PolarHBondContact O-N 3.48Å; L78-A80 VanDerWaalsContact C-N 3.35Å; L78-A80 PolarHBondContact O-N 3.47Å; L78-F81 PolarHBondContact O-N 2.84Å; L78-V82 WeakPolarHBondContact O-CG2 3.47Å; L78-V82 PolarHBondContact O-N 2.94Å
79	L	97.6	Very high	96.3	Very high	96 Å²	96	83.4 Å²	83.4	50%	0.503	50%	0.498	S	S	.	.	H	α-helix	trans	-61.2	-44.5	177.6	-179.2	61.4	0	0	0	111.2	A75 L76 F81 V82 I83	A75-L79 VanDerWaalsContact O-CB 3.27Å; A75-L79 WeakPolarHBondContact O-CB 3.39Å; A75-L79 PolarHBondContact O-N 3.11Å; L76-L79 PolarHBondContact O-N 3.39Å; L79-F81 VanDerWaalsContact C-N 3.32Å; L79-F81 PolarHBondContact O-N 2.91Å; L79-V82 PolarHBondContact O-N 3.19Å; L79-I83 HydrophobicContact CD1-CD1 3.95Å; L79-I83 HydrophobicContact CD1-CG1 4.18Å; L79-I83 HydrophobicContact CD2-CD1 4.47Å; L79-I83 HydrophobicContact CG-CD1 3.77Å; L79-I83 HydrophobicContact CG-CG1 4.41Å; L79-I83 WeakPolarHBondContact O-CB 3.24Å; L79-I83 VanDerWaalsContact O-CG1 3.23Å; L79-I83 WeakPolarHBondContact O-CG1 3.45Å; L79-I83 PolarHBondContact O-N 3.09Å
80	A	97.8	Very high	96.1	Very high	61 Å²	61	85.4 Å²	85.4	50%	0.504	50%	0.501	S	S	.	.	H	α-helix	trans	-60.3	-41.6	176.2	0	0	0	0	0	112	L76 V77 L78 S84	L76-A80 WeakPolarHBondContact O-CB 3.16Å; L76-A80 PolarHBondContact O-N 3.4Å; V77-A80 PolarHBondContact O-N 3.17Å; L78-A80 VanDerWaalsContact C-N 3.35Å; L78-A80 PolarHBondContact O-N 3.47Å; A80-S84 VanDerWaalsContact O-CB 3.3Å; A80-S84 WeakPolarHBondContact O-CB 3.33Å; A80-S84 PolarHBondContact O-N 3.41Å
81	F	98	Very high	95.7	Very high	140 Å²	140	87.3 Å²	87.3	61%	0.614	50%	0.501	S	S	*	.	H	α-helix	trans	-63.4	-47.3	176	-179.4	-100.9	0	0	0	111.9	V77 L78 L79 I83 S84 V85	V77-F81 PolarHBondContact O-N 3.39Å; L78-F81 PolarHBondContact O-N 2.84Å; L79-F81 VanDerWaalsContact C-N 3.32Å; L79-F81 PolarHBondContact O-N 2.91Å; F81-I83 PolarHBondContact O-N 2.01Å; F81-S84 WeakPolarHBondContact O-CB 3.38Å; F81-S84 PolarHBondContact O-N 2.84Å; F81-V85 HydrophobicContact CD1-CG2 4.43Å; F81-V85 HydrophobicContact CE1-CG2 4.02Å; F81-V85 HydrophobicContact CE2-CG2 4.29Å; F81-V85 HydrophobicContact CZ-CG2 3.94Å; F81-V85 WeakPolarHBondContact O-CG2 3.03Å; F81-V85 PolarHBondContact O-N 2.91Å
82	V	97.8	Very high	95	Very high	79 Å²	79	87.6 Å²	87.6	48%	0.479	50%	0.498	S	S	.	.	H	α-helix	trans	-60.7	-46.9	177.5	173.2	0	0	0	0	110.9	L78 L79 S84 V85 C86	L78-V82 WeakPolarHBondContact O-CG2 3.47Å; L78-V82 PolarHBondContact O-N 2.94Å; L79-V82 PolarHBondContact O-N 3.19Å; V82-S84 VanDerWaalsContact C-N 3.33Å; V82-S84 PolarHBondContact O-N 3.01Å; V82-V85 PolarHBondContact O-N 2.99Å; V82-C86 WeakPolarHBondContact O-CB 3.46Å; V82-C86 PolarHBondContact O-N 2.03Å; V82-C86 PolarHBondContact O-SG 2.96Å
