A0A096NCT0_PAPAN Loading...

Cytochrome c oxidase subunit 7B, mitochondrial

AlphaFold DB (A0A2K5W6X1), UniProt , Accession A0A096NCT0, Species PAPAN (Papio anubis, Olive baboon), Gene n/a, Length 80 aa.

						>A0A096NCT0_PAPAN|A0A096NCT0
MFPLVKNALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLAGGATFCIATWTYVATQIGIEWNLSPVGRVTPKEWRNQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.2	Low	71.3	Confident	220 Å²	220	126.7 Å²	126.7	100%	1.084	64%	0.638	S	S	*	*				0	3.6	0	-65.9	-178	122	0	0	114.9
2	F	62.2	Low	72.2	Confident	180 Å²	180	125.7 Å²	125.7	79%	0.789	64%	0.635	S	S	*	*	H	α-helix	trans	-74.2	-32.8	-179.4	-103.5	-99.4	0	0	0	118.9	L4 K6	F2-L4 PolarHBondContact O-N 3.23Å; F2-K6 PolarHBondContact O-N 3.44Å
3	P	64.1	Low	73	Confident	88 Å²	88	125.2 Å²	125.2	57%	0.571	63%	0.629	S	S	*	*	H	α-helix	trans	-74.5	-31.1	-166.9	23.5	-30.3	0	0	0	114	K6 N7	P3-K6 PolarHBondContact O-N 3.41Å; P3-N7 PolarHBondContact O-N 3.29Å
4	L	73.2	Confident	73.7	Confident	142 Å²	142	122.1 Å²	122.1	74%	0.743	62%	0.619	S	S	*	*	H	α-helix	trans	-68.7	-40.7	178	-66.3	174.5	0	0	0	111.8	F2 N7 A8	F2-L4 PolarHBondContact O-N 3.23Å; L4-N7 PolarHBondContact O-N 3.5Å; L4-A8 WeakPolarHBondContact O-CB 3.42Å; L4-A8 PolarHBondContact O-N 2.85Å
5	V	72.4	Confident	74.3	Confident	89 Å²	89	124.5 Å²	124.5	54%	0.539	62%	0.618	S	S	.	*	H	α-helix	trans	-63.8	-43.4	176.5	177.9	0	0	0	0	110.4	N7 A8 L9	V5-N7 PolarHBondContact O-N 3.29Å; V5-A8 PolarHBondContact O-N 2.8Å; V5-L9 HydrophobicContact CG1-CD1 3.88Å; V5-L9 WeakPolarHBondContact O-CB 3.39Å; V5-L9 PolarHBondContact O-N 3.18Å
6	K	69.9	Low	74.8	Confident	135 Å²	135	120.2 Å²	120.2	59%	0.587	60%	0.603	S	S	*	*	H	α-helix	trans	-63.2	-41.8	177.3	-164.8	172.5	-177.9	178.9	0	112.4	F2 P3 N10	F2-K6 PolarHBondContact O-N 3.44Å; P3-K6 PolarHBondContact O-N 3.41Å; K6-N10 WeakPolarHBondContact O-CB 3.24Å; K6-N10 VanDerWaalsContact O-CG 3.24Å; K6-N10 PolarHBondContact O-N 3.32Å; K6-N10 PolarHBondContact O-ND2 2.85Å
7	N	76.5	Confident	75.3	Confident	102 Å²	102	118.1 Å²	118.1	55%	0.545	59%	0.593	S	S	.	*	H	α-helix	trans	-68.7	-37.2	176.8	-82.5	3.2	0	0	0	113.1	P3 L4 V5 R11	P3-N7 PolarHBondContact O-N 3.29Å; L4-N7 PolarHBondContact O-N 3.5Å; V5-N7 PolarHBondContact O-N 3.29Å; N7-R11 WeakPolarHBondContact O-CG 3.26Å; N7-R11 PolarHBondContact O-N 3.14Å; N7-R11 VanDerWaalsContact O-N 3.08Å
8	A	76.9	Confident	75.9	Confident	51 Å²	51	118.6 Å²	118.6	42%	0.421	59%	0.593	S	S	.	*	H	α-helix	trans	-65.9	-45	175.8	0	0	0	0	0	111.7	L4 V5 R11 L12	L4-A8 WeakPolarHBondContact O-CB 3.42Å; L4-A8 PolarHBondContact O-N 2.85Å; V5-A8 PolarHBondContact O-N 2.8Å; A8-R11 PolarHBondContact O-N 3.43Å; A8-L12 WeakPolarHBondContact O-CG 3.45Å; A8-L12 PolarHBondContact O-N 3.36Å
9	L	76.2	Confident	76.3	Confident	106 Å²	106	117.5 Å²	117.5	56%	0.555	59%	0.586	S	S	*	*	H	α-helix	trans	-59.1	-47.6	174.7	-86.6	154.2	0	0	0	112.1	V5 R11 L12 Q13	V5-L9 HydrophobicContact CG1-CD1 3.88Å; V5-L9 WeakPolarHBondContact O-CB 3.39Å; V5-L9 PolarHBondContact O-N 3.18Å; L9-R11 VanDerWaalsContact C-N 3.31Å; L9-R11 PolarHBondContact O-N 2.8Å; L9-L12 PolarHBondContact O-N 2.97Å; L9-Q13 WeakPolarHBondContact O-CB 3.37Å; L9-Q13 PolarHBondContact O-N 2.98Å
10	N	75.8	Confident	76.6	Confident	77 Å²	77	115.6 Å²	115.6	41%	0.412	58%	0.581	S	S	.	*	H	α-helix	trans	-59.9	-41.1	177.6	-74.3	-16	0	0	0	112	K6 Q13 V14	K6-N10 WeakPolarHBondContact O-CB 3.24Å; K6-N10 VanDerWaalsContact O-CG 3.24Å; K6-N10 PolarHBondContact O-N 3.32Å; K6-N10 PolarHBondContact O-ND2 2.85Å; N10-Q13 PolarHBondContact O-N 3.39Å; N10-V14 VanDerWaalsContact O-CG2 3.28Å; N10-V14 WeakPolarHBondContact O-CG2 3.25Å; N10-V14 PolarHBondContact O-N 3.1Å
11	R	78.5	Confident	76.9	Confident	204 Å²	204	115.9 Å²	115.9	77%	0.77	58%	0.582	S	S	*	*	H	α-helix	trans	-65.5	-40.1	176.3	-79.3	-176.9	176.9	-125.5	1.3	112.6	N7 A8 L9 R15	N7-R11 WeakPolarHBondContact O-CG 3.26Å; N7-R11 PolarHBondContact O-N 3.14Å; N7-R11 VanDerWaalsContact O-N 3.08Å; A8-R11 PolarHBondContact O-N 3.43Å; L9-R11 VanDerWaalsContact C-N 3.31Å; L9-R11 PolarHBondContact O-N 2.8Å; R11-R15 WeakPolarHBondContact O-CB 3.41Å; R11-R15 PolarHBondContact O-N 3.22Å
12	L	82.4	Confident	77.9	Confident	114 Å²	114	107.4 Å²	107.4	60%	0.597	55%	0.547	S	S	*	.	H	α-helix	trans	-65.3	-42.4	176.9	-72.3	169.5	0	0	0	111.6	A8 L9 R15 S16	A8-L12 WeakPolarHBondContact O-CG 3.45Å; A8-L12 PolarHBondContact O-N 3.36Å; L9-L12 PolarHBondContact O-N 2.97Å; L12-R15 PolarHBondContact O-N 2.92Å; L12-S16 PolarHBondContact O-N 3.45Å
