A0A096NCU3_PAPAN Loading...

Small vasohibin-binding protein

AlphaFold DB (A0A2K5WZP4), UniProt , Accession A0A096NCU3, Species PAPAN (Papio anubis, Olive baboon), Gene SVBP, Length 66 aa.

						>A0A096NCU3_PAPAN|A0A096NCU3|SVBP
MDPPARKEKTKVKEPVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66	Low	54.1	Low	242 Å²	242	167.5 Å²	167.5	100%	1.192	85%	0.852	S	S	*	*				0	103.1	0	-90.4	-65.3	-167.3	0	0	107.9
2	D	46.2	Very low	54.2	Low	155 Å²	155	164 Å²	164	83%	0.829	85%	0.845	S	S	*	*			trans	170.9	153.1	147.6	-123.5	-60.3	0	0	0	107.6
3	P	54.8	Low	54.3	Low	108 Å²	108	163 Å²	163	70%	0.701	83%	0.831	S	S	*	*				-114.9	-179.7	-81	41.6	-30.4	0	0	0	112.8
4	P	55.1	Low	54.2	Low	118 Å²	118	163.8 Å²	163.8	77%	0.766	83%	0.829	S	S	*	*			trans	-83.8	125	-164.3	32.4	-28.6	0	0	0	112.7	R6	P4-R6 VanDerWaalsContact C-N 3.31Å; P4-R6 PolarHBondContact O-N 2.74Å
5	A	49	Very low	54.6	Low	105 Å²	105	159.3 Å²	159.3	87%	0.868	82%	0.816	S	S	*	*			trans	-74.2	81.7	172	0	0	0	0	0	111	K7	A5-K7 PolarHBondContact O-N 3.04Å
6	R	61.8	Low	54.9	Low	230 Å²	230	153.7 Å²	153.7	87%	0.868	79%	0.791	S	S	*	*			trans	-66.5	114.7	156.1	-93.8	-178.4	172.2	-178.1	-0.3	108.6	P4	P4-R6 VanDerWaalsContact C-N 3.31Å; P4-R6 PolarHBondContact O-N 2.74Å
7	K	52.8	Low	55.5	Low	199 Å²	199	147.5 Å²	147.5	87%	0.865	76%	0.764	S	S	*	*			trans	173.6	124.7	159.7	-98	163.4	-155.8	-170.6	0	105.3	A5	A5-K7 PolarHBondContact O-N 3.04Å
8	E	44.4	Very low	56.3	Low	177 Å²	177	150.7 Å²	150.7	83%	0.827	77%	0.765	S	S	*	*			cis	-145.1	143.1	29.7	-80	166.1	119	0	0	110.9	T10	E8-T10 PolarHBondContact O-N 3.3Å; E8-T10 VanDerWaalsContact O-N 3.13Å
9	K	52.8	Low	57.1	Low	191 Å²	191	147.2 Å²	147.2	83%	0.83	75%	0.752	S	S	*	*			trans	-66.8	107.7	164	-60.5	170.2	-176.9	178.5	0	106.2	K11	K9-K11 PolarHBondContact O-N 3.25Å
10	T	50.6	Low	58	Low	141 Å²	141	146 Å²	146	87%	0.865	74%	0.743	S	S	*	*			trans	-67.3	74.3	164.3	-43.4	0	0	0	0	108.4	E8	E8-T10 PolarHBondContact O-N 3.3Å; E8-T10 VanDerWaalsContact O-N 3.13Å
11	K	61.7	Low	58.9	Low	176 Å²	176	145 Å²	145	77%	0.765	73%	0.733	S	S	*	*			trans	-69.8	148.1	152.1	-83.5	-176.6	170.3	-172.4	0	106.3	K9	K9-K11 PolarHBondContact O-N 3.25Å
12	V	54.4	Low	59.4	Low	126 Å²	126	136.3 Å²	136.3	76%	0.764	70%	0.7	S	S	*	*	S	Bend	trans	97.4	82.8	173.8	-165.5	0	0	0	0	114.7
13	K	56.1	Low	61.2	Low	151 Å²	151	135.7 Å²	135.7	66%	0.657	69%	0.69	S	S	*	*			trans	166.1	20.6	132.4	-88.9	178.6	-172	-176.9	0	115.7	P15 V16 S17	K13-P15 VanDerWaalsContact C-CD 3.43Å; K13-V16 HydrophobicContact CG-CG2 4.36Å; K13-V16 PolarHBondContact O-N 3.22Å; K13-S17 PolarHBondContact O-N 3.13Å; K13-S17 VanDerWaalsContact O-N 3.16Å