83	I	97.2	Very high	94.2	Very high	91 Å²	91	92.4 Å²	92.4	47%	0.467	52%	0.515	S	S	.	.	H	α-helix	trans	-59.6	-45.5	176.7	-68.2	168.4	0	0	0	110.3	L79 F81 V85 C86 V87	L79-I83 HydrophobicContact CD1-CD1 3.95Å; L79-I83 HydrophobicContact CD1-CG1 4.18Å; L79-I83 HydrophobicContact CD2-CD1 4.47Å; L79-I83 HydrophobicContact CG-CD1 3.77Å; L79-I83 HydrophobicContact CG-CG1 4.41Å; L79-I83 WeakPolarHBondContact O-CB 3.24Å; L79-I83 VanDerWaalsContact O-CG1 3.23Å; L79-I83 WeakPolarHBondContact O-CG1 3.45Å; L79-I83 PolarHBondContact O-N 3.09Å; F81-I83 PolarHBondContact O-N 2.01Å; I83-V85 PolarHBondContact O-N 3.17Å; I83-C86 PolarHBondContact O-N 2.87Å; I83-V87 HydrophobicContact CG2-CG2 4.11Å; I83-V87 WeakPolarHBondContact O-CB 3.45Å; I83-V87 VanDerWaalsContact O-CG2 3.27Å; I83-V87 WeakPolarHBondContact O-CG2 3.43Å; I83-V87 PolarHBondContact O-N 3.19Å
84	S	96.1	Very high	93.2	Very high	64 Å²	64	95.8 Å²	95.8	45%	0.448	52%	0.522	S	S	.	.	H	α-helix	trans	-57.7	-48.1	178.3	-178.2	0	0	0	0	111.6	A80 F81 V82 V87 L88	A80-S84 VanDerWaalsContact O-CB 3.3Å; A80-S84 WeakPolarHBondContact O-CB 3.33Å; A80-S84 PolarHBondContact O-N 3.41Å; F81-S84 WeakPolarHBondContact O-CB 3.38Å; F81-S84 PolarHBondContact O-N 2.84Å; V82-S84 VanDerWaalsContact C-N 3.33Å; V82-S84 PolarHBondContact O-N 3.01Å; S84-V87 PolarHBondContact O-N 3.1Å; S84-L88 WeakPolarHBondContact O-CB 3.45Å; S84-L88 VanDerWaalsContact O-CG 3.26Å; S84-L88 WeakPolarHBondContact O-CG 3.01Å; S84-L88 PolarHBondContact O-N 2.93Å
85	V	96.4	Very high	91.7	Very high	62 Å²	62	97.6 Å²	97.6	38%	0.376	53%	0.529	S	S	.	.	H	α-helix	trans	-62.9	-45.7	176.5	175.2	0	0	0	0	111.1	F81 V82 I83 V87 L88 C89	F81-V85 HydrophobicContact CD1-CG2 4.43Å; F81-V85 HydrophobicContact CE1-CG2 4.02Å; F81-V85 HydrophobicContact CE2-CG2 4.29Å; F81-V85 HydrophobicContact CZ-CG2 3.94Å; F81-V85 WeakPolarHBondContact O-CG2 3.03Å; F81-V85 PolarHBondContact O-N 2.91Å; V82-V85 PolarHBondContact O-N 2.99Å; I83-V85 PolarHBondContact O-N 3.17Å; V85-V87 VanDerWaalsContact C-N 3.34Å; V85-V87 PolarHBondContact O-N 2.94Å; V85-L88 PolarHBondContact O-N 2.93Å; V85-C89 WeakPolarHBondContact O-CB 3.44Å; V85-C89 PolarHBondContact O-N 2.82Å; V85-C89 PolarHBondContact O-SG 3Å