13	Q	82.8	Confident	78.6	Confident	120 Å²	120	107.6 Å²	107.6	56%	0.561	54%	0.543	S	S	*	.	H	α-helix	trans	-64.6	-43.8	177.6	-173.1	177.7	-9.1	0	0	112.1	L9 N10 R15 S16 I17	L9-Q13 WeakPolarHBondContact O-CB 3.37Å; L9-Q13 PolarHBondContact O-N 2.98Å; N10-Q13 PolarHBondContact O-N 3.39Å; Q13-R15 VanDerWaalsContact C-N 3.3Å; Q13-R15 PolarHBondContact O-N 3.29Å; Q13-S16 PolarHBondContact O-N 2.95Å; Q13-S16 PolarHBondContact O-OG 3.02Å; Q13-I17 HydrophobicContact CG-CD1 4.18Å; Q13-I17 WeakPolarHBondContact O-CD1 3.21Å; Q13-I17 VanDerWaalsContact O-CG1 3.25Å; Q13-I17 WeakPolarHBondContact O-CG1 3.18Å; Q13-I17 PolarHBondContact O-N 3.49Å; Q13-I17 VanDerWaalsContact O-N 3.08Å
14	V	83.3	Confident	79.1	Confident	81 Å²	81	110 Å²	110	49%	0.491	55%	0.546	S	S	.	.	H	α-helix	trans	-62.5	-41.4	175.7	172.3	0	0	0	0	110.8	N10 I17 Q18	N10-V14 VanDerWaalsContact O-CG2 3.28Å; N10-V14 WeakPolarHBondContact O-CG2 3.25Å; N10-V14 PolarHBondContact O-N 3.1Å; V14-I17 PolarHBondContact O-N 3.43Å; V14-Q18 WeakPolarHBondContact O-CG 3.43Å; V14-Q18 PolarHBondContact O-N 2.89Å
15	R	82.6	Confident	78.9	Confident	158 Å²	158	107.5 Å²	107.5	60%	0.596	54%	0.54	S	S	*	.	H	α-helix	trans	-67.4	-38.2	178.8	-165.9	177.6	-175.9	-175.8	2.3	112.4	R11 L12 Q13 Q18 Q19	R11-R15 WeakPolarHBondContact O-CB 3.41Å; R11-R15 PolarHBondContact O-N 3.22Å; L12-R15 PolarHBondContact O-N 2.92Å; Q13-R15 VanDerWaalsContact C-N 3.3Å; Q13-R15 PolarHBondContact O-N 3.29Å; R15-Q18 PolarHBondContact O-N 3.02Å; R15-Q19 WeakPolarHBondContact O-CB 3.43Å; R15-Q19 VanDerWaalsContact O-CG 3.29Å; R15-Q19 WeakPolarHBondContact O-CG 3.45Å; R15-Q19 PolarHBondContact O-N 3.45Å
16	S	81.3	Confident	78.7	Confident	56 Å²	56	110.5 Å²	110.5	39%	0.392	55%	0.548	S	S	.	.	H	α-helix	trans	-68.2	-36.8	177.3	70.4	0	0	0	0	112.1	L12 Q13 Q19 T20	L12-S16 PolarHBondContact O-N 3.45Å; Q13-S16 PolarHBondContact O-N 2.95Å; Q13-S16 PolarHBondContact O-OG 3.02Å; S16-Q19 PolarHBondContact O-N 3.15Å; S16-T20 WeakPolarHBondContact O-CB 3.23Å; S16-T20 PolarHBondContact O-N 2.93Å; S16-T20 PolarHBondContact O-OG1 2.86Å
17	I	83.8	Confident	78.7	Confident	84 Å²	84	110.8 Å²	110.8	43%	0.431	55%	0.552	S	S	.	*	H	α-helix	trans	-62.9	-50.6	173.6	-67.9	164.9	0	0	0	110	Q13 V14 Q19 T20 M21	Q13-I17 HydrophobicContact CG-CD1 4.18Å; Q13-I17 WeakPolarHBondContact O-CD1 3.21Å; Q13-I17 VanDerWaalsContact O-CG1 3.25Å; Q13-I17 WeakPolarHBondContact O-CG1 3.18Å; Q13-I17 PolarHBondContact O-N 3.49Å; Q13-I17 VanDerWaalsContact O-N 3.08Å; V14-I17 PolarHBondContact O-N 3.43Å; I17-Q19 VanDerWaalsContact C-N 3.31Å; I17-Q19 PolarHBondContact O-N 3.33Å; I17-T20 PolarHBondContact O-N 2.67Å; I17-T20 VanDerWaalsContact O-N 3.13Å; I17-M21 HydrophobicContact CG2-CG 4.44Å; I17-M21 HydrophobicContact CG2-SD 4.03Å; I17-M21 WeakPolarHBondContact O-CG 3.44Å; I17-M21 PolarHBondContact O-N 3.45Å
18	Q	85.3	Confident	78.3	Confident	127 Å²	127	114.9 Å²	114.9	59%	0.593	57%	0.565	S	S	*	*	H	α-helix	trans	-59.7	-40.3	178.2	-73.9	-179.3	-30.7	0	0	112.4	V14 R15 M21 A22	V14-Q18 WeakPolarHBondContact O-CG 3.43Å; V14-Q18 PolarHBondContact O-N 2.89Å; R15-Q18 PolarHBondContact O-N 3.02Å; Q18-M21 PolarHBondContact O-N 3.49Å; Q18-A22 VanDerWaalsContact O-CB 3.31Å; Q18-A22 WeakPolarHBondContact O-CB 3.28Å; Q18-A22 PolarHBondContact O-N 2.99Å
19	Q	84.2	Confident	78.3	Confident	99 Å²	99	121.1 Å²	121.1	46%	0.463	58%	0.577	S	S	.	*	H	α-helix	trans	-66.2	-37.8	175.8	-76.2	176.5	-21.6	0	0	112.8	R15 S16 I17 R23	R15-Q19 WeakPolarHBondContact O-CB 3.43Å; R15-Q19 VanDerWaalsContact O-CG 3.29Å; R15-Q19 WeakPolarHBondContact O-CG 3.45Å; R15-Q19 PolarHBondContact O-N 3.45Å; S16-Q19 PolarHBondContact O-N 3.15Å; I17-Q19 VanDerWaalsContact C-N 3.31Å; I17-Q19 PolarHBondContact O-N 3.33Å; Q19-R23 WeakPolarHBondContact O-CB 3.47Å; Q19-R23 VanDerWaalsContact O-CG 3.26Å; Q19-R23 WeakPolarHBondContact O-CG 3.44Å; Q19-R23 PolarHBondContact O-N 2.96Å
20	T	83.4	Confident	78.8	Confident	78 Å²	78	121.3 Å²	121.3	48%	0.479	58%	0.583	S	S	.	*	H	α-helix	trans	-67.6	-43.9	176.8	-56.2	0	0	0	0	110.8	S16 I17 R23 Q24	S16-T20 WeakPolarHBondContact O-CB 3.23Å; S16-T20 PolarHBondContact O-N 2.93Å; S16-T20 PolarHBondContact O-OG1 2.86Å; I17-T20 PolarHBondContact O-N 2.67Å; I17-T20 VanDerWaalsContact O-N 3.13Å; T20-R23 PolarHBondContact O-N 2.95Å; T20-Q24 WeakPolarHBondContact O-CG 3.36Å; T20-Q24 PolarHBondContact O-N 2.93Å
