A0A096NBM3_PAPAN Loading...

MICOS complex subunit MIC10

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

AlphaFold DB (Q5TGZ0), UniProt , Accession A0A096NBM3, Species PAPAN (Papio anubis, Olive baboon), Gene n/a, Length 78 aa.

						>A0A096NBM3_PAPAN|A0A096NBM3
MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.3	Low	75.8	Confident	158 Å²	158	108.7 Å²	108.7	78%	0.778	54%	0.543	S	S	*	.				0	123.6	0	-70.3	-170.2	-176.7	0	0	106.3	P65	M1-P65 HydrophobicContact CE-CB 3.8Å; M1-P65 HydrophobicContact CE-CG 4.5Å
2	S	71.1	Confident	76.3	Confident	69 Å²	69	113.7 Å²	113.7	48%	0.483	55%	0.551	S	S	.	*			trans	-71.2	140.7	174	-58.1	0	0	0	0	108.6	S4 E5 L6	S2-S4 PolarHBondContact O-N 3.24Å; S2-S4 VanDerWaalsContact O-N 3.11Å; S2-E5 PolarHBondContact N-OE2 3.48Å; S2-E5 PolarHBondContact O-N 3.29Å; S2-L6 PolarHBondContact O-N 3.5Å
3	E	76	Confident	77	Confident	181 Å²	181	105.9 Å²	105.9	85%	0.846	52%	0.515	S	S	*	.	H	α-helix	trans	-54.2	-32.6	179	-67	176.9	92.2	0	0	111.8	L6 G7	E3-L6 PolarHBondContact O-N 3.09Å; E3-G7 PolarHBondContact O-N 2.8Å
4	S	74.8	Confident	77.6	Confident	92 Å²	92	105.9 Å²	105.9	64%	0.643	52%	0.518	S	S	*	.	H	α-helix	trans	-63.4	-38.8	174.4	53.2	0	0	0	0	114.1	S2 L6 R8	S2-S4 PolarHBondContact O-N 3.24Å; S2-S4 VanDerWaalsContact O-N 3.11Å; S4-L6 VanDerWaalsContact C-N 3.34Å; S4-R8 PolarHBondContact O-N 2.94Å; S4-R8 VanDerWaalsContact O-N 3.12Å
5	E	72.6	Confident	78.3	Confident	109 Å²	109	102.4 Å²	102.4	51%	0.509	51%	0.513	S	S	.	.	H	α-helix	trans	-69.8	-36.8	175.9	-66.4	179.8	128	0	0	111.3	S2 K9	S2-E5 PolarHBondContact N-OE2 3.48Å; S2-E5 PolarHBondContact O-N 3.29Å; E5-K9 WeakPolarHBondContact O-CG 3.12Å; E5-K9 PolarHBondContact O-N 3.1Å
6	L	75.3	Confident	78.7	Confident	69 Å²	69	100.4 Å²	100.4	36%	0.361	51%	0.505	S	S	.	.	H	α-helix	trans	-67.5	-45.2	177.2	-168	68.3	0	0	0	110.7	S2 E3 S4 R8 K9 W10 F62	S2-L6 PolarHBondContact O-N 3.5Å; E3-L6 PolarHBondContact O-N 3.09Å; S4-L6 VanDerWaalsContact C-N 3.34Å; L6-R8 PolarHBondContact O-N 2.87Å; L6-K9 PolarHBondContact O-N 3.08Å; L6-W10 PolarHBondContact O-N 2.67Å; L6-F62 HydrophobicContact CD1-CD1 4.12Å; L6-F62 HydrophobicContact CD1-CE1 3.73Å
7	G	81.7	Confident	79	Confident	29 Å²	29	95.5 Å²	95.5	30%	0.299	48%	0.483	S	S	.	.	H	α-helix	trans	-55.6	-50.7	174.9	0	0	0	0	0	112.1	E3 K9 W10 D11	E3-G7 PolarHBondContact O-N 2.8Å; G7-K9 VanDerWaalsContact C-N 3.29Å; G7-K9 PolarHBondContact O-N 2.87Å; G7-W10 WeakPolarHBondContact O-CA 3.43Å; G7-W10 WeakPolarHBondContact O-CB 3.43Å; G7-W10 PolarHBondContact O-N 3.26Å; G7-D11 PolarHBondContact O-N 3.32Å
8	R	80.3	Confident	79.5	Confident	181 Å²	181	95.2 Å²	95.2	68%	0.683	49%	0.486	S	S	*	.	H	α-helix	trans	-61.3	-34.6	179.5	-165.3	175	70.1	149.8	0	113.5	S4 L6 R12	S4-R8 PolarHBondContact O-N 2.94Å; S4-R8 VanDerWaalsContact O-N 3.12Å; L6-R8 PolarHBondContact O-N 2.87Å; R8-R12 PolarHBondContact O-N 2.95Å
9	K	76.4	Confident	79.9	Confident	53 Å²	53	95.1 Å²	95.1	23%	0.23	49%	0.491	C	S	.	.	H	α-helix	trans	-67.6	-42.9	173.6	-75.3	-173.5	176.7	-156.4	0	111.6	E5 L6 G7 R12 C13 D61 F62	E5-K9 WeakPolarHBondContact O-CG 3.12Å; E5-K9 PolarHBondContact O-N 3.1Å; L6-K9 PolarHBondContact O-N 3.08Å; G7-K9 VanDerWaalsContact C-N 3.29Å; G7-K9 PolarHBondContact O-N 2.87Å; K9-R12 PolarHBondContact O-N 3.36Å; K9-C13 VanDerWaalsContact O-CB 3.27Å; K9-C13 WeakPolarHBondContact O-CB 3.28Å; K9-C13 PolarHBondContact O-N 2.84Å; K9-D61 PolarHBondContact NZ-O 3.49Å; K9-F62 HydrophobicContact CB-CE1 3.9Å; K9-F62 HydrophobicContact CB-CZ 4.24Å; K9-F62 HydrophobicContact CD-CD1 4.31Å; K9-F62 HydrophobicContact CD-CE1 4.42Å
10	W	83.5	Confident	80.1	Confident	141 Å²	141	93.1 Å²	93.1	53%	0.534	48%	0.478	S	S	.	.	H	α-helix	trans	-62.2	-46.3	175.6	-82.9	110	0	0	0	112.2	L6 G7 R12 C13 L14 F62	L6-W10 PolarHBondContact O-N 2.67Å; G7-W10 WeakPolarHBondContact O-CA 3.43Å; G7-W10 WeakPolarHBondContact O-CB 3.43Å; G7-W10 PolarHBondContact O-N 3.26Å; W10-R12 VanDerWaalsContact C-N 3.34Å; W10-R12 PolarHBondContact O-N 2.66Å; W10-C13 PolarHBondContact O-N 3.13Å; W10-L14 VanDerWaalsContact O-CB 3.22Å; W10-L14 WeakPolarHBondContact O-CB 3.47Å; W10-L14 PolarHBondContact O-N 2.85Å; W10-F62 AromaticContact CD1-CZ 3.82Å; W10-F62 HydrophobicContact CD2-CE1 4.38Å; W10-F62 HydrophobicContact CD2-CE2 4.22Å; W10-F62 AromaticContact CD2-CZ 3.51Å; W10-F62 HydrophobicContact CD2-CZ 3.51Å; W10-F62 AromaticContact CE2-CE1 3.98Å; W10-F62 AromaticContact CE2-CZ 3.41Å; W10-F62 VanDerWaalsContact CE2-CZ 3.41Å; W10-F62 HydrophobicContact CE3-CE2 4.36Å; W10-F62 HydrophobicContact CE3-CZ 4.06Å; W10-F62 HydrophobicContact CG-CE1 4.38Å; W10-F62 AromaticContact CG-CZ 3.77Å; W10-F62 HydrophobicContact CG-CZ 3.77Å; W10-F62 HydrophobicContact CH2-CE2 4.36Å; W10-F62 HydrophobicContact CH2-CZ 4.41Å; W10-F62 HydrophobicContact CZ2-CE2 4.21Å; W10-F62 AromaticContact CZ2-CZ 3.9Å; W10-F62 HydrophobicContact CZ2-CZ 3.9Å; W10-F62 HydrophobicContact CZ3-CE2 4.43Å; W10-F62 HydrophobicContact CZ3-CZ 4.48Å; W10-F62 AromaticContact NE1-CE1 3.71Å; W10-F62 AromaticContact NE1-CZ 3.58Å