86	C	94.1	Very high	89.5	Confident	75 Å²	75	102.6 Å²	102.6	51%	0.507	54%	0.54	S	S	.	.	H	α-helix	trans	-59.8	-43.1	177.9	-72.3	0	0	0	0	112.3	V82 I83 C89 Y90	V82-C86 WeakPolarHBondContact O-CB 3.46Å; V82-C86 PolarHBondContact O-N 2.03Å; V82-C86 PolarHBondContact O-SG 2.96Å; I83-C86 PolarHBondContact O-N 2.87Å; C86-C89 PolarHBondContact O-N 3.2Å; C86-Y90 VanDerWaalsContact O-CB 3.24Å; C86-Y90 WeakPolarHBondContact O-CB 3.42Å; C86-Y90 PolarHBondContact O-N 2.91Å
87	V	94.9	Very high	87.7	Confident	70 Å²	70	101.4 Å²	101.4	42%	0.424	54%	0.539	S	S	.	.	H	α-helix	trans	-66.3	-42.1	176.7	171.7	0	0	0	0	110.5	I83 S84 V85 Y90 L91	I83-V87 HydrophobicContact CG2-CG2 4.11Å; I83-V87 WeakPolarHBondContact O-CB 3.45Å; I83-V87 VanDerWaalsContact O-CG2 3.27Å; I83-V87 WeakPolarHBondContact O-CG2 3.43Å; I83-V87 PolarHBondContact O-N 3.19Å; S84-V87 PolarHBondContact O-N 3.1Å; V85-V87 VanDerWaalsContact C-N 3.34Å; V85-V87 PolarHBondContact O-N 2.94Å; V87-Y90 PolarHBondContact O-N 3.44Å; V87-L91 HydrophobicContact CG1-CD1 3.78Å; V87-L91 HydrophobicContact CG1-CG 4.12Å; V87-L91 VanDerWaalsContact O-CB 3.27Å; V87-L91 WeakPolarHBondContact O-CB 3.48Å; V87-L91 VanDerWaalsContact O-CG 3.24Å; V87-L91 WeakPolarHBondContact O-CG 3.11Å; V87-L91 PolarHBondContact O-N 2.04Å
88	L	90.4	Very high	85.6	Confident	111 Å²	111	105.9 Å²	105.9	58%	0.581	55%	0.554	S	S	*	*	H	α-helix	trans	-62.9	-43.1	175.3	-71.4	174.3	0	0	0	111.8	S84 V85 F92	S84-L88 WeakPolarHBondContact O-CB 3.45Å; S84-L88 VanDerWaalsContact O-CG 3.26Å; S84-L88 WeakPolarHBondContact O-CG 3.01Å; S84-L88 PolarHBondContact O-N 2.93Å; V85-L88 PolarHBondContact O-N 2.93Å; L88-F92 VanDerWaalsContact O-CB 3.24Å; L88-F92 WeakPolarHBondContact O-CB 3.42Å; L88-F92 PolarHBondContact O-N 2.88Å
89	C	88.6	Confident	83.4	Confident	69 Å²	69	110.1 Å²	110.1	47%	0.466	56%	0.562	S	S	.	*	H	α-helix	trans	-64.2	-44.3	174.6	-68.4	0	0	0	0	111.5	V85 C86 F92 L93	V85-C89 WeakPolarHBondContact O-CB 3.44Å; V85-C89 PolarHBondContact O-N 2.82Å; V85-C89 PolarHBondContact O-SG 3Å; C86-C89 PolarHBondContact O-N 3.2Å; C89-F92 PolarHBondContact O-N 2.76Å; C89-L93 WeakPolarHBondContact O-CG 3.42Å; C89-L93 PolarHBondContact O-N 3.1Å
90	Y	91.6	Very high	81.3	Confident	140 Å²	140	113.2 Å²	113.2	55%	0.549	58%	0.578	S	S	.	*	H	α-helix	trans	-63.8	-47.5	178	179	-95.8	0	0	0	111.6	C86 V87 F92 L93 Y94	C86-Y90 VanDerWaalsContact O-CB 3.24Å; C86-Y90 WeakPolarHBondContact O-CB 3.42Å; C86-Y90 PolarHBondContact O-N 2.91Å; V87-Y90 PolarHBondContact O-N 3.44Å; Y90-F92 VanDerWaalsContact C-N 3.31Å; Y90-F92 PolarHBondContact O-N 3.16Å; Y90-L93 PolarHBondContact O-N 2.84Å; Y90-Y94 HydrophobicContact CE1-CD2 4.47Å; Y90-Y94 HydrophobicContact CE1-CG 4.31Å; Y90-Y94 WeakPolarHBondContact O-CB 3.39Å; Y90-Y94 PolarHBondContact O-N 2.95Å