21	M	81.3	Confident	79.5	Confident	122 Å²	122	121 Å²	121	60%	0.601	59%	0.585	S	S	*	*	H	α-helix	trans	-63.9	-42.8	175.6	-68.4	-178.2	74.7	0	0	112.1	I17 Q18 R23 Q24 S25	I17-M21 HydrophobicContact CG2-CG 4.44Å; I17-M21 HydrophobicContact CG2-SD 4.03Å; I17-M21 WeakPolarHBondContact O-CG 3.44Å; I17-M21 PolarHBondContact O-N 3.45Å; Q18-M21 PolarHBondContact O-N 3.49Å; M21-R23 VanDerWaalsContact C-N 3.33Å; M21-R23 PolarHBondContact O-N 3.49Å; M21-Q24 PolarHBondContact O-N 2.82Å; M21-S25 WeakPolarHBondContact O-CB 3.31Å; M21-S25 PolarHBondContact O-N 2.89Å; M21-S25 PolarHBondContact O-OG 3.45Å
22	A	80.3	Confident	80.1	Confident	42 Å²	42	114.6 Å²	114.6	35%	0.347	57%	0.566	S	S	.	*	H	α-helix	trans	-63.9	-38.6	175.6	0	0	0	0	0	111.9	Q18 S25 H26	Q18-A22 VanDerWaalsContact O-CB 3.31Å; Q18-A22 WeakPolarHBondContact O-CB 3.28Å; Q18-A22 PolarHBondContact O-N 2.99Å; A22-S25 WeakPolarHBondContact CA-OG 3.45Å; A22-S25 PolarHBondContact O-N 2.9Å; A22-S25 PolarHBondContact O-OG 3.39Å; A22-H26 WeakPolarHBondContact O-CB 3.22Å; A22-H26 PolarHBondContact O-CD2 3.4Å; A22-H26 PolarHBondContact O-N 2.99Å
23	R	76.9	Confident	80.8	Confident	185 Å²	185	114.7 Å²	114.7	70%	0.698	56%	0.562	S	S	*	*	H	α-helix	trans	-63	-45	173.1	-77	173.7	179.1	-172.4	-0.1	111.2	Q19 T20 M21 H26 Q27	Q19-R23 WeakPolarHBondContact O-CB 3.47Å; Q19-R23 VanDerWaalsContact O-CG 3.26Å; Q19-R23 WeakPolarHBondContact O-CG 3.44Å; Q19-R23 PolarHBondContact O-N 2.96Å; T20-R23 PolarHBondContact O-N 2.95Å; M21-R23 VanDerWaalsContact C-N 3.33Å; M21-R23 PolarHBondContact O-N 3.49Å; R23-H26 CarbonylContact O-C 3.58Å; R23-H26 PolarHBondContact O-N 2.91Å; R23-Q27 VanDerWaalsContact O-CB 3.28Å; R23-Q27 WeakPolarHBondContact O-CB 3.26Å; R23-Q27 PolarHBondContact O-N 2.87Å
24	Q	73.7	Confident	81.5	Confident	137 Å²	137	115.4 Å²	115.4	64%	0.64	57%	0.565	S	S	*	*	H	α-helix	trans	-65	-37.3	175.8	-73.8	-168.2	-38.4	0	0	112.8	T20 M21 H26 Q27	T20-Q24 WeakPolarHBondContact O-CG 3.36Å; T20-Q24 PolarHBondContact O-N 2.93Å; M21-Q24 PolarHBondContact O-N 2.82Å; Q24-H26 VanDerWaalsContact C-N 3.34Å; Q24-Q27 PolarHBondContact O-N 3.02Å
25	S	69.7	Low	82.1	Confident	90 Å²	90	115.4 Å²	115.4	63%	0.629	56%	0.562	S	S	*	*	H	α-helix	trans	-70	-31.2	177.1	69.7	0	0	0	0	112.7	M21 A22	M21-S25 WeakPolarHBondContact O-CB 3.31Å; M21-S25 PolarHBondContact O-N 2.89Å; M21-S25 PolarHBondContact O-OG 3.45Å; A22-S25 WeakPolarHBondContact CA-OG 3.45Å; A22-S25 PolarHBondContact O-N 2.9Å; A22-S25 PolarHBondContact O-OG 3.39Å
26	H	67.8	Low	82.7	Confident	152 Å²	152	113.8 Å²	113.8	70%	0.704	56%	0.559	S	S	*	*	H	α-helix	trans	-88.7	-11.6	175.2	-73.1	-62.3	0	0	0	113.8	A22 R23 Q24 K28	A22-H26 WeakPolarHBondContact O-CB 3.22Å; A22-H26 PolarHBondContact O-CD2 3.4Å; A22-H26 PolarHBondContact O-N 2.99Å; R23-H26 CarbonylContact O-C 3.58Å; R23-H26 PolarHBondContact O-N 2.91Å; Q24-H26 VanDerWaalsContact C-N 3.34Å; H26-K28 VanDerWaalsContact C-N 3.31Å; H26-K28 PolarHBondContact O-N 3.42Å
27	Q	70.9	Confident	83.6	Confident	142 Å²	142	116.9 Å²	116.9	66%	0.664	56%	0.564	S	S	*	*	S	Bend	trans	-72.4	91.7	172.6	-161.4	158.7	-17.1	0	0	107.3	R23 Q24 R29	R23-Q27 VanDerWaalsContact O-CB 3.28Å; R23-Q27 WeakPolarHBondContact O-CB 3.26Å; R23-Q27 PolarHBondContact O-N 2.87Å; Q24-Q27 PolarHBondContact O-N 3.02Å; Q27-R29 PolarHBondContact O-N 2.82Å
28	K	66.9	Low	84.2	Confident	188 Å²	188	113.8 Å²	113.8	82%	0.817	55%	0.552	S	S	*	*			trans	-50.4	111.1	168.8	-69.9	-172.9	-179.9	-176.9	0	106.6	H26 T30	H26-K28 VanDerWaalsContact C-N 3.31Å; H26-K28 PolarHBondContact O-N 3.42Å; K28-T30 PolarHBondContact O-N 2.82Å
29	R	77.5	Confident	84.9	Confident	182 Å²	182	114.5 Å²	114.5	69%	0.687	56%	0.56	S	S	*	*			trans	-54.2	109.2	177.6	177.7	177.7	170.3	-171.6	-6.8	106.9	Q27 D32 D35	Q27-R29 PolarHBondContact O-N 2.82Å; R29-D32 IonicContact NH2-OD2 3.51Å; R29-D35 IonicContact CZ-OD1 3.6Å; R29-D35 IonicContact CZ-OD2 3.97Å; R29-D35 IonicContact NE-OD2 2.89Å; R29-D35 VanDerWaalsContact NH2-CG 3.32Å; R29-D35 IonicContact NH2-OD1 2.97Å; R29-D35 PolarHBondContact NH2-OD1 3.29Å; R29-D35 IonicContact NH2-OD2 3.82Å; R29-D35 PolarHBondContact NH2-OD2 3.26Å