11	D	85.9	Confident	80.2	Confident	114 Å²	114	91.1 Å²	91.1	61%	0.61	47%	0.468	S	S	*	.	H	α-helix	trans	-58.5	-45.9	177.7	-80.6	-55.8	0	0	0	111.7	G7 L14 A15	G7-D11 PolarHBondContact O-N 3.32Å; D11-L14 PolarHBondContact O-N 2.9Å; D11-A15 WeakPolarHBondContact O-CB 3.25Å; D11-A15 PolarHBondContact O-N 3.3Å
12	R	81.3	Confident	81.6	Confident	168 Å²	168	85.7 Å²	85.7	63%	0.634	45%	0.453	S	S	*	.	H	α-helix	trans	-63.2	-48.1	177.8	-171.3	174.9	-173.1	174.9	2.9	112	R8 K9 W10 L14 A15 D16	R8-R12 PolarHBondContact O-N 2.95Å; K9-R12 PolarHBondContact O-N 3.36Å; W10-R12 VanDerWaalsContact C-N 3.34Å; W10-R12 PolarHBondContact O-N 2.66Å; R12-L14 VanDerWaalsContact C-N 3.31Å; R12-L14 PolarHBondContact O-N 3.46Å; R12-A15 PolarHBondContact O-N 2.84Å; R12-D16 PolarHBondContact O-N 2.8Å
13	C	85.4	Confident	82.4	Confident	13 Å²	13	86.1 Å²	86.1	9%	0.088	45%	0.453	C	S	.	.	H	α-helix	trans	-56.5	-46.1	175.7	158.2	0	0	0	0	111.7	K9 W10 D16 A17 C58	K9-C13 VanDerWaalsContact O-CB 3.27Å; K9-C13 WeakPolarHBondContact O-CB 3.28Å; K9-C13 PolarHBondContact O-N 2.84Å; W10-C13 PolarHBondContact O-N 3.13Å; C13-D16 PolarHBondContact O-N 2.84Å; C13-A17 VanDerWaalsContact O-CB 3.26Å; C13-A17 WeakPolarHBondContact O-CB 3.47Å; C13-A17 PolarHBondContact O-N 3.33Å; C13-C58 VanDerWaalsContact CA-SG 3.53Å; C13-C58 HydrophobicContact CB-CB 3.79Å; C13-C58 WeakPolarHBondContact CB-SG 3.48Å; C13-C58 WeakPolarHBondContact SG-CB 3.47Å; C13-C58 CovalentContact SG-SG 2Å; C13-C58 PolarHBondContact SG-SG 3.19Å
14	L	86.4	Confident	82.6	Confident	105 Å²	105	78.5 Å²	78.5	55%	0.55	42%	0.423	S	S	.	.	H	α-helix	trans	-69.1	-40.5	-177.3	-168.8	142.3	0	0	0	111	W10 D11 R12 A17 V18	W10-L14 VanDerWaalsContact O-CB 3.22Å; W10-L14 WeakPolarHBondContact O-CB 3.47Å; W10-L14 PolarHBondContact O-N 2.85Å; D11-L14 PolarHBondContact O-N 2.9Å; R12-L14 VanDerWaalsContact C-N 3.31Å; R12-L14 PolarHBondContact O-N 3.46Å; L14-A17 PolarHBondContact O-N 2.91Å; L14-V18 HydrophobicContact CD2-CG2 3.97Å; L14-V18 WeakPolarHBondContact O-CB 3.46Å; L14-V18 WeakPolarHBondContact O-CG2 3.49Å; L14-V18 PolarHBondContact O-N 3.44Å
15	A	87.9	Confident	83.1	Confident	54 Å²	54	79.1 Å²	79.1	45%	0.446	41%	0.414	S	S	.	.	H	α-helix	trans	-59.9	-49.4	173.4	0	0	0	0	0	111.7	D11 R12 A17 V18 V19	D11-A15 WeakPolarHBondContact O-CB 3.25Å; D11-A15 PolarHBondContact O-N 3.3Å; R12-A15 PolarHBondContact O-N 2.84Å; A15-A17 VanDerWaalsContact C-N 3.32Å; A15-A17 PolarHBondContact O-N 3.31Å; A15-V18 PolarHBondContact O-N 3.47Å; A15-V19 WeakPolarHBondContact O-CG2 3.22Å; A15-V19 PolarHBondContact O-N 2.83Å
16	D	83.7	Confident	83.7	Confident	71 Å²	71	75.5 Å²	75.5	38%	0.38	41%	0.406	S	S	.	.	H	α-helix	trans	-59.8	-42.6	175.5	-98.2	-70.4	0	0	0	111.8	R12 C13 V19 K20	R12-D16 PolarHBondContact O-N 2.8Å; C13-D16 PolarHBondContact O-N 2.84Å; D16-V19 PolarHBondContact O-N 3.32Å; D16-K20 WeakPolarHBondContact O-CB 3.34Å; D16-K20 WeakPolarHBondContact O-CG 3.15Å; D16-K20 PolarHBondContact O-N 3.42Å
17	A	84.8	Confident	84.2	Confident	17 Å²	17	77.9 Å²	77.9	14%	0.14	42%	0.418	C	S	.	.	H	α-helix	trans	-62.6	-48.5	177.7	0	0	0	0	0	111.6	C13 L14 A15 V19 K20 I21 A54	C13-A17 VanDerWaalsContact O-CB 3.26Å; C13-A17 WeakPolarHBondContact O-CB 3.47Å; C13-A17 PolarHBondContact O-N 3.33Å; L14-A17 PolarHBondContact O-N 2.91Å; A15-A17 VanDerWaalsContact C-N 3.32Å; A15-A17 PolarHBondContact O-N 3.31Å; A17-V19 VanDerWaalsContact C-N 3.31Å; A17-V19 PolarHBondContact O-N 3.06Å; A17-K20 PolarHBondContact O-N 3.26Å; A17-I21 HydrophobicContact CB-CD1 4.23Å; A17-I21 VanDerWaalsContact O-CB 3.29Å; A17-I21 WeakPolarHBondContact O-CB 3.4Å; A17-I21 VanDerWaalsContact O-CD1 3.3Å; A17-I21 WeakPolarHBondContact O-CD1 3.09Å; A17-I21 WeakPolarHBondContact O-CG1 3.1Å; A17-I21 PolarHBondContact O-N 2.82Å; A17-A54 HydrophobicContact CB-CB 3.71Å
18	V	88.3	Confident	84.3	Confident	89 Å²	89	76.9 Å²	76.9	54%	0.539	41%	0.408	S	S	.	.	H	α-helix	trans	-59.3	-43.6	178.4	168.5	0	0	0	0	110.6	L14 A15 G22	L14-V18 HydrophobicContact CD2-CG2 3.97Å; L14-V18 WeakPolarHBondContact O-CB 3.46Å; L14-V18 WeakPolarHBondContact O-CG2 3.49Å; L14-V18 PolarHBondContact O-N 3.44Å; A15-V18 PolarHBondContact O-N 3.47Å; V18-G22 WeakPolarHBondContact O-CA 3.34Å; V18-G22 PolarHBondContact O-N 2.75Å
19	V	87.1	Confident	84.5	Confident	94 Å²	94	71.2 Å²	71.2	57%	0.57	39%	0.391	S	S	*	.	H	α-helix	trans	-64.3	-46.4	177.4	173.2	0	0	0	0	111.2	A15 D16 A17 T23	A15-V19 WeakPolarHBondContact O-CG2 3.22Å; A15-V19 PolarHBondContact O-N 2.83Å; D16-V19 PolarHBondContact O-N 3.32Å; A17-V19 VanDerWaalsContact C-N 3.31Å; A17-V19 PolarHBondContact O-N 3.06Å; V19-T23 VanDerWaalsContact O-CB 3.24Å; V19-T23 WeakPolarHBondContact O-CB 3.21Å; V19-T23 PolarHBondContact O-N 3.47Å; V19-T23 PolarHBondContact O-OG1 2.9Å
20	K	83.2	Confident	84.9	Confident	54 Å²	54	72.8 Å²	72.8	24%	0.235	41%	0.405	C	S	.	.	H	α-helix	trans	-66.6	-46.1	-179.8	-74.4	-177.1	-175.3	-170.3	0	112.8	D16 A17 G24 M53 A54 N57	D16-K20 WeakPolarHBondContact O-CB 3.34Å; D16-K20 WeakPolarHBondContact O-CG 3.15Å; D16-K20 PolarHBondContact O-N 3.42Å; A17-K20 PolarHBondContact O-N 3.26Å; K20-G24 PolarHBondContact O-N 3.29Å; K20-M53 PolarHBondContact NZ-O 2.94Å; K20-M53 VanDerWaalsContact NZ-O 3.13Å; K20-A54 HydrophobicContact CD-CB 4.29Å; K20-N57 VanDerWaalsContact NZ-CG 3.32Å; K20-N57 PolarHBondContact NZ-ND2 3.01Å