14	E	53.2	Low	62.6	Low	174 Å²	174	137.2 Å²	137.2	81%	0.813	69%	0.688	S	S	*	*	H	α-helix	trans	-49	-43.3	174	-84.6	-169.1	117.4	0	0	116.4	V16 S17 R18	E14-V16 VanDerWaalsContact C-N 3.35Å; E14-V16 PolarHBondContact O-N 3.23Å; E14-S17 PolarHBondContact O-N 3.41Å; E14-R18 PolarHBondContact O-N 3.42Å; E14-R18 VanDerWaalsContact O-N 3.1Å
15	P	59.3	Low	64.2	Low	96 Å²	96	138.7 Å²	138.7	62%	0.623	68%	0.682	S	S	*	*	H	α-helix	trans	-68.9	-33.5	-177.9	23.4	-31.3	0	0	0	112.7	K13 R18 V19	K13-P15 VanDerWaalsContact C-CD 3.43Å; P15-R18 PolarHBondContact O-N 3.16Å; P15-V19 WeakPolarHBondContact O-CG2 3.42Å; P15-V19 PolarHBondContact O-N 3.44Å
16	V	60.7	Low	66.2	Low	70 Å²	70	136.8 Å²	136.8	42%	0.424	66%	0.662	S	S	.	*	H	α-helix	trans	-68.6	-44.6	177.5	-179	0	0	0	0	110.1	K13 E14 R18 V19 E20	K13-V16 HydrophobicContact CG-CG2 4.36Å; K13-V16 PolarHBondContact O-N 3.22Å; E14-V16 VanDerWaalsContact C-N 3.35Å; E14-V16 PolarHBondContact O-N 3.23Å; V16-R18 VanDerWaalsContact C-N 3.27Å; V16-R18 PolarHBondContact O-N 3.41Å; V16-V19 PolarHBondContact O-N 3.1Å; V16-E20 WeakPolarHBondContact O-CG 3.42Å; V16-E20 PolarHBondContact O-N 2.9Å
17	S	65.1	Low	67.6	Low	48 Å²	48	128.5 Å²	128.5	34%	0.336	64%	0.643	S	S	.	*	H	α-helix	trans	-61.4	-33.6	176.3	-176.4	0	0	0	0	112.8	K13 E14 K21	K13-S17 PolarHBondContact O-N 3.13Å; K13-S17 VanDerWaalsContact O-N 3.16Å; E14-S17 PolarHBondContact O-N 3.41Å; S17-K21 WeakPolarHBondContact O-CB 3.44Å; S17-K21 VanDerWaalsContact O-CG 3.31Å; S17-K21 WeakPolarHBondContact O-CG 3.47Å; S17-K21 PolarHBondContact O-N 2.87Å; S17-K21 VanDerWaalsContact O-N 3.09Å
18	R	69.8	Low	69.6	Low	206 Å²	206	125.8 Å²	125.8	78%	0.777	63%	0.633	S	S	*	*	H	α-helix	trans	-70.9	-40.3	177.6	-166.3	174.8	-178.5	173.6	-0	112.4	E14 P15 V16 A22	E14-R18 PolarHBondContact O-N 3.42Å; E14-R18 VanDerWaalsContact O-N 3.1Å; P15-R18 PolarHBondContact O-N 3.16Å; V16-R18 VanDerWaalsContact C-N 3.27Å; V16-R18 PolarHBondContact O-N 3.41Å; R18-A22 PolarHBondContact O-N 3.02Å
19	V	71	Confident	72.1	Confident	84 Å²	84	123 Å²	123	51%	0.509	62%	0.621	S	S	.	*	H	α-helix	trans	-67.8	-40.2	177	174.4	0	0	0	0	111.1	P15 V16 A22 K23	P15-V19 WeakPolarHBondContact O-CG2 3.42Å; P15-V19 PolarHBondContact O-N 3.44Å; V16-V19 PolarHBondContact O-N 3.1Å; V19-A22 PolarHBondContact O-N 3.43Å; V19-K23 WeakPolarHBondContact O-CG 3.46Å; V19-K23 PolarHBondContact O-N 3.32Å