30	T	85.8	Confident	85.6	Confident	110 Å²	110	113 Å²	113	68%	0.675	57%	0.565	S	S	*	*			trans	-76.4	129.1	174.6	-61.4	0	0	0	0	106.3	K28 D32	K28-T30 PolarHBondContact O-N 2.82Å; T30-D32 PolarHBondContact O-N 3.5Å; T30-D32 VanDerWaalsContact O-N 3.14Å
31	P	91.2	Very high	86.3	Confident	69 Å²	69	113.3 Å²	113.3	45%	0.448	57%	0.566	S	S	.	*			trans	-53.7	123.1	179.8	-27.1	34.5	0	0	0	110.2	D35 K36	P31-D35 WeakPolarHBondContact CA-OD2 3.48Å; P31-D35 HydrophobicContact CB-CB 3.76Å; P31-K36 HydrophobicContact CB-CG 4.03Å; P31-K36 WeakPolarHBondContact O-CE 3.28Å
32	D	91.3	Very high	87.1	Confident	70 Å²	70	113.4 Å²	113.4	37%	0.374	57%	0.569	S	S	.	*			trans	-80	-172.9	175.9	68.5	33	0	0	0	110.8	R29 T30 H34 D35 K36	R29-D32 IonicContact NH2-OD2 3.51Å; T30-D32 PolarHBondContact O-N 3.5Å; T30-D32 VanDerWaalsContact O-N 3.14Å; D32-H34 VanDerWaalsContact C-N 3.3Å; D32-H34 PolarHBondContact O-N 3.14Å; D32-H34 WeakPolarHBondContact OD1-CA 3.44Å; D32-H34 WeakPolarHBondContact OD1-CB 3.5Å; D32-H34 IonicContact OD1-CD2 3.98Å; D32-H34 PolarHBondContact OD1-N 3.03Å; D32-D35 PolarHBondContact N-OD2 2.92Å; D32-D35 PolarHBondContact O-N 3.14Å; D32-D35 PolarHBondContact OD1-N 3.06Å; D32-K36 WeakPolarHBondContact O-CG 3.19Å; D32-K36 PolarHBondContact O-N 3.43Å; D32-K36 VanDerWaalsContact O-N 3.14Å
33	F	96.7	Very high	88	Confident	117 Å²	117	114.2 Å²	114.2	51%	0.513	58%	0.575	S	S	.	*	H	α-helix	trans	-60.4	-40.6	179.8	178	-90.7	0	0	0	112.5	K36 Y37 V41	F33-K36 PolarHBondContact O-N 2.96Å; F33-Y37 AromaticContact CD2-CD2 3.47Å; F33-Y37 HydrophobicContact CD2-CD2 3.47Å; F33-Y37 VanDerWaalsContact CD2-CD2 3.47Å; F33-Y37 HydrophobicContact CD2-CE2 4.1Å; F33-Y37 HydrophobicContact CD2-CG 4.41Å; F33-Y37 AromaticContact CE2-CD2 3.55Å; F33-Y37 HydrophobicContact CE2-CD2 3.55Å; F33-Y37 HydrophobicContact CE2-CE2 4.3Å; F33-Y37 HydrophobicContact CE2-CG 4.12Å; F33-Y37 HydrophobicContact CG-CD2 4.12Å; F33-Y37 HydrophobicContact CZ-CD2 4.25Å; F33-Y37 HydrophobicContact CZ-CG 4.45Å; F33-Y37 WeakPolarHBondContact O-CB 3.43Å; F33-Y37 WeakPolarHBondContact O-CD2 3.42Å; F33-Y37 PolarHBondContact O-N 2.97Å; F33-V41 HydrophobicContact CE1-CG2 4.49Å; F33-V41 HydrophobicContact CZ-CG2 4.21Å
34	H	97.3	Very high	89	Confident	135 Å²	135	107.4 Å²	107.4	63%	0.625	56%	0.563	S	S	*	*	H	α-helix	trans	-72.4	-36	-177.2	-58.7	-71.4	0	0	0	111	D32 K36 G38	D32-H34 VanDerWaalsContact C-N 3.3Å; D32-H34 PolarHBondContact O-N 3.14Å; D32-H34 WeakPolarHBondContact OD1-CA 3.44Å; D32-H34 WeakPolarHBondContact OD1-CB 3.5Å; D32-H34 IonicContact OD1-CD2 3.98Å; D32-H34 PolarHBondContact OD1-N 3.03Å; H34-K36 VanDerWaalsContact C-N 3.28Å; H34-K36 PolarHBondContact O-N 3.42Å; H34-G38 VanDerWaalsContact O-CA 3.28Å; H34-G38 WeakPolarHBondContact O-CA 3.4Å; H34-G38 PolarHBondContact O-N 2.87Å
35	D	95.8	Very high	90.2	Very high	81 Å²	81	102.8 Å²	102.8	43%	0.433	55%	0.551	S	S	.	*	H	α-helix	trans	-62.2	-37.1	172.9	-63.6	-41.3	0	0	0	111.6	R29 P31 D32	R29-D35 IonicContact CZ-OD1 3.6Å; R29-D35 IonicContact CZ-OD2 3.97Å; R29-D35 IonicContact NE-OD2 2.89Å; R29-D35 VanDerWaalsContact NH2-CG 3.32Å; R29-D35 IonicContact NH2-OD1 2.97Å; R29-D35 PolarHBondContact NH2-OD1 3.29Å; R29-D35 IonicContact NH2-OD2 3.82Å; R29-D35 PolarHBondContact NH2-OD2 3.26Å; P31-D35 WeakPolarHBondContact CA-OD2 3.48Å; P31-D35 HydrophobicContact CB-CB 3.76Å; D32-D35 PolarHBondContact N-OD2 2.92Å; D32-D35 PolarHBondContact O-N 3.14Å; D32-D35 PolarHBondContact OD1-N 3.06Å
36	K	96.9	Very high	91.6	Very high	123 Å²	123	100.6 Å²	100.6	54%	0.535	54%	0.539	S	S	.	.	H	α-helix	trans	-85.7	-39.7	-177.5	-70.6	179	-178.2	179.3	0	114.3	P31 D32 F33 H34	P31-K36 HydrophobicContact CB-CG 4.03Å; P31-K36 WeakPolarHBondContact O-CE 3.28Å; D32-K36 WeakPolarHBondContact O-CG 3.19Å; D32-K36 PolarHBondContact O-N 3.43Å; D32-K36 VanDerWaalsContact O-N 3.14Å; F33-K36 PolarHBondContact O-N 2.96Å; H34-K36 VanDerWaalsContact C-N 3.28Å; H34-K36 PolarHBondContact O-N 3.42Å