21	I	82	Confident	84.8	Confident	52 Å²	52	70.7 Å²	70.7	27%	0.267	40%	0.399	S	S	.	.	H	α-helix	trans	-66.2	-46.8	178.6	-63	160.1	0	0	0	109.1	A17 T23 G24 F25 L51	A17-I21 HydrophobicContact CB-CD1 4.23Å; A17-I21 VanDerWaalsContact O-CB 3.29Å; A17-I21 WeakPolarHBondContact O-CB 3.4Å; A17-I21 VanDerWaalsContact O-CD1 3.3Å; A17-I21 WeakPolarHBondContact O-CD1 3.09Å; A17-I21 WeakPolarHBondContact O-CG1 3.1Å; A17-I21 PolarHBondContact O-N 2.82Å; I21-T23 PolarHBondContact O-N 3.24Å; I21-G24 PolarHBondContact O-N 2.9Å; I21-F25 WeakPolarHBondContact O-CB 3.4Å; I21-F25 PolarHBondContact O-N 2.81Å; I21-L51 HydrophobicContact CD1-CD2 3.35Å; I21-L51 HydrophobicContact CD1-CG 4.19Å; I21-L51 HydrophobicContact CG1-CD2 3.85Å; I21-L51 HydrophobicContact CG1-CG 4.14Å
22	G	86.4	Confident	84.5	Confident	45 Å²	45	65.6 Å²	65.6	46%	0.464	37%	0.373	S	S	.	.	H	α-helix	trans	-60.7	-43.3	178.7	0	0	0	0	0	112.4	V18 G26	V18-G22 WeakPolarHBondContact O-CA 3.34Å; V18-G22 PolarHBondContact O-N 2.75Å; G22-G26 PolarHBondContact O-N 2.87Å
23	T	86.6	Confident	84.5	Confident	78 Å²	78	63.9 Å²	63.9	48%	0.479	38%	0.375	S	S	.	.	H	α-helix	trans	-66.5	-47.7	176.2	-55.2	0	0	0	0	111.3	V19 I21 F25 G26 L27	V19-T23 VanDerWaalsContact O-CB 3.24Å; V19-T23 WeakPolarHBondContact O-CB 3.21Å; V19-T23 PolarHBondContact O-N 3.47Å; V19-T23 PolarHBondContact O-OG1 2.9Å; I21-T23 PolarHBondContact O-N 3.24Å; T23-F25 VanDerWaalsContact C-N 3.34Å; T23-F25 PolarHBondContact O-N 3.41Å; T23-G26 PolarHBondContact O-N 3.35Å; T23-L27 HydrophobicContact CG2-CD1 4.03Å; T23-L27 HydrophobicContact CG2-CG 4.5Å; T23-L27 WeakPolarHBondContact O-CB 3.24Å; T23-L27 WeakPolarHBondContact O-CG 3.43Å; T23-L27 PolarHBondContact O-N 2.86Å
24	G	81.2	Confident	84.2	Confident	21 Å²	21	67.5 Å²	67.5	22%	0.216	40%	0.397	C	S	.	.	H	α-helix	trans	-64.8	-37.3	178.7	0	0	0	0	0	113	K20 I21 G28	K20-G24 PolarHBondContact O-N 3.29Å; I21-G24 PolarHBondContact O-N 2.9Å; G24-G28 WeakPolarHBondContact O-CA 3.25Å; G24-G28 PolarHBondContact O-N 2.92Å
25	F	84.7	Confident	83.7	Confident	105 Å²	105	69.7 Å²	69.7	46%	0.461	40%	0.403	S	S	.	.	H	α-helix	trans	-69.4	-46.6	175.6	-171.9	-105.9	0	0	0	111.2	I21 T23 G28 I29 L43	I21-F25 WeakPolarHBondContact O-CB 3.4Å; I21-F25 PolarHBondContact O-N 2.81Å; T23-F25 VanDerWaalsContact C-N 3.34Å; T23-F25 PolarHBondContact O-N 3.41Å; F25-G28 CarbonylContact O-C 3.59Å; F25-G28 PolarHBondContact O-N 2.92Å; F25-I29 HydrophobicContact CD1-CD1 3.67Å; F25-I29 HydrophobicContact CD1-CG1 4.37Å; F25-I29 HydrophobicContact CE1-CD1 3.29Å; F25-I29 HydrophobicContact CE1-CG1 4.18Å; F25-I29 HydrophobicContact CG-CD1 4.47Å; F25-I29 HydrophobicContact CZ-CD1 3.79Å; F25-I29 HydrophobicContact CZ-CG1 4.33Å; F25-I29 WeakPolarHBondContact O-CG1 3.18Å; F25-I29 PolarHBondContact O-N 2.89Å; F25-L43 HydrophobicContact CD2-CD2 4.11Å; F25-L43 HydrophobicContact CE2-CD2 4.18Å
26	G	86.4	Confident	82.8	Confident	33 Å²	33	71.1 Å²	71.1	34%	0.34	40%	0.399	S	S	.	.	H	α-helix	trans	-59.1	-50.5	176.2	0	0	0	0	0	112.4	G22 T23 G28 I29 V30	G22-G26 PolarHBondContact O-N 2.87Å; T23-G26 PolarHBondContact O-N 3.35Å; G26-G28 VanDerWaalsContact C-N 3.33Å; G26-G28 PolarHBondContact O-N 3.45Å; G26-I29 PolarHBondContact O-N 3.48Å; G26-V30 WeakPolarHBondContact O-CG2 3.35Å; G26-V30 PolarHBondContact O-N 3.39Å
27	L	86.2	Confident	82.1	Confident	118 Å²	118	77.4 Å²	77.4	62%	0.618	42%	0.423	S	S	*	.	H	α-helix	trans	-62	-41.7	174.6	-71.4	174.7	0	0	0	111.7	T23 I29 V30 F31	T23-L27 HydrophobicContact CG2-CD1 4.03Å; T23-L27 HydrophobicContact CG2-CG 4.5Å; T23-L27 WeakPolarHBondContact O-CB 3.24Å; T23-L27 WeakPolarHBondContact O-CG 3.43Å; T23-L27 PolarHBondContact O-N 2.86Å; L27-I29 VanDerWaalsContact C-N 3.31Å; L27-I29 PolarHBondContact O-N 2.9Å; L27-V30 PolarHBondContact O-N 3.14Å; L27-F31 VanDerWaalsContact O-CB 3.25Å; L27-F31 WeakPolarHBondContact O-CB 3.42Å; L27-F31 PolarHBondContact O-N 2.88Å
28	G	82.6	Confident	81.3	Confident	8 Å²	8	87.6 Å²	87.6	8%	0.082	46%	0.457	C	S	.	.	H	α-helix	trans	-61.6	-37.2	176.7	0	0	0	0	0	112.7	G24 F25 G26 S32	G24-G28 WeakPolarHBondContact O-CA 3.25Å; G24-G28 PolarHBondContact O-N 2.92Å; F25-G28 CarbonylContact O-C 3.59Å; F25-G28 PolarHBondContact O-N 2.92Å; G26-G28 VanDerWaalsContact C-N 3.33Å; G26-G28 PolarHBondContact O-N 3.45Å; G28-S32 WeakPolarHBondContact O-CB 3.32Å; G28-S32 PolarHBondContact O-N 3.23Å; G28-S32 PolarHBondContact O-OG 2.81Å
29	I	84.2	Confident	80.6	Confident	63 Å²	63	92.2 Å²	92.2	32%	0.323	47%	0.465	S	S	.	.	H	α-helix	trans	-65.9	-53.3	175.3	-72.9	173.1	0	0	0	108.8	F25 G26 L27 F31 S32 L33 L43	F25-I29 HydrophobicContact CD1-CD1 3.67Å; F25-I29 HydrophobicContact CD1-CG1 4.37Å; F25-I29 HydrophobicContact CE1-CD1 3.29Å; F25-I29 HydrophobicContact CE1-CG1 4.18Å; F25-I29 HydrophobicContact CG-CD1 4.47Å; F25-I29 HydrophobicContact CZ-CD1 3.79Å; F25-I29 HydrophobicContact CZ-CG1 4.33Å; F25-I29 WeakPolarHBondContact O-CG1 3.18Å; F25-I29 PolarHBondContact O-N 2.89Å; G26-I29 PolarHBondContact O-N 3.48Å; L27-I29 VanDerWaalsContact C-N 3.31Å; L27-I29 PolarHBondContact O-N 2.9Å; I29-F31 VanDerWaalsContact C-N 3.27Å; I29-F31 PolarHBondContact O-N 2.83Å; I29-S32 PolarHBondContact O-N 3.4Å; I29-S32 VanDerWaalsContact O-N 3.13Å; I29-L33 HydrophobicContact CG2-CD1 3.74Å; I29-L33 HydrophobicContact CG2-CG 4.22Å; I29-L33 WeakPolarHBondContact O-CB 3.3Å; I29-L33 VanDerWaalsContact O-CG 3.28Å; I29-L33 WeakPolarHBondContact O-CG 3.12Å; I29-L33 PolarHBondContact O-N 3.3Å; I29-L43 HydrophobicContact CB-CD2 4.38Å; I29-L43 HydrophobicContact CG1-CD2 3.66Å; I29-L43 VanDerWaalsContact N-CD2 3.31Å