20	E	74.7	Confident	74.2	Confident	123 Å²	123	120.5 Å²	120.5	58%	0.575	61%	0.611	S	S	*	*	H	α-helix	trans	-64.4	-43.8	176.1	-71.4	178.1	149.2	0	0	112.1	V16 A22 K23 Q24	V16-E20 WeakPolarHBondContact O-CG 3.42Å; V16-E20 PolarHBondContact O-N 2.9Å; E20-A22 VanDerWaalsContact C-N 3.28Å; E20-A22 PolarHBondContact O-N 2.91Å; E20-K23 PolarHBondContact O-N 2.97Å; E20-Q24 PolarHBondContact O-N 3.07Å
21	K	77.1	Confident	76.4	Confident	125 Å²	125	118.2 Å²	118.2	54%	0.543	59%	0.594	S	S	.	*	H	α-helix	trans	-61.5	-35.6	173.4	-75.5	174.3	-179	174	0	112.6	S17 K25	S17-K21 WeakPolarHBondContact O-CB 3.44Å; S17-K21 VanDerWaalsContact O-CG 3.31Å; S17-K21 WeakPolarHBondContact O-CG 3.47Å; S17-K21 PolarHBondContact O-N 2.87Å; S17-K21 VanDerWaalsContact O-N 3.09Å; K21-K25 VanDerWaalsContact O-CG 3.3Å; K21-K25 WeakPolarHBondContact O-CG 3.33Å; K21-K25 PolarHBondContact O-N 3.09Å; K21-K25 VanDerWaalsContact O-N 3.08Å
22	A	77.6	Confident	78.1	Confident	59 Å²	59	117 Å²	117	49%	0.488	59%	0.589	S	S	.	*	H	α-helix	trans	-67.5	-43.4	175.9	0	0	0	0	0	111.7	R18 V19 E20 K25 S26	R18-A22 PolarHBondContact O-N 3.02Å; V19-A22 PolarHBondContact O-N 3.43Å; E20-A22 VanDerWaalsContact C-N 3.28Å; E20-A22 PolarHBondContact O-N 2.91Å; A22-K25 PolarHBondContact O-N 3.25Å; A22-S26 PolarHBondContact O-N 2.99Å
23	K	82.8	Confident	80.2	Confident	142 Å²	142	116.7 Å²	116.7	62%	0.617	58%	0.578	S	S	*	*	H	α-helix	trans	-64.1	-38.6	175.3	-72.1	-178.2	177.7	-173.5	0	112.8	V19 E20 S26 A27	V19-K23 WeakPolarHBondContact O-CG 3.46Å; V19-K23 PolarHBondContact O-N 3.32Å; E20-K23 PolarHBondContact O-N 2.97Å; K23-S26 WeakPolarHBondContact CA-OG 3.44Å; K23-S26 PolarHBondContact O-N 3.37Å; K23-S26 PolarHBondContact O-OG 3Å; K23-A27 WeakPolarHBondContact O-CB 3.45Å; K23-A27 PolarHBondContact O-N 3.25Å
24	Q	84.3	Confident	82.2	Confident	141 Å²	141	117.5 Å²	117.5	66%	0.659	58%	0.577	S	S	*	*	H	α-helix	trans	-65.5	-41.5	175.8	-170	178.8	10.1	0	0	111.5	E20 A27 Q28	E20-Q24 PolarHBondContact O-N 3.07Å; Q24-A27 PolarHBondContact O-N 3.01Å; Q24-Q28 WeakPolarHBondContact O-CB 3.47Å; Q24-Q28 PolarHBondContact O-N 3.19Å
25	K	89.7	Confident	84.4	Confident	148 Å²	148	113.9 Å²	113.9	64%	0.643	56%	0.561	S	S	*	*	H	α-helix	trans	-64.3	-41.4	175.5	-75.4	178.8	179.9	-169.5	0	112.3	K21 A22 Q28 Q29	K21-K25 VanDerWaalsContact O-CG 3.3Å; K21-K25 WeakPolarHBondContact O-CG 3.33Å; K21-K25 PolarHBondContact O-N 3.09Å; K21-K25 VanDerWaalsContact O-N 3.08Å; A22-K25 PolarHBondContact O-N 3.25Å; K25-Q28 PolarHBondContact O-N 3.38Å; K25-Q29 WeakPolarHBondContact O-CB 3.31Å; K25-Q29 PolarHBondContact O-N 2.88Å