37	Y	98.3	Very high	93.1	Very high	122 Å²	122	98 Å²	98	48%	0.478	53%	0.534	S	S	.	.	H	α-helix	trans	-127.7	-10.7	-166	-53.3	-69.3	0	0	0	113.5	F33 N39 A40 V41	F33-Y37 AromaticContact CD2-CD2 3.47Å; F33-Y37 HydrophobicContact CD2-CD2 3.47Å; F33-Y37 VanDerWaalsContact CD2-CD2 3.47Å; F33-Y37 HydrophobicContact CD2-CE2 4.1Å; F33-Y37 HydrophobicContact CD2-CG 4.41Å; F33-Y37 AromaticContact CE2-CD2 3.55Å; F33-Y37 HydrophobicContact CE2-CD2 3.55Å; F33-Y37 HydrophobicContact CE2-CE2 4.3Å; F33-Y37 HydrophobicContact CE2-CG 4.12Å; F33-Y37 HydrophobicContact CG-CD2 4.12Å; F33-Y37 HydrophobicContact CZ-CD2 4.25Å; F33-Y37 HydrophobicContact CZ-CG 4.45Å; F33-Y37 WeakPolarHBondContact O-CB 3.43Å; F33-Y37 WeakPolarHBondContact O-CD2 3.42Å; F33-Y37 PolarHBondContact O-N 2.97Å; Y37-N39 VanDerWaalsContact C-N 3.34Å; Y37-N39 PolarHBondContact O-N 3.36Å; Y37-A40 PolarHBondContact O-N 2.89Å; Y37-V41 WeakPolarHBondContact O-CB 3.49Å; Y37-V41 WeakPolarHBondContact O-CG2 3.28Å; Y37-V41 PolarHBondContact O-N 2.9Å
38	G	98.3	Very high	94.4	Very high	19 Å²	19	98.2 Å²	98.2	20%	0.196	53%	0.533	C	S	.	.	H	α-helix	trans	-53.3	-49.1	-172.4	0	0	0	0	0	112.7	H34 A40 L42	H34-G38 VanDerWaalsContact O-CA 3.28Å; H34-G38 WeakPolarHBondContact O-CA 3.4Å; H34-G38 PolarHBondContact O-N 2.87Å; G38-A40 PolarHBondContact O-N 2.84Å; G38-L42 WeakPolarHBondContact O-CB 3.49Å; G38-L42 PolarHBondContact O-N 2.9Å
39	N	98.5	Very high	96	Very high	141 Å²	141	92.2 Å²	92.2	75%	0.754	51%	0.514	S	S	*	.	H	α-helix	trans	-65.9	-40.3	178.9	-68.8	-19	0	0	0	112.7	Y37 A43	Y37-N39 VanDerWaalsContact C-N 3.34Å; Y37-N39 PolarHBondContact O-N 3.36Å; N39-A43 VanDerWaalsContact O-CB 3.26Å; N39-A43 WeakPolarHBondContact O-CB 3.26Å; N39-A43 PolarHBondContact O-N 2.94Å
40	A	98.6	Very high	97	Very high	68 Å²	68	89 Å²	89	56%	0.562	51%	0.509	S	S	*	.	H	α-helix	trans	-69.3	-43.4	-179.3	0	0	0	0	0	111.7	Y37 G38 G44	Y37-A40 PolarHBondContact O-N 2.89Å; G38-A40 PolarHBondContact O-N 2.84Å; A40-G44 PolarHBondContact O-N 3.25Å
41	V	98.8	Very high	97.6	Very high	85 Å²	85	86.4 Å²	86.4	52%	0.515	50%	0.499	S	S	.	.	H	α-helix	trans	-63.7	-43.9	175.4	171.9	0	0	0	0	110.3	F33 Y37 G45	F33-V41 HydrophobicContact CE1-CG2 4.49Å; F33-V41 HydrophobicContact CZ-CG2 4.21Å; Y37-V41 WeakPolarHBondContact O-CB 3.49Å; Y37-V41 WeakPolarHBondContact O-CG2 3.28Å; Y37-V41 PolarHBondContact O-N 2.9Å; V41-G45 WeakPolarHBondContact O-CA 3.41Å; V41-G45 PolarHBondContact O-N 3.3Å
42	L	98.8	Very high	98	Very high	124 Å²	124	85.9 Å²	85.9	65%	0.649	50%	0.495	S	S	*	.	H	α-helix	trans	-63.9	-52.4	179.1	-179.3	61.2	0	0	0	111.4	G38 A46	G38-L42 WeakPolarHBondContact O-CB 3.49Å; G38-L42 PolarHBondContact O-N 2.9Å; L42-A46 VanDerWaalsContact O-CB 3.22Å; L42-A46 WeakPolarHBondContact O-CB 3.45Å; L42-A46 PolarHBondContact O-N 2.8Å
43	A	98.8	Very high	98.3	Very high	59 Å²	59	90.9 Å²	90.9	49%	0.488	51%	0.508	S	S	.	.	H	α-helix	trans	-63.5	-50.9	-179.3	0	0	0	0	0	111.3	N39 G45 A46 T47	N39-A43 VanDerWaalsContact O-CB 3.26Å; N39-A43 WeakPolarHBondContact O-CB 3.26Å; N39-A43 PolarHBondContact O-N 2.94Å; A43-G45 PolarHBondContact O-N 3.41Å; A43-A46 PolarHBondContact O-N 2.82Å; A43-T47 WeakPolarHBondContact O-CB 3.45Å; A43-T47 PolarHBondContact O-N 3.48Å; A43-T47 PolarHBondContact O-OG1 3.05Å
44	G	98.8	Very high	98.4	Very high	42 Å²	42	88.9 Å²	88.9	43%	0.433	51%	0.506	S	S	.	.	H	α-helix	trans	-63.3	-44.1	-179.2	0	0	0	0	0	112.8	A40 T47 F48	A40-G44 PolarHBondContact O-N 3.25Å; G44-T47 PolarHBondContact O-N 2.92Å; G44-F48 VanDerWaalsContact O-CB 3.28Å; G44-F48 WeakPolarHBondContact O-CB 3.29Å; G44-F48 PolarHBondContact O-N 3.48Å
45	G	98.8	Very high	98.5	Very high	39 Å²	39	89 Å²	89	40%	0.402	50%	0.502	S	S	.	.	H	α-helix	trans	-63.8	-42.9	177.8	0	0	0	0	0	112.5	V41 A43 C49	V41-G45 WeakPolarHBondContact O-CA 3.41Å; V41-G45 PolarHBondContact O-N 3.3Å; A43-G45 PolarHBondContact O-N 3.41Å; G45-C49 WeakPolarHBondContact O-CB 3.38Å; G45-C49 PolarHBondContact O-N 2.9Å
46	A	98.9	Very high	98.6	Very high	45 Å²	45	87 Å²	87	37%	0.372	49%	0.493	S	S	.	.	H	α-helix	trans	-64.2	-47.7	176.1	0	0	0	0	0	111.6	L42 A43 F48 C49 I50	L42-A46 VanDerWaalsContact O-CB 3.22Å; L42-A46 WeakPolarHBondContact O-CB 3.45Å; L42-A46 PolarHBondContact O-N 2.8Å; A43-A46 PolarHBondContact O-N 2.82Å; A46-F48 PolarHBondContact O-N 3.34Å; A46-C49 PolarHBondContact O-N 2.93Å; A46-I50 WeakPolarHBondContact O-CB 3.47Å; A46-I50 VanDerWaalsContact O-CG1 3.31Å; A46-I50 WeakPolarHBondContact O-CG1 3.37Å; A46-I50 PolarHBondContact O-N 3.32Å
47	T	98.9	Very high	98.7	Very high	98 Å²	98	82.8 Å²	82.8	60%	0.601	48%	0.481	S	S	*	.	H	α-helix	trans	-59.8	-47.9	177.8	-61.9	0	0	0	0	111.5	A43 G44 A51	A43-T47 WeakPolarHBondContact O-CB 3.45Å; A43-T47 PolarHBondContact O-N 3.48Å; A43-T47 PolarHBondContact O-OG1 3.05Å; G44-T47 PolarHBondContact O-N 2.92Å; T47-A51 VanDerWaalsContact O-CB 3.23Å; T47-A51 WeakPolarHBondContact O-CB 3.25Å; T47-A51 PolarHBondContact O-N 2.89Å