91	L	87.3	Confident	79.1	Confident	80 Å²	80	116.7 Å²	116.7	42%	0.419	59%	0.588	S	S	.	*	H	α-helix	trans	-60.6	-42.4	174.5	-72.6	175.3	0	0	0	110.2	V87 L93 Y94 T95	V87-L91 HydrophobicContact CG1-CD1 3.78Å; V87-L91 HydrophobicContact CG1-CG 4.12Å; V87-L91 VanDerWaalsContact O-CB 3.27Å; V87-L91 WeakPolarHBondContact O-CB 3.48Å; V87-L91 VanDerWaalsContact O-CG 3.24Å; V87-L91 WeakPolarHBondContact O-CG 3.11Å; V87-L91 PolarHBondContact O-N 2.04Å; L91-L93 VanDerWaalsContact C-N 3.29Å; L91-L93 PolarHBondContact O-N 2.8Å; L91-Y94 PolarHBondContact O-N 3.49Å; L91-T95 WeakPolarHBondContact O-CA 3.15Å; L91-T95 VanDerWaalsContact O-CB 3.24Å; L91-T95 WeakPolarHBondContact O-CB 3.47Å; L91-T95 VanDerWaalsContact O-CG2 3.28Å; L91-T95 WeakPolarHBondContact O-CG2 3.36Å; L91-T95 PolarHBondContact O-N 2.98Å; L91-T95 PolarHBondContact O-OG1 2.77Å
92	F	82.2	Confident	76.9	Confident	134 Å²	134	116.5 Å²	116.5	59%	0.588	60%	0.599	S	S	*	*	H	α-helix	trans	-62	-36.9	176.5	-172	-100.2	0	0	0	113	L88 C89 Y90	L88-F92 VanDerWaalsContact O-CB 3.24Å; L88-F92 WeakPolarHBondContact O-CB 3.42Å; L88-F92 PolarHBondContact O-N 2.88Å; C89-F92 PolarHBondContact O-N 2.76Å; Y90-F92 VanDerWaalsContact C-N 3.31Å; Y90-F92 PolarHBondContact O-N 3.16Å
93	L	80.3	Confident	74.5	Confident	132 Å²	132	116 Å²	116	69%	0.691	61%	0.61	S	S	*	*	H	α-helix	trans	-72.7	-37.9	175.4	-67.3	169.9	0	0	0	112.2	C89 Y90 L91	C89-L93 WeakPolarHBondContact O-CG 3.42Å; C89-L93 PolarHBondContact O-N 3.1Å; Y90-L93 PolarHBondContact O-N 2.84Å; L91-L93 VanDerWaalsContact C-N 3.29Å; L91-L93 PolarHBondContact O-N 2.8Å
94	Y	76.3	Confident	72.3	Confident	170 Å²	170	119.1 Å²	119.1	67%	0.667	63%	0.626	S	S	*	*	H	α-helix	trans	-82.5	-37.8	-176.8	-170.1	-96.3	0	0	0	112.8	Y90 L91 K96	Y90-Y94 HydrophobicContact CE1-CD2 4.47Å; Y90-Y94 HydrophobicContact CE1-CG 4.31Å; Y90-Y94 WeakPolarHBondContact O-CB 3.39Å; Y90-Y94 PolarHBondContact O-N 2.95Å; L91-Y94 PolarHBondContact O-N 3.49Å; Y94-K96 PolarHBondContact O-N 3.41Å
95	T	66.6	Low	70.2	Confident	87 Å²	87	125.5 Å²	125.5	53%	0.534	65%	0.646	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.3	28.8	172.8	76.3	0	0	0	0	111.7	L91 P97	L91-T95 WeakPolarHBondContact O-CA 3.15Å; L91-T95 VanDerWaalsContact O-CB 3.24Å; L91-T95 WeakPolarHBondContact O-CB 3.47Å; L91-T95 VanDerWaalsContact O-CG2 3.28Å; L91-T95 WeakPolarHBondContact O-CG2 3.36Å; L91-T95 PolarHBondContact O-N 2.98Å; L91-T95 PolarHBondContact O-OG1 2.77Å; T95-P97 WeakPolarHBondContact O-CD 3.49Å