26	S	89.6	Confident	86.2	Confident	65 Å²	65	116.3 Å²	116.3	46%	0.455	56%	0.557	S	S	.	*	H	α-helix	trans	-64.9	-44.4	177.2	63	0	0	0	0	111.6	A22 K23 Q28 Q29 E30	A22-S26 PolarHBondContact O-N 2.99Å; K23-S26 WeakPolarHBondContact CA-OG 3.44Å; K23-S26 PolarHBondContact O-N 3.37Å; K23-S26 PolarHBondContact O-OG 3Å; S26-Q28 VanDerWaalsContact C-N 3.3Å; S26-Q28 PolarHBondContact O-N 2.88Å; S26-Q29 PolarHBondContact O-N 3.16Å; S26-Q29 VanDerWaalsContact O-N 3.16Å; S26-E30 WeakPolarHBondContact O-CB 3.41Å; S26-E30 PolarHBondContact O-N 2.93Å
27	A	90.7	Very high	88	Confident	56 Å²	56	116 Å²	116	46%	0.463	56%	0.562	S	S	.	*	H	α-helix	trans	-59.8	-40.5	176.1	0	0	0	0	0	112	K23 Q24 L31	K23-A27 WeakPolarHBondContact O-CB 3.45Å; K23-A27 PolarHBondContact O-N 3.25Å; Q24-A27 PolarHBondContact O-N 3.01Å; A27-L31 WeakPolarHBondContact O-CB 3.4Å; A27-L31 PolarHBondContact O-N 3.48Å
28	Q	95.4	Very high	89.6	Confident	142 Å²	142	118.6 Å²	118.6	66%	0.664	57%	0.569	S	S	*	*	H	α-helix	trans	-67.9	-37.7	176.3	-166.5	176.7	29.6	0	0	112.4	Q24 K25 S26 K32	Q24-Q28 WeakPolarHBondContact O-CB 3.47Å; Q24-Q28 PolarHBondContact O-N 3.19Å; K25-Q28 PolarHBondContact O-N 3.38Å; S26-Q28 VanDerWaalsContact C-N 3.3Å; S26-Q28 PolarHBondContact O-N 2.88Å; Q28-K32 WeakPolarHBondContact O-CB 3.44Å; Q28-K32 PolarHBondContact O-N 3.33Å
29	Q	96.9	Very high	91	Very high	120 Å²	120	113.3 Å²	113.3	56%	0.561	56%	0.555	S	S	*	*	H	α-helix	trans	-68.4	-41.9	177.4	-174.9	174.5	-4.1	0	0	111.7	K25 S26 K32 Q33	K25-Q29 WeakPolarHBondContact O-CB 3.31Å; K25-Q29 PolarHBondContact O-N 2.88Å; S26-Q29 PolarHBondContact O-N 3.16Å; S26-Q29 VanDerWaalsContact O-N 3.16Å; Q29-K32 PolarHBondContact O-N 2.9Å; Q29-Q33 WeakPolarHBondContact O-CG 3.5Å; Q29-Q33 PolarHBondContact O-N 2.91Å
30	E	96.5	Very high	92.3	Very high	137 Å²	137	115.4 Å²	115.4	64%	0.64	55%	0.554	S	S	*	*	H	α-helix	trans	-62.4	-47	175.6	-173.2	179.4	172.2	0	0	111	S26 K32 Q33 R34	S26-E30 WeakPolarHBondContact O-CB 3.41Å; S26-E30 PolarHBondContact O-N 2.93Å; E30-K32 VanDerWaalsContact C-N 3.32Å; E30-K32 PolarHBondContact O-N 3.37Å; E30-Q33 PolarHBondContact O-N 3.38Å; E30-R34 WeakPolarHBondContact O-CB 3.3Å; E30-R34 PolarHBondContact O-N 3.03Å