48	F	98.8	Very high	98.7	Very high	146 Å²	146	81 Å²	81	64%	0.64	48%	0.483	S	S	*	.	H	α-helix	trans	-59.7	-50.3	178	173	-103	0	0	0	111.5	G44 A46 I50 A51 T52	G44-F48 VanDerWaalsContact O-CB 3.28Å; G44-F48 WeakPolarHBondContact O-CB 3.29Å; G44-F48 PolarHBondContact O-N 3.48Å; A46-F48 PolarHBondContact O-N 3.34Å; F48-I50 PolarHBondContact O-N 2.95Å; F48-A51 PolarHBondContact O-N 3.39Å; F48-T52 WeakPolarHBondContact CE2-OG1 3.44Å; F48-T52 WeakPolarHBondContact O-CB 3.31Å; F48-T52 PolarHBondContact O-N 3.08Å; F48-T52 PolarHBondContact O-OG1 3.37Å
49	C	98.8	Very high	98.7	Very high	62 Å²	62	86 Å²	86	42%	0.419	50%	0.501	S	S	.	.	H	α-helix	trans	-57.7	-50.7	-178.8	-175.9	0	0	0	0	111.6	G45 A46 W53	G45-C49 WeakPolarHBondContact O-CB 3.38Å; G45-C49 PolarHBondContact O-N 2.9Å; A46-C49 PolarHBondContact O-N 2.93Å; C49-W53 WeakPolarHBondContact O-CB 3.36Å; C49-W53 PolarHBondContact O-N 3.45Å
50	I	98.8	Very high	98.7	Very high	113 Å²	113	83.9 Å²	83.9	58%	0.579	49%	0.489	S	S	*	.	H	α-helix	trans	-62.9	-46.8	-179.5	-67.4	167.8	0	0	0	110.5	A46 F48 T54	A46-I50 WeakPolarHBondContact O-CB 3.47Å; A46-I50 VanDerWaalsContact O-CG1 3.31Å; A46-I50 WeakPolarHBondContact O-CG1 3.37Å; A46-I50 PolarHBondContact O-N 3.32Å; F48-I50 PolarHBondContact O-N 2.95Å; I50-T54 WeakPolarHBondContact O-CB 3.48Å; I50-T54 PolarHBondContact O-N 2.96Å; I50-T54 PolarHBondContact O-OG1 3.45Å
51	A	98.8	Very high	98.6	Very high	56 Å²	56	84 Å²	84	46%	0.463	50%	0.496	S	S	.	.	H	α-helix	trans	-61.9	-49.1	-178.4	0	0	0	0	0	111.8	T47 F48 T54 Y55	T47-A51 VanDerWaalsContact O-CB 3.23Å; T47-A51 WeakPolarHBondContact O-CB 3.25Å; T47-A51 PolarHBondContact O-N 2.89Å; F48-A51 PolarHBondContact O-N 3.39Å; A51-T54 PolarHBondContact O-N 2.96Å; A51-Y55 WeakPolarHBondContact O-CB 3.37Å; A51-Y55 PolarHBondContact O-N 3.03Å
52	T	98.9	Very high	98.6	Very high	58 Å²	58	83 Å²	83	36%	0.356	49%	0.488	S	S	.	.	H	α-helix	trans	-63.8	-47.5	-179.2	-62	0	0	0	0	111.6	F48 T54 Y55 V56	F48-T52 WeakPolarHBondContact CE2-OG1 3.44Å; F48-T52 WeakPolarHBondContact O-CB 3.31Å; F48-T52 PolarHBondContact O-N 3.08Å; F48-T52 PolarHBondContact O-OG1 3.37Å; T52-T54 PolarHBondContact O-N 3.43Å; T52-Y55 PolarHBondContact O-N 2.91Å; T52-V56 WeakPolarHBondContact O-CG2 3.49Å; T52-V56 PolarHBondContact O-N 3.35Å
53	W	98.8	Very high	98.6	Very high	175 Å²	175	85.4 Å²	85.4	66%	0.663	50%	0.495	S	S	*	.	H	α-helix	trans	-69.8	-33.4	-179.5	-82.5	106.6	0	0	0	113	C49 V56 A57	C49-W53 WeakPolarHBondContact O-CB 3.36Å; C49-W53 PolarHBondContact O-N 3.45Å; W53-V56 HydrophobicContact CE3-CB 4.44Å; W53-V56 HydrophobicContact CE3-CG1 4.29Å; W53-V56 HydrophobicContact CZ3-CG1 4.28Å; W53-V56 PolarHBondContact O-N 3.46Å; W53-A57 VanDerWaalsContact O-CB 3.24Å; W53-A57 WeakPolarHBondContact O-CB 3.35Å; W53-A57 PolarHBondContact O-N 3.35Å
54	T	98.8	Very high	98.5	Very high	75 Å²	75	89.7 Å²	89.7	46%	0.46	50%	0.499	S	S	.	.	H	α-helix	trans	-62.6	-47	171.9	-59.1	0	0	0	0	110.3	I50 A51 T52 V56 A57 T58	I50-T54 WeakPolarHBondContact O-CB 3.48Å; I50-T54 PolarHBondContact O-N 2.96Å; I50-T54 PolarHBondContact O-OG1 3.45Å; A51-T54 PolarHBondContact O-N 2.96Å; T52-T54 PolarHBondContact O-N 3.43Å; T54-V56 PolarHBondContact O-N 3.42Å; T54-A57 PolarHBondContact O-N 3Å; T54-A57 VanDerWaalsContact O-N 3.14Å; T54-T58 PolarHBondContact O-N 3.29Å; T54-T58 PolarHBondContact O-OG1 3.03Å; T54-T58 VanDerWaalsContact O-OG1 3.1Å
55	Y	98.7	Very high	98.5	Very high	137 Å²	137	94.3 Å²	94.3	54%	0.537	51%	0.514	S	S	.	.	H	α-helix	trans	-58.9	-46.8	176.8	-179.4	-88.9	0	0	0	112.1	A51 T52 A57 T58 Q59 I60	A51-Y55 WeakPolarHBondContact O-CB 3.37Å; A51-Y55 PolarHBondContact O-N 3.03Å; T52-Y55 PolarHBondContact O-N 2.91Å; Y55-A57 VanDerWaalsContact C-N 3.3Å; Y55-A57 PolarHBondContact O-N 3.5Å; Y55-T58 PolarHBondContact O-N 3.13Å; Y55-Q59 HydrophobicContact CD1-CB 4.37Å; Y55-Q59 HydrophobicContact CD2-CB 3.62Å; Y55-Q59 HydrophobicContact CD2-CG 3.5Å; Y55-Q59 HydrophobicContact CE1-CB 4.27Å; Y55-Q59 HydrophobicContact CE2-CB 3.51Å; Y55-Q59 HydrophobicContact CE2-CG 3.77Å; Y55-Q59 HydrophobicContact CG-CB 4.05Å; Y55-Q59 HydrophobicContact CG-CG 4.12Å; Y55-Q59 WeakPolarHBondContact O-CA 3.28Å; Y55-Q59 VanDerWaalsContact O-CB 3.25Å; Y55-Q59 WeakPolarHBondContact O-CB 3.46Å; Y55-Q59 PolarHBondContact O-N 3.19Å; Y55-I60 HydrophobicContact CD1-CG2 4.13Å; Y55-I60 HydrophobicContact CE1-CG2 3.6Å