96	K	52.9	Low	67.8	Low	163 Å²	163	129.4 Å²	129.4	71%	0.709	66%	0.664	S	S	*	*			trans	-80.9	87.9	149.1	-93.1	-151.9	179	-174.1	0	108.7	Y94	Y94-K96 PolarHBondContact O-N 3.41Å
97	P	59.3	Low	65.7	Low	95 Å²	95	134.1 Å²	134.1	62%	0.617	68%	0.678	S	S	*	*			trans	-72	132.3	135.2	34.3	-24.5	0	0	0	105.6	T95 R99	T95-P97 WeakPolarHBondContact O-CD 3.49Å; P97-R99 VanDerWaalsContact C-N 3.27Å; P97-R99 PolarHBondContact O-N 2.87Å
98	Q	54.3	Low	63	Low	187 Å²	187	138.6 Å²	138.6	87%	0.874	70%	0.695	S	S	*	*	S	Bend	trans	-25.3	69.6	159.5	-164	-165.4	15.8	0	0	116.1
99	R	52.3	Low	61	Low	207 Å²	207	140.7 Å²	140.7	78%	0.781	71%	0.705	S	S	*	*			trans	-157.8	35.5	-170.7	-108	-64.9	160.1	131.8	-2.1	116.7	P97	P97-R99 VanDerWaalsContact C-N 3.27Å; P97-R99 PolarHBondContact O-N 2.87Å
100	L	52.2	Low	58.4	Low	160 Å²	160	144.7 Å²	144.7	84%	0.838	72%	0.717	S	S	*	*			trans	-111.8	22.1	155.7	-78.1	173.4	0	0	0	112.6
101	D	51.6	Low	55.7	Low	134 Å²	134	142.4 Å²	142.4	72%	0.717	73%	0.728	S	S	*	*	S	Bend	trans	-94.2	95.6	164.1	-71.5	-57.6	0	0	0	109.7
102	T	52	Low	53.1	Low	137 Å²	137	143.6 Å²	143.6	84%	0.84	74%	0.743	S	S	*	*			trans	49.8	75.1	132.7	-26.4	0	0	0	0	116.9
103	G	47.6	Very low	50.9	Low	69 Å²	69	141.9 Å²	141.9	71%	0.711	75%	0.747	S	S	*	*			trans	-122.5	14.8	169.8	0	0	0	0	0	114.4	K105	G103-K105 VanDerWaalsContact C-N 3.26Å; G103-K105 PolarHBondContact O-N 3.12Å
104	L	51	Low	48.4	Very low	155 Å²	155	141.2 Å²	141.2	81%	0.812	75%	0.748	S	S	*	*			trans	-72	87.9	170.6	-154.4	75.5	0	0	0	107.6	L106	L104-L106 PolarHBondContact O-N 3.34Å
105	K	51.5	Low	46.4	Very low	198 Å²	198	140.8 Å²	140.8	86%	0.861	75%	0.753	S	S	*	*			trans	-63.2	80.2	165.9	-100.7	-89	-178.8	172.9	0	107.8	G103 Q107	G103-K105 VanDerWaalsContact C-N 3.26Å; G103-K105 PolarHBondContact O-N 3.12Å; K105-Q107 PolarHBondContact O-N 3.01Å
106	L	47.7	Very low	44.6	Very low	145 Å²	145	145.1 Å²	145.1	76%	0.759	77%	0.767	S	S	*	*			trans	-54.2	110.1	157.6	-106.2	147.4	0	0	0	106.1	L104 H108	L104-L106 PolarHBondContact O-N 3.34Å; L106-H108 PolarHBondContact O-N 2.94Å
107	Q	49	Very low	43.3	Very low	173 Å²	173	141.1 Å²	141.1	81%	0.808	77%	0.772	S	S	*	*			trans	-56.3	103.7	168.5	-75.3	174.1	-11.3	0	0	107.1	K105 L109	K105-Q107 PolarHBondContact O-N 3.01Å; Q107-L109 PolarHBondContact O-N 2.83Å