31	L	97.1	Very high	93.5	Very high	94 Å²	94	112.4 Å²	112.4	49%	0.492	55%	0.551	S	S	.	*	H	α-helix	trans	-57.9	-45.2	174.9	-180	61.5	0	0	0	111.6	A27 Q33 R34 Q35	A27-L31 WeakPolarHBondContact O-CB 3.4Å; A27-L31 PolarHBondContact O-N 3.48Å; L31-Q33 PolarHBondContact O-N 3.08Å; L31-R34 PolarHBondContact O-N 2.87Å; L31-Q35 HydrophobicContact CD1-CG 4.23Å; L31-Q35 HydrophobicContact CG-CG 4.47Å; L31-Q35 WeakPolarHBondContact O-CB 3.48Å; L31-Q35 VanDerWaalsContact O-CG 3.32Å; L31-Q35 WeakPolarHBondContact O-CG 3.3Å; L31-Q35 PolarHBondContact O-N 3.3Å
32	K	98.3	Very high	94.5	Very high	151 Å²	151	111.3 Å²	111.3	66%	0.657	55%	0.55	S	S	*	*	H	α-helix	trans	-62.1	-41.7	177.6	-176.4	-179.9	179.5	-179.6	0	112	Q28 Q29 E30 R36	Q28-K32 WeakPolarHBondContact O-CB 3.44Å; Q28-K32 PolarHBondContact O-N 3.33Å; Q29-K32 PolarHBondContact O-N 2.9Å; E30-K32 VanDerWaalsContact C-N 3.32Å; E30-K32 PolarHBondContact O-N 3.37Å; K32-R36 VanDerWaalsContact O-CB 3.3Å; K32-R36 WeakPolarHBondContact O-CB 3.35Å; K32-R36 PolarHBondContact O-N 3.09Å
33	Q	98.4	Very high	95.5	Very high	118 Å²	118	112.4 Å²	112.4	55%	0.551	55%	0.548	S	S	*	.	H	α-helix	trans	-65.9	-42.5	177.7	-75.1	177.5	1.7	0	0	111.4	Q29 E30 L31 R36 A37	Q29-Q33 WeakPolarHBondContact O-CG 3.5Å; Q29-Q33 PolarHBondContact O-N 2.91Å; E30-Q33 PolarHBondContact O-N 3.38Å; L31-Q33 PolarHBondContact O-N 3.08Å; Q33-R36 WeakPolarHBondContact O-CB 3.41Å; Q33-R36 PolarHBondContact O-N 3.5Å; Q33-A37 PolarHBondContact O-N 2.93Å
34	R	98.3	Very high	96.3	Very high	168 Å²	168	113.9 Å²	113.9	63%	0.634	55%	0.55	S	S	*	.	H	α-helix	trans	-62.4	-49.6	175.7	-177.9	176.4	176.2	159.6	3.8	111.9	E30 L31 R36 A37 E38	E30-R34 WeakPolarHBondContact O-CB 3.3Å; E30-R34 PolarHBondContact O-N 3.03Å; L31-R34 PolarHBondContact O-N 2.87Å; R34-R36 VanDerWaalsContact C-N 3.27Å; R34-R36 PolarHBondContact O-N 3.33Å; R34-A37 WeakPolarHBondContact O-CB 3.39Å; R34-A37 PolarHBondContact O-N 3.46Å; R34-A37 VanDerWaalsContact O-N 3.09Å; R34-E38 WeakPolarHBondContact CG-OE1 3.32Å; R34-E38 IonicContact CZ-OE1 3.94Å; R34-E38 IonicContact NE-OE1 3Å; R34-E38 PolarHBondContact NE-OE1 3.33Å; R34-E38 IonicContact NH2-OE1 2.84Å; R34-E38 WeakPolarHBondContact O-CG 3.49Å; R34-E38 PolarHBondContact O-N 3.33Å
35	Q	98.6	Very high	96.9	Very high	99 Å²	99	111.3 Å²	111.3	46%	0.463	54%	0.543	S	S	.	.	H	α-helix	trans	-57.8	-41.1	174.8	-74.3	176.8	-17.4	0	0	111.6	L31 A37 E38 I39	L31-Q35 HydrophobicContact CD1-CG 4.23Å; L31-Q35 HydrophobicContact CG-CG 4.47Å; L31-Q35 WeakPolarHBondContact O-CB 3.48Å; L31-Q35 VanDerWaalsContact O-CG 3.32Å; L31-Q35 WeakPolarHBondContact O-CG 3.3Å; L31-Q35 PolarHBondContact O-N 3.3Å; Q35-A37 PolarHBondContact O-N 2.92Å; Q35-E38 PolarHBondContact O-N 2.99Å; Q35-I39 VanDerWaalsContact O-CG1 3.26Å; Q35-I39 WeakPolarHBondContact O-CG1 3.43Å; Q35-I39 PolarHBondContact O-N 2.84Å