56	V	98.6	Very high	98.4	Very high	40 Å²	40	97.9 Å²	97.9	24%	0.242	52%	0.523	C	S	.	.	H	α-helix	trans	-59.8	-43.6	175.1	169.3	0	0	0	0	110.7	T52 W53 T54 T58 I60 I62	T52-V56 WeakPolarHBondContact O-CG2 3.49Å; T52-V56 PolarHBondContact O-N 3.35Å; W53-V56 HydrophobicContact CE3-CB 4.44Å; W53-V56 HydrophobicContact CE3-CG1 4.29Å; W53-V56 HydrophobicContact CZ3-CG1 4.28Å; W53-V56 PolarHBondContact O-N 3.46Å; T54-V56 PolarHBondContact O-N 3.42Å; V56-T58 VanDerWaalsContact C-N 3.31Å; V56-T58 PolarHBondContact O-N 2.89Å; V56-I60 HydrophobicContact CB-CD1 4.5Å; V56-I60 HydrophobicContact CG1-CD1 3.98Å; V56-I60 WeakPolarHBondContact O-CG1 3.4Å; V56-I62 HydrophobicContact CG1-CD1 3.87Å; V56-I62 VanDerWaalsContact O-CD1 3.26Å; V56-I62 WeakPolarHBondContact O-CD1 3.44Å
57	A	98.5	Very high	98.3	Very high	34 Å²	34	98.9 Å²	98.9	28%	0.281	53%	0.527	S	S	.	.	H	α-helix	trans	-67.4	-30.3	-176.5	0	0	0	0	0	113.6	W53 T54 Y55 W64	W53-A57 VanDerWaalsContact O-CB 3.24Å; W53-A57 WeakPolarHBondContact O-CB 3.35Å; W53-A57 PolarHBondContact O-N 3.35Å; T54-A57 PolarHBondContact O-N 3Å; T54-A57 VanDerWaalsContact O-N 3.14Å; Y55-A57 VanDerWaalsContact C-N 3.3Å; Y55-A57 PolarHBondContact O-N 3.5Å; A57-W64 HydrophobicContact CB-CZ2 4.11Å; A57-W64 PolarHBondContact O-NE1 3Å
58	T	98.1	Very high	98.3	Very high	86 Å²	86	97.9 Å²	97.9	53%	0.528	52%	0.523	S	S	.	.	H	α-helix	trans	-118.4	-27.3	-170.3	68.2	0	0	0	0	115.1	T54 Y55 V56	T54-T58 PolarHBondContact O-N 3.29Å; T54-T58 PolarHBondContact O-OG1 3.03Å; T54-T58 VanDerWaalsContact O-OG1 3.1Å; Y55-T58 PolarHBondContact O-N 3.13Å; V56-T58 VanDerWaalsContact C-N 3.31Å; V56-T58 PolarHBondContact O-N 2.89Å
59	Q	98.4	Very high	98.3	Very high	122 Å²	122	96.7 Å²	96.7	57%	0.57	53%	0.527	S	S	*	.	H	α-helix	trans	-104.5	-17.4	-165	-56.1	-53.6	110.8	0	0	115.1	Y55	Y55-Q59 HydrophobicContact CD1-CB 4.37Å; Y55-Q59 HydrophobicContact CD2-CB 3.62Å; Y55-Q59 HydrophobicContact CD2-CG 3.5Å; Y55-Q59 HydrophobicContact CE1-CB 4.27Å; Y55-Q59 HydrophobicContact CE2-CB 3.51Å; Y55-Q59 HydrophobicContact CE2-CG 3.77Å; Y55-Q59 HydrophobicContact CG-CB 4.05Å; Y55-Q59 HydrophobicContact CG-CG 4.12Å; Y55-Q59 WeakPolarHBondContact O-CA 3.28Å; Y55-Q59 VanDerWaalsContact O-CB 3.25Å; Y55-Q59 WeakPolarHBondContact O-CB 3.46Å; Y55-Q59 PolarHBondContact O-N 3.19Å
60	I	98.2	Very high	98.2	Very high	98 Å²	98	97.9 Å²	97.9	50%	0.503	55%	0.55	S	S	.	*	S	Bend	trans	-98.8	9.1	-176.2	73.7	177.2	0	0	0	113.7	Y55 V56 I62	Y55-I60 HydrophobicContact CD1-CG2 4.13Å; Y55-I60 HydrophobicContact CE1-CG2 3.6Å; V56-I60 HydrophobicContact CB-CD1 4.5Å; V56-I60 HydrophobicContact CG1-CD1 3.98Å; V56-I60 WeakPolarHBondContact O-CG1 3.4Å; I60-I62 HydrophobicContact CD1-CD1 4.12Å; I60-I62 HydrophobicContact CD1-CG1 4.09Å; I60-I62 HydrophobicContact CG1-CD1 4.2Å; I60-I62 HydrophobicContact CG1-CG1 3.76Å
61	G	97.8	Very high	98.1	Very high	70 Å²	70	100.5 Å²	100.5	72%	0.722	55%	0.553	S	S	*	*			trans	76	30.3	175.9	0	0	0	0	0	114.7	E63	G61-E63 PolarHBondContact O-N 3.37Å
62	I	98.2	Very high	98.1	Very high	65 Å²	65	102.5 Å²	102.5	33%	0.333	56%	0.559	S	S	.	*			trans	-61.9	121.8	171.9	-60.7	-178.1	0	0	0	109.1	V56 I60 W64	V56-I62 HydrophobicContact CG1-CD1 3.87Å; V56-I62 VanDerWaalsContact O-CD1 3.26Å; V56-I62 WeakPolarHBondContact O-CD1 3.44Å; I60-I62 HydrophobicContact CD1-CD1 4.12Å; I60-I62 HydrophobicContact CD1-CG1 4.09Å; I60-I62 HydrophobicContact CG1-CD1 4.2Å; I60-I62 HydrophobicContact CG1-CG1 3.76Å; I62-W64 HydrophobicContact CB-CZ2 4.22Å; I62-W64 HydrophobicContact CD1-CH2 4.48Å; I62-W64 HydrophobicContact CD1-CZ2 3.97Å; I62-W64 HydrophobicContact CG2-CD2 3.81Å; I62-W64 HydrophobicContact CG2-CE3 4.23Å; I62-W64 HydrophobicContact CG2-CG 4.27Å; I62-W64 HydrophobicContact CG2-CH2 4.2Å; I62-W64 HydrophobicContact CG2-CZ2 3.77Å; I62-W64 HydrophobicContact CG2-CZ3 4.41Å; I62-W64 PolarHBondContact O-N 2.93Å
63	E	98	Very high	98	Very high	173 Å²	173	105.9 Å²	105.9	81%	0.808	58%	0.58	S	S	*	*			trans	-80.9	103.8	171.3	-170.9	171.5	-174	0	0	109.8	G61	G61-E63 PolarHBondContact O-N 3.37Å