30	V	85.4	Confident	80	Confident	86 Å²	86	94.9 Å²	94.9	52%	0.521	47%	0.473	S	S	.	.	H	α-helix	trans	-55.4	-47.7	-179.2	173.9	0	0	0	0	110	G26 L27 L33 T34	G26-V30 WeakPolarHBondContact O-CG2 3.35Å; G26-V30 PolarHBondContact O-N 3.39Å; L27-V30 PolarHBondContact O-N 3.14Å; V30-L33 PolarHBondContact O-N 3.27Å; V30-T34 HydrophobicContact CG1-CG2 4.37Å; V30-T34 WeakPolarHBondContact O-CB 3.29Å; V30-T34 WeakPolarHBondContact O-CG2 3.37Å; V30-T34 PolarHBondContact O-N 3.28Å; V30-T34 PolarHBondContact O-OG1 3.13Å
31	F	81.8	Confident	79.9	Confident	97 Å²	97	100.8 Å²	100.8	43%	0.425	49%	0.494	S	S	.	.	H	α-helix	trans	-66.8	-38.2	179.5	-157.9	-117.5	0	0	0	112.8	L27 I29 L33 T34 F35 F36	L27-F31 VanDerWaalsContact O-CB 3.25Å; L27-F31 WeakPolarHBondContact O-CB 3.42Å; L27-F31 PolarHBondContact O-N 2.88Å; I29-F31 VanDerWaalsContact C-N 3.27Å; I29-F31 PolarHBondContact O-N 2.83Å; F31-L33 VanDerWaalsContact C-N 3.29Å; F31-L33 PolarHBondContact O-N 2.88Å; F31-T34 PolarHBondContact O-N 3.35Å; F31-F35 AromaticContact CD2-CD2 3.36Å; F31-F35 HydrophobicContact CD2-CD2 3.36Å; F31-F35 AromaticContact CD2-CE2 3.89Å; F31-F35 HydrophobicContact CD2-CE2 3.89Å; F31-F35 HydrophobicContact CD2-CG 4.24Å; F31-F35 HydrophobicContact CE2-CB 4.38Å; F31-F35 AromaticContact CE2-CD2 3.4Å; F31-F35 HydrophobicContact CE2-CD2 3.4Å; F31-F35 VanDerWaalsContact CE2-CD2 3.4Å; F31-F35 AromaticContact CE2-CE2 3.84Å; F31-F35 HydrophobicContact CE2-CE2 3.84Å; F31-F35 HydrophobicContact CE2-CG 4Å; F31-F35 HydrophobicContact CG-CD2 4.23Å; F31-F35 HydrophobicContact CZ-CD2 4.34Å; F31-F35 PolarHBondContact O-N 3.46Å; F31-F36 AromaticContact CD1-CD2 3.64Å; F31-F36 HydrophobicContact CD1-CD2 3.64Å; F31-F36 AromaticContact CD1-CE2 3.39Å; F31-F36 HydrophobicContact CD1-CE2 3.39Å; F31-F36 HydrophobicContact CD1-CZ 4.36Å; F31-F36 AromaticContact CE1-CD2 3.74Å; F31-F36 HydrophobicContact CE1-CD2 3.74Å; F31-F36 AromaticContact CE1-CE2 2.96Å; F31-F36 HydrophobicContact CE1-CE2 2.96Å; F31-F36 AromaticContact CE1-CZ 3.65Å; F31-F36 HydrophobicContact CE1-CZ 3.65Å; F31-F36 HydrophobicContact CE2-CE2 4.36Å; F31-F36 HydrophobicContact CG-CD2 4.37Å; F31-F36 HydrophobicContact CG-CE2 4.28Å; F31-F36 HydrophobicContact CZ-CD2 4.46Å; F31-F36 AromaticContact CZ-CE2 3.51Å; F31-F36 HydrophobicContact CZ-CE2 3.51Å; F31-F36 HydrophobicContact CZ-CZ 4.2Å; F31-F36 PolarHBondContact O-N 3.45Å
32	S	78.3	Confident	79.6	Confident	7 Å²	7	99 Å²	99	5%	0.049	49%	0.486	C	S	.	.	H	α-helix	trans	-65.7	-33.8	176.1	-63.7	0	0	0	0	112.5	G28 I29 L43	G28-S32 WeakPolarHBondContact O-CB 3.32Å; G28-S32 PolarHBondContact O-N 3.23Å; G28-S32 PolarHBondContact O-OG 2.81Å; I29-S32 PolarHBondContact O-N 3.4Å; I29-S32 VanDerWaalsContact O-N 3.13Å; S32-L43 WeakPolarHBondContact OG-CG 3.49Å
33	L	81.1	Confident	79.2	Confident	132 Å²	132	98.2 Å²	98.2	69%	0.691	47%	0.471	S	S	*	.	H	α-helix	trans	-77.7	-40	176.8	-67.1	177.7	0	0	0	112.3	I29 V30 F31	I29-L33 HydrophobicContact CG2-CD1 3.74Å; I29-L33 HydrophobicContact CG2-CG 4.22Å; I29-L33 WeakPolarHBondContact O-CB 3.3Å; I29-L33 VanDerWaalsContact O-CG 3.28Å; I29-L33 WeakPolarHBondContact O-CG 3.12Å; I29-L33 PolarHBondContact O-N 3.3Å; V30-L33 PolarHBondContact O-N 3.27Å; F31-L33 VanDerWaalsContact C-N 3.29Å; F31-L33 PolarHBondContact O-N 2.88Å
34	T	79.5	Confident	79	Confident	89 Å²	89	97.3 Å²	97.3	55%	0.546	47%	0.471	S	S	.	.	H	α-helix	trans	-86.2	-40.8	-173.7	53.5	0	0	0	0	113.9	V30 F31	V30-T34 HydrophobicContact CG1-CG2 4.37Å; V30-T34 WeakPolarHBondContact O-CB 3.29Å; V30-T34 WeakPolarHBondContact O-CG2 3.37Å; V30-T34 PolarHBondContact O-N 3.28Å; V30-T34 PolarHBondContact O-OG1 3.13Å; F31-T34 PolarHBondContact O-N 3.35Å
35	F	76.4	Confident	79.1	Confident	151 Å²	151	101.2 Å²	101.2	66%	0.662	48%	0.483	S	S	*	.	T	Hydrogen-bonded Turn	trans	-111.9	-29.4	-171	-68.2	-80.5	0	0	0	114.4	F31	F31-F35 AromaticContact CD2-CD2 3.36Å; F31-F35 HydrophobicContact CD2-CD2 3.36Å; F31-F35 AromaticContact CD2-CE2 3.89Å; F31-F35 HydrophobicContact CD2-CE2 3.89Å; F31-F35 HydrophobicContact CD2-CG 4.24Å; F31-F35 HydrophobicContact CE2-CB 4.38Å; F31-F35 AromaticContact CE2-CD2 3.4Å; F31-F35 HydrophobicContact CE2-CD2 3.4Å; F31-F35 VanDerWaalsContact CE2-CD2 3.4Å; F31-F35 AromaticContact CE2-CE2 3.84Å; F31-F35 HydrophobicContact CE2-CE2 3.84Å; F31-F35 HydrophobicContact CE2-CG 4Å; F31-F35 HydrophobicContact CG-CD2 4.23Å; F31-F35 HydrophobicContact CZ-CD2 4.34Å; F31-F35 PolarHBondContact O-N 3.46Å