36	R	98.7	Very high	97.4	Very high	147 Å²	147	109 Å²	109	56%	0.555	54%	0.536	S	S	*	.	H	α-helix	trans	-61.9	-44.5	175.5	-174.1	176.4	-173.5	-87.6	-1.9	111.3	K32 Q33 R34 E38 I39 Y40	K32-R36 VanDerWaalsContact O-CB 3.3Å; K32-R36 WeakPolarHBondContact O-CB 3.35Å; K32-R36 PolarHBondContact O-N 3.09Å; Q33-R36 WeakPolarHBondContact O-CB 3.41Å; Q33-R36 PolarHBondContact O-N 3.5Å; R34-R36 VanDerWaalsContact C-N 3.27Å; R34-R36 PolarHBondContact O-N 3.33Å; R36-E38 VanDerWaalsContact C-N 3.34Å; R36-I39 PolarHBondContact O-N 3.38Å; R36-Y40 HydrophobicContact CG-CD2 3.88Å; R36-Y40 HydrophobicContact CG-CE2 3.64Å; R36-Y40 PolarHBondContact NH2-OH 3.48Å; R36-Y40 WeakPolarHBondContact O-CD2 3.45Å; R36-Y40 PolarHBondContact O-N 3.25Å
37	A	98.5	Very high	97.8	Very high	62 Å²	62	110.1 Å²	110.1	51%	0.512	54%	0.54	S	S	.	.	H	α-helix	trans	-61.7	-43.2	176.8	0	0	0	0	0	111.7	Q33 R34 Q35 I39 Y40 A41	Q33-A37 PolarHBondContact O-N 2.93Å; R34-A37 WeakPolarHBondContact O-CB 3.39Å; R34-A37 PolarHBondContact O-N 3.46Å; R34-A37 VanDerWaalsContact O-N 3.09Å; Q35-A37 PolarHBondContact O-N 2.92Å; A37-I39 PolarHBondContact O-N 2.91Å; A37-Y40 PolarHBondContact O-N 3.34Å; A37-A41 WeakPolarHBondContact O-CB 3.26Å; A37-A41 PolarHBondContact O-N 3.26Å
38	E	98.5	Very high	98.2	Very high	103 Å²	103	111.8 Å²	111.8	48%	0.481	54%	0.538	S	S	.	.	H	α-helix	trans	-62.1	-41.7	176	-70.4	171.8	-165.5	0	0	111.7	R34 Q35 R36 Y40 A41 L42	R34-E38 WeakPolarHBondContact CG-OE1 3.32Å; R34-E38 IonicContact CZ-OE1 3.94Å; R34-E38 IonicContact NE-OE1 3Å; R34-E38 PolarHBondContact NE-OE1 3.33Å; R34-E38 IonicContact NH2-OE1 2.84Å; R34-E38 WeakPolarHBondContact O-CG 3.49Å; R34-E38 PolarHBondContact O-N 3.33Å; Q35-E38 PolarHBondContact O-N 2.99Å; R36-E38 VanDerWaalsContact C-N 3.34Å; E38-Y40 PolarHBondContact O-N 2.92Å; E38-A41 PolarHBondContact O-N 3.05Å; E38-L42 WeakPolarHBondContact O-CB 3.19Å; E38-L42 PolarHBondContact O-N 3.34Å
39	I	98.8	Very high	98.3	Very high	95 Å²	95	108.5 Å²	108.5	49%	0.487	53%	0.525	S	S	.	.	H	α-helix	trans	-61.4	-43.6	174.5	-70	163.4	0	0	0	111.4	Q35 R36 A37 L42 N43	Q35-I39 VanDerWaalsContact O-CG1 3.26Å; Q35-I39 WeakPolarHBondContact O-CG1 3.43Å; Q35-I39 PolarHBondContact O-N 2.84Å; R36-I39 PolarHBondContact O-N 3.38Å; A37-I39 PolarHBondContact O-N 2.91Å; I39-L42 PolarHBondContact O-N 2.9Å; I39-N43 WeakPolarHBondContact O-CB 3.4Å; I39-N43 VanDerWaalsContact O-CG 3.3Å; I39-N43 PolarHBondContact O-N 3.41Å