108	H	38.7	Very low	42	Very low	165 Å²	165	146.1 Å²	146.1	76%	0.764	78%	0.784	S	S	*	*			trans	-71.8	85.9	165.9	-172	-84.7	0	0	0	107.4	L106 E110	L106-H108 PolarHBondContact O-N 2.94Å; H108-E110 PolarHBondContact CE1-O 3.06Å; H108-E110 PolarHBondContact ND1-O 3.15Å; H108-E110 PolarHBondContact O-N 3.14Å
109	L	47.3	Very low	41	Very low	154 Å²	154	142.9 Å²	142.9	81%	0.806	78%	0.782	S	S	*	*			trans	-81.4	94.6	158.1	-100.4	169.2	0	0	0	107.5	Q107	Q107-L109 PolarHBondContact O-N 2.83Å
110	E	34.7	Very low	39.9	Very low	153 Å²	153	140.1 Å²	140.1	72%	0.715	78%	0.783	S	S	*	*			trans	-171.2	100.4	146.3	-111	-178.1	139.5	0	0	105.6	H108	H108-E110 PolarHBondContact CE1-O 3.06Å; H108-E110 PolarHBondContact ND1-O 3.15Å; H108-E110 PolarHBondContact O-N 3.14Å
111	A	35.2	Very low	39	Very low	93 Å²	93	139.7 Å²	139.7	77%	0.769	78%	0.776	S	S	*	*				90.8	143.2	86.6	0	0	0	0	0	111.8
112	S	32.2	Very low	38	Very low	105 Å²	105	141 Å²	141	73%	0.734	78%	0.776	S	S	*	*			trans	84.8	88.8	165.6	-175.6	0	0	0	0	118.3
113	S	36.5	Very low	37	Very low	97 Å²	97	140.5 Å²	140.5	68%	0.678	77%	0.772	S	S	*	*				38.3	140.2	120.7	63	0	0	0	0	121.8
114	T	28	Very low	36.2	Very low	118 Å²	118	146.7 Å²	146.7	72%	0.724	78%	0.78	S	S	*	*			trans	113.3	100.6	140.6	-50.8	0	0	0	0	116
115	Q	33.5	Very low	35.4	Very low	161 Å²	161	143.5 Å²	143.5	75%	0.752	78%	0.776	S	S	*	*				43	138.4	127.8	-105.7	-178	-27.9	0	0	122.7
116	E	28.2	Very low	34.8	Very low	179 Å²	179	141.5 Å²	141.5	84%	0.836	77%	0.774	S	S	*	*			trans	79	135.9	142.9	-73.6	-165.7	94.8	0	0	120.9
117	G	27.4	Very low	34.1	Very low	79 Å²	79	141.3 Å²	141.3	81%	0.814	77%	0.773	S	S	*	*			trans	148.3	80.7	153.7	0	0	0	0	0	116.9
118	K	30.7	Very low	33.9	Very low	199 Å²	199	136.8 Å²	136.8	87%	0.865	76%	0.761	S	S	*	*			trans	-50.1	146.8	158.3	-105.2	-178.2	171.4	179.1	0	111.9
119	S	34.2	Very low	33.9	Very low	119 Å²	119	136.4 Å²	136.4	83%	0.832	77%	0.765	S	S	*	*				-177.2	151.7	124	48.3	0	0	0	0	113.2
120	N	29.1	Very low	33.5	Very low	149 Å²	149	134 Å²	134	80%	0.797	77%	0.767	S	S	*	*			trans	-92	172.4	-169.3	-62.7	-61.3	0	0	0	112.8
121	E	32.8	Very low	33.5	Very low	152 Å²	152	130.8 Å²	130.8	71%	0.71	77%	0.766	S	S	*	*				118.4	128.6	128.6	-148.4	-178.6	130.9	0	0	118.8
122	K	29.8	Very low	33.7	Very low	162 Å²	162	131.3 Å²	131.3	70%	0.704	76%	0.764	S	S	*	*			trans	83.8	104.6	144.8	-104.9	174.5	-171.8	135	0	122.3
123	T	30.9	Very low	33.9	Very low	125 Å²	125	133.4 Å²	133.4	77%	0.767	77%	0.768	S	S	*	*				50.3	121.4	110.5	-40.1	0	0	0	0	118.5