36	F	68.6	Low	79	Confident	83 Å²	83	97.3 Å²	97.3	36%	0.364	47%	0.472	S	S	.	.	S	Bend	trans	-108.8	11.5	-164.6	-72.5	-92.5	0	0	0	115.8	F31 R38 R39 P42	F31-F36 AromaticContact CD1-CD2 3.64Å; F31-F36 HydrophobicContact CD1-CD2 3.64Å; F31-F36 AromaticContact CD1-CE2 3.39Å; F31-F36 HydrophobicContact CD1-CE2 3.39Å; F31-F36 HydrophobicContact CD1-CZ 4.36Å; F31-F36 AromaticContact CE1-CD2 3.74Å; F31-F36 HydrophobicContact CE1-CD2 3.74Å; F31-F36 AromaticContact CE1-CE2 2.96Å; F31-F36 HydrophobicContact CE1-CE2 2.96Å; F31-F36 AromaticContact CE1-CZ 3.65Å; F31-F36 HydrophobicContact CE1-CZ 3.65Å; F31-F36 HydrophobicContact CE2-CE2 4.36Å; F31-F36 HydrophobicContact CG-CD2 4.37Å; F31-F36 HydrophobicContact CG-CE2 4.28Å; F31-F36 HydrophobicContact CZ-CD2 4.46Å; F31-F36 AromaticContact CZ-CE2 3.51Å; F31-F36 HydrophobicContact CZ-CE2 3.51Å; F31-F36 HydrophobicContact CZ-CZ 4.2Å; F31-F36 PolarHBondContact O-N 3.45Å; F36-R38 VanDerWaalsContact C-N 3.25Å; F36-R38 PolarHBondContact O-N 3.31Å; F36-R38 VanDerWaalsContact O-N 3.1Å; F36-R39 HydrophobicContact CB-CB 4.29Å; F36-R39 WeakPolarHBondContact O-CG 3.37Å; F36-R39 PolarHBondContact O-N 2.81Å; F36-P42 HydrophobicContact CB-CG 4.18Å; F36-P42 HydrophobicContact CD1-CG 3.98Å; F36-P42 HydrophobicContact CD2-CG 4.17Å; F36-P42 HydrophobicContact CE1-CG 4.49Å; F36-P42 HydrophobicContact CG-CG 3.79Å
37	K	69.2	Low	78.8	Confident	203 Å²	203	97.2 Å²	97.2	88%	0.883	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.3	45	169	-153.4	177	-178.3	173.5	0	112.6
38	R	68.9	Low	78.8	Confident	231 Å²	231	93.5 Å²	93.5	87%	0.872	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.2	14.4	-177.3	-53.8	-177.5	178.8	173.5	-0.7	117.6	F36 M40	F36-R38 VanDerWaalsContact C-N 3.25Å; F36-R38 PolarHBondContact O-N 3.31Å; F36-R38 VanDerWaalsContact O-N 3.1Å; R38-M40 PolarHBondContact O-N 2.83Å
39	R	72.2	Confident	78.9	Confident	187 Å²	187	97.7 Å²	97.7	71%	0.706	48%	0.475	S	S	*	.			trans	-69.1	123.3	169.1	-66	-66.3	-166.7	173.2	2.9	109.2	F36 W41 P42	F36-R39 HydrophobicContact CB-CB 4.29Å; F36-R39 WeakPolarHBondContact O-CG 3.37Å; F36-R39 PolarHBondContact O-N 2.81Å; R39-W41 VanDerWaalsContact C-N 3.3Å; R39-W41 PolarHBondContact O-N 2.85Å; R39-P42 WeakPolarHBondContact O-CD 3.26Å
40	M	75.3	Confident	78.9	Confident	150 Å²	150	94.9 Å²	94.9	74%	0.739	46%	0.461	S	S	*	.	S	Bend	trans	-82	-6.7	-177.3	-161.9	134.1	147.2	0	0	113.5	R38 L43 A44	R38-M40 PolarHBondContact O-N 2.83Å; M40-L43 HydrophobicContact CG-CD1 4.35Å; M40-L43 WeakPolarHBondContact O-CB 3.39Å; M40-L43 PolarHBondContact O-N 2Å; M40-A44 PolarHBondContact O-N 3.12Å; M40-A44 VanDerWaalsContact O-N 3.09Å
41	W	80.8	Confident	78.9	Confident	177 Å²	177	95 Å²	95	67%	0.67	46%	0.459	S	S	*	.	H	α-helix	trans	-61.2	-39.9	-179.2	-170.8	83.1	0	0	0	114.1	R39 L43 A44 F45	R39-W41 VanDerWaalsContact C-N 3.3Å; R39-W41 PolarHBondContact O-N 2.85Å; W41-L43 VanDerWaalsContact C-N 3.29Å; W41-L43 PolarHBondContact O-N 3.43Å; W41-A44 PolarHBondContact O-N 3.26Å; W41-F45 HydrophobicContact CD2-CB 4.42Å; W41-F45 HydrophobicContact CE3-CB 4.39Å; W41-F45 HydrophobicContact CH2-CB 4.39Å; W41-F45 HydrophobicContact CH2-CD1 4.47Å; W41-F45 HydrophobicContact CH2-CD2 4.03Å; W41-F45 HydrophobicContact CH2-CE2 4.42Å; W41-F45 HydrophobicContact CH2-CG 4.06Å; W41-F45 HydrophobicContact CZ2-CB 4.41Å; W41-F45 HydrophobicContact CZ2-CD2 4.04Å; W41-F45 HydrophobicContact CZ2-CG 4.32Å; W41-F45 HydrophobicContact CZ3-CB 4.38Å; W41-F45 HydrophobicContact CZ3-CG 4.31Å; W41-F45 WeakPolarHBondContact O-CB 3.38Å; W41-F45 PolarHBondContact O-N 3.41Å
42	P	75.4	Confident	79	Confident	15 Å²	15	92.3 Å²	92.3	10%	0.097	46%	0.458	C	S	.	.	H	α-helix	trans	-62.7	-33.6	175.2	-21.4	34.4	0	0	0	113.2	F36 R39 G46	F36-P42 HydrophobicContact CB-CG 4.18Å; F36-P42 HydrophobicContact CD1-CG 3.98Å; F36-P42 HydrophobicContact CD2-CG 4.17Å; F36-P42 HydrophobicContact CE1-CG 4.49Å; F36-P42 HydrophobicContact CG-CG 3.79Å; R39-P42 WeakPolarHBondContact O-CD 3.26Å; P42-G46 PolarHBondContact O-N 3.43Å
43	L	77.6	Confident	79.2	Confident	28 Å²	28	96.6 Å²	96.6	15%	0.147	48%	0.478	C	S	.	.	H	α-helix	trans	-67.7	-48.5	173.3	-75.1	166.2	0	0	0	111.4	F25 I29 S32 M40 W41 F45 S47	F25-L43 HydrophobicContact CD2-CD2 4.11Å; F25-L43 HydrophobicContact CE2-CD2 4.18Å; I29-L43 HydrophobicContact CB-CD2 4.38Å; I29-L43 HydrophobicContact CG1-CD2 3.66Å; I29-L43 VanDerWaalsContact N-CD2 3.31Å; S32-L43 WeakPolarHBondContact OG-CG 3.49Å; M40-L43 HydrophobicContact CG-CD1 4.35Å; M40-L43 WeakPolarHBondContact O-CB 3.39Å; M40-L43 PolarHBondContact O-N 2Å; W41-L43 VanDerWaalsContact C-N 3.29Å; W41-L43 PolarHBondContact O-N 3.43Å; L43-F45 VanDerWaalsContact C-N 3.35Å; L43-S47 VanDerWaalsContact O-CB 3.25Å; L43-S47 WeakPolarHBondContact O-CB 3.44Å; L43-S47 PolarHBondContact O-N 3.45Å; L43-S47 PolarHBondContact O-OG 3.35Å
44	A	83.3	Confident	79.2	Confident	59 Å²	59	90.5 Å²	90.5	49%	0.488	45%	0.447	S	S	.	.	H	α-helix	trans	-63.3	-41.7	178.3	0	0	0	0	0	111.8	M40 W41 S47 G48	M40-A44 PolarHBondContact O-N 3.12Å; M40-A44 VanDerWaalsContact O-N 3.09Å; W41-A44 PolarHBondContact O-N 3.26Å; A44-S47 WeakPolarHBondContact CA-OG 3.22Å; A44-S47 PolarHBondContact O-OG 2.7Å; A44-S47 VanDerWaalsContact O-OG 3.08Å; A44-G48 PolarHBondContact O-N 2.95Å