40	Y	98.8	Very high	98.4	Very high	128 Å²	128	109.1 Å²	109.1	50%	0.502	53%	0.528	S	S	.	.	H	α-helix	trans	-69.2	-36.6	178.1	-81.7	-70.3	0	0	0	112.8	R36 A37 E38 L42 N43 R44	R36-Y40 HydrophobicContact CG-CD2 3.88Å; R36-Y40 HydrophobicContact CG-CE2 3.64Å; R36-Y40 PolarHBondContact NH2-OH 3.48Å; R36-Y40 WeakPolarHBondContact O-CD2 3.45Å; R36-Y40 PolarHBondContact O-N 3.25Å; A37-Y40 PolarHBondContact O-N 3.34Å; E38-Y40 PolarHBondContact O-N 2.92Å; Y40-L42 VanDerWaalsContact C-N 3.34Å; Y40-N43 PolarHBondContact O-N 3.02Å; Y40-R44 WeakPolarHBondContact O-CB 3.49Å; Y40-R44 PolarHBondContact O-N 3.46Å
41	A	98.6	Very high	98.5	Very high	60 Å²	60	107.2 Å²	107.2	50%	0.496	52%	0.519	S	S	.	.	H	α-helix	trans	-61.5	-45.2	173.3	0	0	0	0	0	110.7	A37 E38 R44 V45	A37-A41 WeakPolarHBondContact O-CB 3.26Å; A37-A41 PolarHBondContact O-N 3.26Å; E38-A41 PolarHBondContact O-N 3.05Å; A41-R44 PolarHBondContact O-N 2.84Å; A41-V45 PolarHBondContact O-N 3.49Å
42	L	98.7	Very high	98.5	Very high	103 Å²	103	108.1 Å²	108.1	54%	0.539	52%	0.521	S	S	.	.	H	α-helix	trans	-62.5	-48.9	175.5	179	62.1	0	0	0	111.8	E38 I39 Y40 R44 V45 M46	E38-L42 WeakPolarHBondContact O-CB 3.19Å; E38-L42 PolarHBondContact O-N 3.34Å; I39-L42 PolarHBondContact O-N 2.9Å; Y40-L42 VanDerWaalsContact C-N 3.34Å; L42-R44 PolarHBondContact O-N 3.49Å; L42-V45 PolarHBondContact O-N 2.91Å; L42-V45 VanDerWaalsContact O-N 3.09Å; L42-M46 HydrophobicContact CD1-CG 4.12Å; L42-M46 HydrophobicContact CG-CG 4.24Å; L42-M46 WeakPolarHBondContact O-CG 3.31Å; L42-M46 PolarHBondContact O-N 3.39Å
43	N	98.6	Very high	98.5	Very high	81 Å²	81	106.4 Å²	106.4	43%	0.433	52%	0.515	S	S	.	.	H	α-helix	trans	-57.1	-39.4	179.7	-79	-8	0	0	0	111.7	I39 Y40 M46 T47	I39-N43 WeakPolarHBondContact O-CB 3.4Å; I39-N43 VanDerWaalsContact O-CG 3.3Å; I39-N43 PolarHBondContact O-N 3.41Å; Y40-N43 PolarHBondContact O-N 3.02Å; N43-M46 PolarHBondContact O-N 2.93Å; N43-T47 WeakPolarHBondContact O-CB 3.34Å; N43-T47 PolarHBondContact O-N 2.88Å; N43-T47 PolarHBondContact O-OG1 3Å