64	W	97.8	Very high	97.9	Very high	149 Å²	149	103.4 Å²	103.4	56%	0.564	59%	0.586	S	S	*	*			trans	-81.4	-16.1	-179.6	-67	105.9	0	0	0	114.1	A57 I62 L66	A57-W64 HydrophobicContact CB-CZ2 4.11Å; A57-W64 PolarHBondContact O-NE1 3Å; I62-W64 HydrophobicContact CB-CZ2 4.22Å; I62-W64 HydrophobicContact CD1-CH2 4.48Å; I62-W64 HydrophobicContact CD1-CZ2 3.97Å; I62-W64 HydrophobicContact CG2-CD2 3.81Å; I62-W64 HydrophobicContact CG2-CE3 4.23Å; I62-W64 HydrophobicContact CG2-CG 4.27Å; I62-W64 HydrophobicContact CG2-CH2 4.2Å; I62-W64 HydrophobicContact CG2-CZ2 3.77Å; I62-W64 HydrophobicContact CG2-CZ3 4.41Å; I62-W64 PolarHBondContact O-N 2.93Å; W64-L66 VanDerWaalsContact C-N 3.26Å; W64-L66 HydrophobicContact CB-CD2 4.02Å; W64-L66 HydrophobicContact CB-CG 3.91Å; W64-L66 PolarHBondContact O-N 3.01Å
65	N	97.6	Very high	97.7	Very high	140 Å²	140	108.7 Å²	108.7	75%	0.749	60%	0.603	S	S	*	*			trans	42.5	49.9	-177	-167.6	25.6	0	0	0	113.6
66	L	97.2	Very high	97.6	Very high	114 Å²	114	110.1 Å²	110.1	60%	0.597	61%	0.614	S	S	*	*			trans	-66.1	158.6	-179.5	-59.6	179.7	0	0	0	111.1	W64	W64-L66 VanDerWaalsContact C-N 3.26Å; W64-L66 HydrophobicContact CB-CD2 4.02Å; W64-L66 HydrophobicContact CB-CG 3.91Å; W64-L66 PolarHBondContact O-N 3.01Å
67	S	97.6	Very high	97.4	Very high	65 Å²	65	118.9 Å²	118.9	46%	0.455	64%	0.643	S	S	.	*			trans	-49.9	131.6	179.8	176.5	0	0	0	0	112.3	V69 R71	S67-V69 VanDerWaalsContact C-N 3.25Å; S67-V69 PolarHBondContact O-N 3.47Å; S67-V69 PolarHBondContact OG-N 3.23Å; S67-R71 PolarHBondContact O-NH1 3.04Å
68	P	97.6	Very high	97.1	Very high	78 Å²	78	126.6 Å²	126.6	51%	0.506	67%	0.665	S	S	.	*			trans	-75.5	-15.4	-179.3	30.8	-35.6	0	0	0	112.9	G70 R71 V72	P68-G70 PolarHBondContact O-N 3.48Å; P68-R71 PolarHBondContact O-N 3.04Å; P68-V72 HydrophobicContact CB-CB 3.99Å; P68-V72 HydrophobicContact CB-CG2 3.95Å; P68-V72 PolarHBondContact O-N 3.39Å
69	V	98.2	Very high	96.2	Very high	120 Å²	120	129.7 Å²	129.7	73%	0.727	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.2	121.4	-177.2	-179.3	0	0	0	0	110.2	S67 R71	S67-V69 VanDerWaalsContact C-N 3.25Å; S67-V69 PolarHBondContact O-N 3.47Å; S67-V69 PolarHBondContact OG-N 3.23Å; V69-R71 PolarHBondContact O-N 2.98Å
70	G	97.3	Very high	94.8	Very high	88 Å²	88	136.7 Å²	136.7	91%	0.907	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	72.3	7.6	-178.5	0	0	0	0	0	115.2	P68	P68-G70 PolarHBondContact O-N 3.48Å
71	R	97.5	Very high	94.6	Very high	168 Å²	168	138.7 Å²	138.7	63%	0.634	72%	0.721	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122.8	-38.3	179.5	-63.7	-172.4	-177.9	95	2.2	113.7	S67 P68 V69	S67-R71 PolarHBondContact O-NH1 3.04Å; P68-R71 PolarHBondContact O-N 3.04Å; V69-R71 PolarHBondContact O-N 2.98Å
72	V	97.7	Very high	94.5	Very high	98 Å²	98	142.3 Å²	142.3	59%	0.594	72%	0.721	S	S	*	*			trans	-111.8	128.6	-175.6	-179.6	0	0	0	0	109.5	P68 P74	P68-V72 HydrophobicContact CB-CB 3.99Å; P68-V72 HydrophobicContact CB-CG2 3.95Å; P68-V72 PolarHBondContact O-N 3.39Å; V72-P74 WeakPolarHBondContact O-CD 3.45Å
73	T	97.5	Very high	94.3	Very high	129 Å²	129	146.6 Å²	146.6	79%	0.791	74%	0.743	S	S	*	*			trans	-79.6	119.6	170.5	-56.3	0	0	0	0	109.1	K75	T73-K75 PolarHBondContact O-N 3.08Å
74	P	96.6	Very high	94	Very high	122 Å²	122	145 Å²	145	79%	0.792	74%	0.739	S	S	*	*			trans	-58.8	138.8	176.7	-23.8	34.8	0	0	0	111.4	V72	V72-P74 WeakPolarHBondContact O-CD 3.45Å
75	K	95	Very high	93.8	Very high	187 Å²	187	144.8 Å²	144.8	81%	0.813	75%	0.75	S	S	*	*			trans	-117.6	132.3	175.6	-175.2	179.8	176.4	-178	0	109	T73 W77	T73-K75 PolarHBondContact O-N 3.08Å; K75-W77 PolarHBondContact O-N 3.4Å
76	E	96.1	Very high	93.5	Very high	166 Å²	166	145.1 Å²	145.1	78%	0.776	75%	0.75	S	S	*	*			trans	-57.7	126.1	170.8	-69.1	-56.8	147.8	0	0	109.6
77	W	94.5	Very high	93.3	Very high	225 Å²	225	147.3 Å²	147.3	85%	0.852	76%	0.761	S	S	*	*			trans	-106.3	-13.5	-171.4	63.6	-90	0	0	0	113	K75	K75-W77 PolarHBondContact O-N 3.4Å
78	R	92.4	Very high	93	Very high	196 Å²	196	153.6 Å²	153.6	74%	0.74	78%	0.784	S	S	*	*			trans	-106.7	123.1	177.7	-171.7	174.7	-178.8	-178	1.3	109.8
79	N	78.3	Confident	92.6	Very high	151 Å²	151	159.9 Å²	159.9	81%	0.807	81%	0.808	S	S	*	*			trans	-74.4	137.5	167.1	-62.6	-27.9	0	0	0	108.7
80	Q	69.8	Low	92.1	Very high	269 Å²	269	163.5 Å²	163.5	100%	1.257	82%	0.815	S	S	*	*			trans	-64.4	0	174.2	-73.3	-175.4	-6.7	0	0	111.3

Retrieved 80 of 80 residues in 29.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).