124	K	32.4	Very low	33.9	Very low	199 Å²	199	132.8 Å²	132.8	87%	0.865	77%	0.768	S	S	*	*				-177.7	133.2	98.1	-149.1	176.3	-178	-158.1	0	111.9
125	A	33.2	Very low	34.3	Very low	88 Å²	88	132.9 Å²	132.9	73%	0.727	77%	0.769	S	S	*	*			trans	-75.4	153.7	171.4	0	0	0	0	0	112.6
126	L	38.6	Very low	34.7	Very low	157 Å²	157	132 Å²	132	82%	0.822	77%	0.769	S	S	*	*			trans	67.7	118.8	145.8	-153.2	75.5	0	0	0	119.3
127	N	34.5	Very low	35.2	Very low	140 Å²	140	132 Å²	132	75%	0.749	77%	0.769	S	S	*	*			trans	-146.2	114.3	136.8	-173.9	2.4	0	0	0	109.9
128	S	43.8	Very low	35.5	Very low	79 Å²	79	135 Å²	135	55%	0.552	77%	0.772	S	S	*	*			trans	-74	140.8	171.6	-52.4	0	0	0	0	110.6
129	N	39.2	Very low	35.3	Very low	156 Å²	156	134.9 Å²	134.9	83%	0.834	77%	0.768	S	S	*	*			trans	-144	108.6	148.2	-76	-41	0	0	0	108.7
130	A	38.9	Very low	35.2	Very low	103 Å²	103	138.1 Å²	138.1	85%	0.851	76%	0.763	S	S	*	*			trans	-90.8	136.5	168	0	0	0	0	0	109.3
131	A	34.9	Very low	35.4	Very low	86 Å²	86	140.1 Å²	140.1	71%	0.711	77%	0.767	S	S	*	*			trans	167.9	104	141.9	0	0	0	0	0	106.9
132	S	38.4	Very low	35.6	Very low	104 Å²	104	137.3 Å²	137.3	73%	0.727	77%	0.77	S	S	*	*				77.2	126	102.5	-47.4	0	0	0	0	110.8
133	N	37.1	Very low	35.8	Very low	150 Å²	150	136.5 Å²	136.5	80%	0.802	77%	0.774	S	S	*	*				-169.2	140.4	71.4	-58.1	-33.3	0	0	0	111.5
134	A	37.1	Very low	36	Very low	84 Å²	84	137 Å²	137	69%	0.694	77%	0.772	S	S	*	*			trans	57	109.8	138.3	0	0	0	0	0	121.4
135	T	35.4	Very low	36.3	Very low	119 Å²	119	134.5 Å²	134.5	73%	0.73	77%	0.766	S	S	*	*				68.4	123.4	98	-11.7	0	0	0	0	112.2
136	N	41.9	Very low	36.6	Very low	143 Å²	143	137.1 Å²	137.1	77%	0.765	77%	0.767	S	S	*	*			cis	-154.7	132.9	46.9	-36.6	-40.4	0	0	0	111
137	E	38.3	Very low	36.3	Very low	178 Å²	178	138.1 Å²	138.1	83%	0.832	77%	0.767	S	S	*	*			trans	-93.2	134.6	157.1	31.6	-115.8	99.5	0	0	109.7
138	T	33.7	Very low	36.4	Very low	143 Å²	143	139 Å²	139	88%	0.877	77%	0.767	S	S	*	*			trans	-146.3	126.9	150.8	-34.5	0	0	0	0	111.4
139	Y	28.1	Very low	35.8	Very low	196 Å²	196	144.3 Å²	144.3	77%	0.769	78%	0.78	S	S	*	*			trans	-59.9	165.4	-179.3	-167.9	-95.9	0	0	0	115.5
140	Y	32	Very low	35.4	Very low	187 Å²	187	141.8 Å²	141.8	73%	0.733	77%	0.77	S	S	*	*			trans	-36.5	154.1	173.8	-57	-96.1	0	0	0	118
141	E	32.2	Very low	35.2	Very low	191 Å²	191	145.4 Å²	145.4	89%	0.893	77%	0.772	S	S	*	*			trans	-142.1	133.6	135.6	-156.7	122.3	117.3	0	0	110
142	A	37	Very low	35.1	Very low	93 Å²	93	148.1 Å²	148.1	77%	0.769	77%	0.774	S	S	*	*			trans	-99.4	146.9	175.4	0	0	0	0	0	109