45	F	84.2	Confident	79.4	Confident	104 Å²	104	93.8 Å²	93.8	46%	0.456	45%	0.451	S	S	.	.	H	α-helix	trans	-67.7	-48.3	177	-178.7	-106.8	0	0	0	111.7	W41 L43 G48 M49	W41-F45 HydrophobicContact CD2-CB 4.42Å; W41-F45 HydrophobicContact CE3-CB 4.39Å; W41-F45 HydrophobicContact CH2-CB 4.39Å; W41-F45 HydrophobicContact CH2-CD1 4.47Å; W41-F45 HydrophobicContact CH2-CD2 4.03Å; W41-F45 HydrophobicContact CH2-CE2 4.42Å; W41-F45 HydrophobicContact CH2-CG 4.06Å; W41-F45 HydrophobicContact CZ2-CB 4.41Å; W41-F45 HydrophobicContact CZ2-CD2 4.04Å; W41-F45 HydrophobicContact CZ2-CG 4.32Å; W41-F45 HydrophobicContact CZ3-CB 4.38Å; W41-F45 HydrophobicContact CZ3-CG 4.31Å; W41-F45 WeakPolarHBondContact O-CB 3.38Å; W41-F45 PolarHBondContact O-N 3.41Å; L43-F45 VanDerWaalsContact C-N 3.35Å; F45-G48 PolarHBondContact O-N 2.84Å; F45-M49 HydrophobicContact CD1-CG 4.49Å; F45-M49 HydrophobicContact CD1-SD 3.76Å; F45-M49 HydrophobicContact CD2-CG 4.44Å; F45-M49 HydrophobicContact CD2-SD 4.44Å; F45-M49 HydrophobicContact CE1-CG 4.23Å; F45-M49 HydrophobicContact CE1-SD 3.1Å; F45-M49 WeakPolarHBondContact CE1-SD 3.39Å; F45-M49 HydrophobicContact CE2-CG 4.14Å; F45-M49 HydrophobicContact CE2-SD 3.88Å; F45-M49 HydrophobicContact CG-SD 4.39Å; F45-M49 HydrophobicContact CZ-CE 4.44Å; F45-M49 HydrophobicContact CZ-CG 4.04Å; F45-M49 HydrophobicContact CZ-SD 3.18Å; F45-M49 WeakPolarHBondContact CZ-SD 3Å; F45-M49 WeakPolarHBondContact O-CB 3.49Å; F45-M49 WeakPolarHBondContact O-CG 3.21Å; F45-M49 PolarHBondContact O-N 3.43Å
46	G	80.9	Confident	79.8	Confident	22 Å²	22	89.5 Å²	89.5	23%	0.227	44%	0.439	C	S	.	.	H	α-helix	trans	-63.9	-42.3	178.7	0	0	0	0	0	112.8	P42 G50	P42-G46 PolarHBondContact O-N 3.43Å; G46-G50 PolarHBondContact O-N 3.35Å
47	S	83.6	Confident	80.2	Confident	31 Å²	31	88.8 Å²	88.8	22%	0.217	44%	0.439	C	S	.	.	H	α-helix	trans	-66.6	-43.7	173.5	56.8	0	0	0	0	111.9	L43 A44 G50 L51	L43-S47 VanDerWaalsContact O-CB 3.25Å; L43-S47 WeakPolarHBondContact O-CB 3.44Å; L43-S47 PolarHBondContact O-N 3.45Å; L43-S47 PolarHBondContact O-OG 3.35Å; A44-S47 WeakPolarHBondContact CA-OG 3.22Å; A44-S47 PolarHBondContact O-OG 2.7Å; A44-S47 VanDerWaalsContact O-OG 3.08Å; S47-G50 PolarHBondContact O-N 3Å; S47-L51 VanDerWaalsContact O-CB 3.24Å; S47-L51 WeakPolarHBondContact O-CB 2.91Å; S47-L51 WeakPolarHBondContact O-CG 3.27Å; S47-L51 PolarHBondContact O-N 3.33Å
48	G	85.8	Confident	80.6	Confident	40 Å²	40	79.7 Å²	79.7	41%	0.412	40%	0.401	S	S	.	.	H	α-helix	trans	-61.7	-44.6	176.6	0	0	0	0	0	113.1	A44 F45 G52	A44-G48 PolarHBondContact O-N 2.95Å; F45-G48 PolarHBondContact O-N 2.84Å; G48-G52 PolarHBondContact O-N 3.18Å
49	M	85.4	Confident	81.2	Confident	96 Å²	96	73.2 Å²	73.2	47%	0.473	38%	0.381	S	S	.	.	H	α-helix	trans	-63.5	-46	173.2	-73.9	-176.1	75.7	0	0	111.9	F45 G52 M53	F45-M49 HydrophobicContact CD1-CG 4.49Å; F45-M49 HydrophobicContact CD1-SD 3.76Å; F45-M49 HydrophobicContact CD2-CG 4.44Å; F45-M49 HydrophobicContact CD2-SD 4.44Å; F45-M49 HydrophobicContact CE1-CG 4.23Å; F45-M49 HydrophobicContact CE1-SD 3.1Å; F45-M49 WeakPolarHBondContact CE1-SD 3.39Å; F45-M49 HydrophobicContact CE2-CG 4.14Å; F45-M49 HydrophobicContact CE2-SD 3.88Å; F45-M49 HydrophobicContact CG-SD 4.39Å; F45-M49 HydrophobicContact CZ-CE 4.44Å; F45-M49 HydrophobicContact CZ-CG 4.04Å; F45-M49 HydrophobicContact CZ-SD 3.18Å; F45-M49 WeakPolarHBondContact CZ-SD 3Å; F45-M49 WeakPolarHBondContact O-CB 3.49Å; F45-M49 WeakPolarHBondContact O-CG 3.21Å; F45-M49 PolarHBondContact O-N 3.43Å; M49-G52 PolarHBondContact O-N 3.04Å; M49-M53 HydrophobicContact CB-CE 4.5Å; M49-M53 WeakPolarHBondContact O-CG 2.97Å; M49-M53 PolarHBondContact O-N 3.22Å
50	G	82.9	Confident	81.3	Confident	4 Å²	4	70.5 Å²	70.5	4%	0.041	38%	0.376	C	S	.	.	H	α-helix	trans	-61.1	-43.8	178.5	0	0	0	0	0	112.5	G46 S47 M53 A54	G46-G50 PolarHBondContact O-N 3.35Å; S47-G50 PolarHBondContact O-N 3Å; G50-M53 PolarHBondContact O-N 3.43Å; G50-A54 WeakPolarHBondContact O-CB 3.34Å; G50-A54 PolarHBondContact O-N 2.8Å
51	L	85.5	Confident	81.2	Confident	89 Å²	89	66.4 Å²	66.4	47%	0.466	36%	0.357	S	S	.	.	H	α-helix	trans	-62.1	-46.6	173.6	-77.6	167.6	0	0	0	111.6	I21 S47 M53 A54 Y55	I21-L51 HydrophobicContact CD1-CD2 3.35Å; I21-L51 HydrophobicContact CD1-CG 4.19Å; I21-L51 HydrophobicContact CG1-CD2 3.85Å; I21-L51 HydrophobicContact CG1-CG 4.14Å; S47-L51 VanDerWaalsContact O-CB 3.24Å; S47-L51 WeakPolarHBondContact O-CB 2.91Å; S47-L51 WeakPolarHBondContact O-CG 3.27Å; S47-L51 PolarHBondContact O-N 3.33Å; L51-M53 PolarHBondContact O-N 3.13Å; L51-A54 PolarHBondContact O-N 3.23Å; L51-Y55 VanDerWaalsContact O-CB 3.26Å; L51-Y55 WeakPolarHBondContact O-CB 3.33Å; L51-Y55 PolarHBondContact O-N 2.89Å
52	G	84.9	Confident	80.8	Confident	40 Å²	40	60.4 Å²	60.4	41%	0.412	34%	0.336	S	S	.	.	H	α-helix	trans	-59	-45.4	176.9	0	0	0	0	0	112.3	G48 M49 Y55 S56	G48-G52 PolarHBondContact O-N 3.18Å; M49-G52 PolarHBondContact O-N 3.04Å; G52-Y55 PolarHBondContact O-N 2.86Å; G52-S56 WeakPolarHBondContact O-CB 3.26Å; G52-S56 PolarHBondContact O-N 3.25Å; G52-S56 PolarHBondContact O-OG 2.87Å
53	M	82.8	Confident	80.5	Confident	97 Å²	97	66.6 Å²	66.6	48%	0.478	36%	0.363	S	S	.	.	H	α-helix	trans	-69.3	-32.4	177.1	-71	-173.4	-69.2	0	0	113.6	K20 M49 G50 L51 S56 N57	K20-M53 PolarHBondContact NZ-O 2.94Å; K20-M53 VanDerWaalsContact NZ-O 3.13Å; M49-M53 HydrophobicContact CB-CE 4.5Å; M49-M53 WeakPolarHBondContact O-CG 2.97Å; M49-M53 PolarHBondContact O-N 3.22Å; G50-M53 PolarHBondContact O-N 3.43Å; L51-M53 PolarHBondContact O-N 3.13Å; M53-S56 WeakPolarHBondContact CA-OG 3.47Å; M53-S56 PolarHBondContact O-OG 3.39Å; M53-S56 VanDerWaalsContact O-OG 3.14Å; M53-N57 WeakPolarHBondContact O-CB 3.45Å; M53-N57 PolarHBondContact O-N 2.96Å; M53-N57 PolarHBondContact O-OD1 2.97Å
54	A	80.6	Confident	79.7	Confident	4 Å²	4	66.9 Å²	66.9	3%	0.033	37%	0.37	C	S	.	.	H	α-helix	trans	-69.1	-46.7	172.9	0	0	0	0	0	110.1	A17 K20 G50 L51 S56 N57 C58	A17-A54 HydrophobicContact CB-CB 3.71Å; K20-A54 HydrophobicContact CD-CB 4.29Å; G50-A54 WeakPolarHBondContact O-CB 3.34Å; G50-A54 PolarHBondContact O-N 2.8Å; L51-A54 PolarHBondContact O-N 3.23Å; A54-S56 PolarHBondContact O-N 3.04Å; A54-N57 WeakPolarHBondContact O-CB 3.43Å; A54-N57 PolarHBondContact O-N 3.36Å; A54-C58 PolarHBondContact O-N 2.96Å; A54-C58 PolarHBondContact O-SG 3.39Å
55	Y	83.1	Confident	78.6	Confident	159 Å²	159	66.4 Å²	66.4	62%	0.624	36%	0.361	S	S	*	.	H	α-helix	trans	-61.2	-45.5	178.9	-175.4	-92.3	0	0	0	112.2	L51 G52 N57 C58 Q59	L51-Y55 VanDerWaalsContact O-CB 3.26Å; L51-Y55 WeakPolarHBondContact O-CB 3.33Å; L51-Y55 PolarHBondContact O-N 2.89Å; G52-Y55 PolarHBondContact O-N 2.86Å; Y55-N57 VanDerWaalsContact C-N 3.29Å; Y55-N57 PolarHBondContact O-N 3.32Å; Y55-C58 PolarHBondContact O-N 3.42Å; Y55-Q59 HydrophobicContact CE1-CB 4.48Å; Y55-Q59 WeakPolarHBondContact O-CB 3.24Å; Y55-Q59 PolarHBondContact O-N 2.81Å
56	S	84.2	Confident	77.2	Confident	60 Å²	60	71 Å²	71	42%	0.42	38%	0.377	S	S	.	.	H	α-helix	trans	-62.4	-37.5	177.4	60.7	0	0	0	0	112.4	G52 M53 A54 H60	G52-S56 WeakPolarHBondContact O-CB 3.26Å; G52-S56 PolarHBondContact O-N 3.25Å; G52-S56 PolarHBondContact O-OG 2.87Å; M53-S56 WeakPolarHBondContact CA-OG 3.47Å; M53-S56 PolarHBondContact O-OG 3.39Å; M53-S56 VanDerWaalsContact O-OG 3.14Å; A54-S56 PolarHBondContact O-N 3.04Å; S56-H60 WeakPolarHBondContact O-CB 3.23Å; S56-H60 PolarHBondContact O-N 3.12Å
57	N	77	Confident	76	Confident	69 Å²	69	76.9 Å²	76.9	37%	0.369	40%	0.403	S	S	.	.	H	α-helix	trans	-64.9	-50.2	175.5	-82.4	23.1	0	0	0	110.9	K20 M53 A54 Y55 Q59 H60 D61	K20-N57 VanDerWaalsContact NZ-CG 3.32Å; K20-N57 PolarHBondContact NZ-ND2 3.01Å; M53-N57 WeakPolarHBondContact O-CB 3.45Å; M53-N57 PolarHBondContact O-N 2.96Å; M53-N57 PolarHBondContact O-OD1 2.97Å; A54-N57 WeakPolarHBondContact O-CB 3.43Å; A54-N57 PolarHBondContact O-N 3.36Å; Y55-N57 VanDerWaalsContact C-N 3.29Å; Y55-N57 PolarHBondContact O-N 3.32Å; N57-Q59 PolarHBondContact O-N 2.84Å; N57-H60 WeakPolarHBondContact O-CB 3.35Å; N57-H60 PolarHBondContact O-N 3.11Å; N57-D61 PolarHBondContact O-N 3.25Å
58	C	78.9	Confident	74.6	Confident	11 Å²	11	83.4 Å²	83.4	7%	0.074	43%	0.434	C	S	.	.	H	α-helix	trans	-58.9	-46.8	177.6	-63	0	0	0	0	112	C13 A54 Y55 H60 D61 F62	C13-C58 VanDerWaalsContact CA-SG 3.53Å; C13-C58 HydrophobicContact CB-CB 3.79Å; C13-C58 WeakPolarHBondContact CB-SG 3.48Å; C13-C58 WeakPolarHBondContact SG-CB 3.47Å; C13-C58 CovalentContact SG-SG 2Å; C13-C58 PolarHBondContact SG-SG 3.19Å; A54-C58 PolarHBondContact O-N 2.96Å; A54-C58 PolarHBondContact O-SG 3.39Å; Y55-C58 PolarHBondContact O-N 3.42Å; C58-H60 PolarHBondContact O-N 3.31Å; C58-D61 WeakPolarHBondContact O-CB 3.42Å; C58-D61 PolarHBondContact O-N 3.48Å; C58-D61 VanDerWaalsContact O-N 3.13Å; C58-F62 HydrophobicContact CB-CE2 4.33Å; C58-F62 WeakPolarHBondContact O-CD2 3.44Å; C58-F62 PolarHBondContact O-N 3Å
59	Q	81	Confident	73.2	Confident	95 Å²	95	90.1 Å²	90.1	44%	0.444	46%	0.455	S	S	.	.	H	α-helix	trans	-61.7	-37.3	179.6	-156.5	-157.7	-22.8	0	0	111.2	Y55 N57 F62 Q63	Y55-Q59 HydrophobicContact CE1-CB 4.48Å; Y55-Q59 WeakPolarHBondContact O-CB 3.24Å; Y55-Q59 PolarHBondContact O-N 2.81Å; N57-Q59 PolarHBondContact O-N 2.84Å; Q59-F62 PolarHBondContact O-N 2.88Å; Q59-Q63 VanDerWaalsContact O-CB 3.23Å; Q59-Q63 WeakPolarHBondContact O-CB 3.33Å; Q59-Q63 PolarHBondContact O-N 3.22Å
60	H	74.7	Confident	71.8	Confident	131 Å²	131	89.1 Å²	89.1	61%	0.606	47%	0.469	S	S	*	.	H	α-helix	trans	-64.9	-43	173.9	-166.7	76	0	0	0	112.2	S56 N57 C58 F62 Q63 A64	S56-H60 WeakPolarHBondContact O-CB 3.23Å; S56-H60 PolarHBondContact O-N 3.12Å; N57-H60 WeakPolarHBondContact O-CB 3.35Å; N57-H60 PolarHBondContact O-N 3.11Å; C58-H60 PolarHBondContact O-N 3.31Å; H60-F62 VanDerWaalsContact C-N 3.29Å; H60-F62 PolarHBondContact O-N 3.28Å; H60-Q63 CarbonylContact O-C 3.56Å; H60-Q63 PolarHBondContact O-N 2.95Å; H60-A64 WeakPolarHBondContact O-CB 2.83Å; H60-A64 PolarHBondContact O-N 3.21Å
61	D	72.5	Confident	70.4	Confident	64 Å²	64	97.9 Å²	97.9	34%	0.342	51%	0.506	S	S	.	.	H	α-helix	trans	-61.8	-34	174	-87.9	-73.5	0	0	0	112.9	K9 N57 C58	K9-D61 PolarHBondContact NZ-O 3.49Å; N57-D61 PolarHBondContact O-N 3.25Å; C58-D61 WeakPolarHBondContact O-CB 3.42Å; C58-D61 PolarHBondContact O-N 3.48Å; C58-D61 VanDerWaalsContact O-N 3.13Å