143	D	35.1	Very low	35.1	Very low	146 Å²	146	146.7 Å²	146.7	78%	0.781	77%	0.769	S	S	*	*			trans	-141.3	111.9	168.1	-128.9	-51.8	0	0	0	110.3
144	D	35.2	Very low	35.1	Very low	135 Å²	135	145.3 Å²	145.3	72%	0.722	77%	0.766	S	S	*	*			trans	-130.8	116.2	169.1	-167.6	-70.4	0	0	0	105.8
145	I	38	Very low	35.3	Very low	146 Å²	146	148.8 Å²	148.8	75%	0.749	77%	0.768	S	S	*	*			trans	-135.7	107	164.8	-61	-172.6	0	0	0	109
146	I	39.2	Very low	35.6	Very low	144 Å²	144	151.6 Å²	151.6	74%	0.738	78%	0.776	S	S	*	*			trans	-68	130.7	157.1	-64.6	168.8	0	0	0	108.8
147	Q	33.3	Very low	35.6	Very low	177 Å²	177	153.6 Å²	153.6	83%	0.827	78%	0.775	S	S	*	*			trans	-135.6	111.3	149.7	-156	-165.8	87.5	0	0	111
148	E	36.5	Very low	35.8	Very low	160 Å²	160	152 Å²	152	75%	0.748	77%	0.77	S	S	*	*			trans	-67.9	132.9	162.8	178.7	-164.2	126.2	0	0	110.5
149	K	29.8	Very low	36	Very low	189 Å²	189	148 Å²	148	82%	0.822	75%	0.752	S	S	*	*			trans	-155.9	103.6	145.9	-158.3	173.7	179.5	-178.9	0	113.5
150	T	31.7	Very low	36.6	Very low	104 Å²	104	153.4 Å²	153.4	64%	0.638	77%	0.773	S	S	*	*			trans	-1.7	123.5	147.7	-33	0	0	0	0	120
151	M	35.1	Very low	36.8	Very low	178 Å²	178	151.7 Å²	151.7	88%	0.877	78%	0.775	S	S	*	*			trans	33.2	121.3	131	-140.8	158.1	91.3	0	0	119.7
152	D	31.8	Very low	37.1	Very low	144 Å²	144	149.6 Å²	149.6	77%	0.77	77%	0.769	S	S	*	*				-163.3	152	115.3	-163.5	34.8	0	0	0	112.3
153	A	38.2	Very low	37.1	Very low	74 Å²	74	152.8 Å²	152.8	61%	0.612	77%	0.769	S	S	*	*			trans	-64.4	178.6	179.1	0	0	0	0	0	114
154	T	37.1	Very low	37.2	Very low	120 Å²	120	153.2 Å²	153.2	74%	0.736	77%	0.768	S	S	*	*			trans	103.6	125.3	148.8	-20	0	0	0	0	117
155	Q	41	Very low	37.3	Very low	158 Å²	158	154.3 Å²	154.3	74%	0.738	77%	0.771	S	S	*	*			trans	78	94	155.9	-68.2	-121.5	42.7	0	0	119.2
156	I	42.7	Very low	37.3	Very low	177 Å²	177	154.9 Å²	154.9	91%	0.908	77%	0.772	S	S	*	*			trans	-112	93.4	141.1	-57	177.8	0	0	0	107.2
157	Y	42.4	Very low	37.1	Very low	186 Å²	186	155.6 Å²	155.6	73%	0.729	78%	0.775	S	S	*	*			trans	-118.5	105.8	157.6	-174.6	-82.6	0	0	0	107.1
158	I	42.3	Very low	37.4	Very low	144 Å²	144	154 Å²	154	74%	0.738	77%	0.771	S	S	*	*			trans	-155.1	97.2	153.7	-55.7	-170.1	0	0	0	104.3
159	A	38.2	Very low	37.5	Very low	60 Å²	60	153.5 Å²	153.5	50%	0.496	77%	0.773	S	S	.	*				56.7	103.8	91.7	0	0	0	0	0	112.6
160	Y	40.1	Very low	38.2	Very low	308 Å²	308	150.3 Å²	150.3	100%	1.208	77%	0.768	S	S	*	*				-178.9	0	123.6	-84.8	-67.6	0	0	0	108.4

Retrieved 160 of 160 residues in 107 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).