62	F	71.8	Confident	68.4	Low	51 Å²	51	103.4 Å²	103.4	22%	0.224	52%	0.522	C	S	.	.	H	α-helix	trans	-75.1	-39	173.1	-72.2	-67.5	0	0	0	112.4	L6 K9 W10 C58 Q59 H60 A64	L6-F62 HydrophobicContact CD1-CD1 4.12Å; L6-F62 HydrophobicContact CD1-CE1 3.73Å; K9-F62 HydrophobicContact CB-CE1 3.9Å; K9-F62 HydrophobicContact CB-CZ 4.24Å; K9-F62 HydrophobicContact CD-CD1 4.31Å; K9-F62 HydrophobicContact CD-CE1 4.42Å; W10-F62 AromaticContact CD1-CZ 3.82Å; W10-F62 HydrophobicContact CD2-CE1 4.38Å; W10-F62 HydrophobicContact CD2-CE2 4.22Å; W10-F62 AromaticContact CD2-CZ 3.51Å; W10-F62 HydrophobicContact CD2-CZ 3.51Å; W10-F62 AromaticContact CE2-CE1 3.98Å; W10-F62 AromaticContact CE2-CZ 3.41Å; W10-F62 VanDerWaalsContact CE2-CZ 3.41Å; W10-F62 HydrophobicContact CE3-CE2 4.36Å; W10-F62 HydrophobicContact CE3-CZ 4.06Å; W10-F62 HydrophobicContact CG-CE1 4.38Å; W10-F62 AromaticContact CG-CZ 3.77Å; W10-F62 HydrophobicContact CG-CZ 3.77Å; W10-F62 HydrophobicContact CH2-CE2 4.36Å; W10-F62 HydrophobicContact CH2-CZ 4.41Å; W10-F62 HydrophobicContact CZ2-CE2 4.21Å; W10-F62 AromaticContact CZ2-CZ 3.9Å; W10-F62 HydrophobicContact CZ2-CZ 3.9Å; W10-F62 HydrophobicContact CZ3-CE2 4.43Å; W10-F62 HydrophobicContact CZ3-CZ 4.48Å; W10-F62 AromaticContact NE1-CE1 3.71Å; W10-F62 AromaticContact NE1-CZ 3.58Å; C58-F62 HydrophobicContact CB-CE2 4.33Å; C58-F62 WeakPolarHBondContact O-CD2 3.44Å; C58-F62 PolarHBondContact O-N 3Å; Q59-F62 PolarHBondContact O-N 2.88Å; H60-F62 VanDerWaalsContact C-N 3.29Å; H60-F62 PolarHBondContact O-N 3.28Å; F62-A64 VanDerWaalsContact C-N 3.34Å
63	Q	69.3	Low	66.8	Low	144 Å²	144	107.5 Å²	107.5	67%	0.673	54%	0.539	S	S	*	.	H	α-helix	trans	-81.2	-8	-178.8	-170.5	171.5	-15	0	0	114	Q59 H60 P65	Q59-Q63 VanDerWaalsContact O-CB 3.23Å; Q59-Q63 WeakPolarHBondContact O-CB 3.33Å; Q59-Q63 PolarHBondContact O-N 3.22Å; H60-Q63 CarbonylContact O-C 3.56Å; H60-Q63 PolarHBondContact O-N 2.95Å; Q63-P65 WeakPolarHBondContact O-CD 3.42Å
64	A	62.3	Low	65	Low	34 Å²	34	111.8 Å²	111.8	28%	0.281	56%	0.555	S	S	.	*			trans	-98.9	66.3	166.3	0	0	0	0	0	112.5	H60 F62 Y66	H60-A64 WeakPolarHBondContact O-CB 2.83Å; H60-A64 PolarHBondContact O-N 3.21Å; F62-A64 VanDerWaalsContact C-N 3.34Å; A64-Y66 PolarHBondContact O-N 3.12Å; A64-Y66 VanDerWaalsContact O-N 3.12Å
65	P	58.4	Low	63.6	Low	49 Å²	49	119.8 Å²	119.8	32%	0.318	59%	0.591	S	S	.	*	T	Hydrogen-bonded Turn	trans	-67.9	-2.8	175.8	19.8	-21.9	0	0	0	114.9	M1 Q63	M1-P65 HydrophobicContact CE-CB 3.8Å; M1-P65 HydrophobicContact CE-CG 4.5Å; Q63-P65 WeakPolarHBondContact O-CD 3.42Å
66	Y	55.2	Low	61.7	Low	201 Å²	201	120.9 Å²	120.9	79%	0.788	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-140.9	10.7	-171.6	-43.8	-67.7	0	0	0	117.6	A64 L68	A64-Y66 PolarHBondContact O-N 3.12Å; A64-Y66 VanDerWaalsContact O-N 3.12Å; Y66-L68 VanDerWaalsContact C-N 3.26Å; Y66-L68 PolarHBondContact O-N 3.14Å; Y66-L68 VanDerWaalsContact O-N 3.14Å
67	L	55.8	Low	59.9	Low	146 Å²	146	126.6 Å²	126.6	76%	0.764	62%	0.622	S	S	*	*			trans	-90.5	66.6	170.2	-71.5	-179.9	0	0	0	111.4	H69	L67-H69 VanDerWaalsContact C-N 3.35Å; L67-H69 PolarHBondContact O-N 3.14Å; L67-H69 VanDerWaalsContact O-N 3.14Å
68	L	55.2	Low	58	Low	167 Å²	167	136.1 Å²	136.1	87%	0.874	66%	0.664	S	S	*	*			trans	-66	91.2	153.6	-89.6	161.3	0	0	0	108.1	Y66	Y66-L68 VanDerWaalsContact C-N 3.26Å; Y66-L68 PolarHBondContact O-N 3.14Å; Y66-L68 VanDerWaalsContact O-N 3.14Å
69	H	55.7	Low	56.9	Low	182 Å²	182	142.4 Å²	142.4	84%	0.843	69%	0.694	S	S	*	*			trans	-137.1	107	165.2	-100.4	65.6	0	0	0	110.4	L67	L67-H69 VanDerWaalsContact C-N 3.35Å; L67-H69 PolarHBondContact O-N 3.14Å; L67-H69 VanDerWaalsContact O-N 3.14Å
70	G	55.3	Low	55.6	Low	75 Å²	75	144.8 Å²	144.8	77%	0.773	71%	0.707	S	S	*	*	S	Bend	trans	100.5	75.1	154.1	0	0	0	0	0	117.7
71	K	53.8	Low	54.6	Low	187 Å²	187	145.6 Å²	145.6	81%	0.813	71%	0.713	S	S	*	*			trans	78.6	113.8	149.8	-62.2	-141.7	177.5	-174.4	0	121.3
72	Y	43.9	Very low	53.5	Low	205 Å²	205	150.4 Å²	150.4	80%	0.804	73%	0.734	S	S	*	*			trans	14.1	118.6	140.1	-47.2	-86.5	0	0	0	120.5
73	V	50.7	Low	52.4	Low	127 Å²	127	156.6 Å²	156.6	77%	0.77	77%	0.766	S	S	*	*			trans	-124.3	107	139.4	-178.7	0	0	0	0	106.2	E75	V73-E75 PolarHBondContact O-N 3.18Å
74	K	44.9	Very low	51.3	Low	187 Å²	187	157.5 Å²	157.5	81%	0.813	77%	0.773	S	S	*	*			trans	-69.5	109.9	160.9	-73.8	-175.4	177.5	-173.8	0	105.3	Q76	K74-Q76 PolarHBondContact O-N 3.4Å
75	E	52.4	Low	50.5	Low	172 Å²	172	166.3 Å²	166.3	80%	0.804	81%	0.808	S	S	*	*			trans	-69.6	121.6	159.7	-144.3	159.9	129	0	0	105.9	V73 E77	V73-E75 PolarHBondContact O-N 3.18Å; E75-E77 PolarHBondContact O-N 3.32Å
76	Q	43	Very low	49.9	Very low	182 Å²	182	175.3 Å²	175.3	85%	0.85	85%	0.845	S	S	*	*			trans	-66.8	108.6	175.6	-69.4	-174.3	-84.8	0	0	108.3	K74	K74-Q76 PolarHBondContact O-N 3.4Å
77	E	46.4	Very low	49.4	Very low	179 Å²	179	173.2 Å²	173.2	84%	0.836	85%	0.85	S	S	*	*			trans	-121.1	118.4	151.7	-75.9	-165.8	96.2	0	0	107.8	E75	E75-E77 PolarHBondContact O-N 3.32Å
78	Q	36.2	Very low	48.8	Very low	269 Å²	269	175.6 Å²	175.6	100%	1.257	86%	0.858	S	S	*	*			trans	84.4	0	-170.7	-57.8	-165.5	-88.2	0	0	118.1

Retrieved 78 of 78 residues in 45.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).