44	R	98.6	Very high	98.5	Very high	174 Å²	174	106.3 Å²	106.3	66%	0.657	51%	0.513	S	S	*	.	H	α-helix	trans	-60.5	-48.9	176.1	-178.4	176.2	178	160.9	2.9	111.7	Y40 A41 L42 M46 T47 E48	Y40-R44 WeakPolarHBondContact O-CB 3.49Å; Y40-R44 PolarHBondContact O-N 3.46Å; A41-R44 PolarHBondContact O-N 2.84Å; L42-R44 PolarHBondContact O-N 3.49Å; R44-M46 VanDerWaalsContact C-N 3.31Å; R44-M46 PolarHBondContact O-N 3.32Å; R44-T47 PolarHBondContact O-N 3.44Å; R44-E48 VanDerWaalsContact CG-OE1 3.31Å; R44-E48 WeakPolarHBondContact CG-OE1 3.38Å; R44-E48 IonicContact CZ-OE1 3.99Å; R44-E48 IonicContact NE-OE1 3.62Å; R44-E48 PolarHBondContact NE-OE1 3.4Å; R44-E48 IonicContact NH2-OE1 3.69Å; R44-E48 WeakPolarHBondContact O-CB 3.34Å; R44-E48 WeakPolarHBondContact O-CG 3.47Å; R44-E48 PolarHBondContact O-N 2.89Å
45	V	98.6	Very high	98.4	Very high	87 Å²	87	101.7 Å²	101.7	53%	0.527	50%	0.501	S	S	.	.	H	α-helix	trans	-61.4	-42	177.8	174.6	0	0	0	0	110.9	A41 L42 E48 L49	A41-V45 PolarHBondContact O-N 3.49Å; L42-V45 PolarHBondContact O-N 2.91Å; L42-V45 VanDerWaalsContact O-N 3.09Å; V45-E48 PolarHBondContact O-N 3.09Å; V45-L49 WeakPolarHBondContact O-CB 3.48Å; V45-L49 PolarHBondContact O-N 3.25Å
46	M	98.6	Very high	98.3	Very high	99 Å²	99	102.5 Å²	102.5	49%	0.488	51%	0.505	S	S	.	.	H	α-helix	trans	-63.5	-43.2	177.9	-69.5	-57.2	-55.6	0	0	112.3	L42 N43 R44 L49 E50	L42-M46 HydrophobicContact CD1-CG 4.12Å; L42-M46 HydrophobicContact CG-CG 4.24Å; L42-M46 WeakPolarHBondContact O-CG 3.31Å; L42-M46 PolarHBondContact O-N 3.39Å; N43-M46 PolarHBondContact O-N 2.93Å; R44-M46 VanDerWaalsContact C-N 3.31Å; R44-M46 PolarHBondContact O-N 3.32Å; M46-L49 PolarHBondContact O-N 3.03Å; M46-E50 WeakPolarHBondContact O-CB 3.47Å; M46-E50 PolarHBondContact O-N 3.33Å
47	T	98.6	Very high	98.2	Very high	89 Å²	89	100.7 Å²	100.7	55%	0.546	50%	0.501	S	S	.	.	H	α-helix	trans	-65.4	-42.1	176.1	-60.8	0	0	0	0	111.8	N43 R44 L49 E50 Q51	N43-T47 WeakPolarHBondContact O-CB 3.34Å; N43-T47 PolarHBondContact O-N 2.88Å; N43-T47 PolarHBondContact O-OG1 3Å; R44-T47 PolarHBondContact O-N 3.44Å; T47-L49 VanDerWaalsContact C-N 3.33Å; T47-L49 PolarHBondContact O-N 2.97Å; T47-E50 PolarHBondContact O-N 3.34Å; T47-Q51 WeakPolarHBondContact O-CB 3.33Å; T47-Q51 PolarHBondContact O-N 3.27Å
48	E	98.4	Very high	98.1	Very high	90 Å²	90	100.4 Å²	100.4	42%	0.421	50%	0.495	S	S	.	.	H	α-helix	trans	-63.1	-40.8	176.6	-73	172.2	-169.3	0	0	111.2	R44 V45 Q51 Q52	R44-E48 VanDerWaalsContact CG-OE1 3.31Å; R44-E48 WeakPolarHBondContact CG-OE1 3.38Å; R44-E48 IonicContact CZ-OE1 3.99Å; R44-E48 IonicContact NE-OE1 3.62Å; R44-E48 PolarHBondContact NE-OE1 3.4Å; R44-E48 IonicContact NH2-OE1 3.69Å; R44-E48 WeakPolarHBondContact O-CB 3.34Å; R44-E48 WeakPolarHBondContact O-CG 3.47Å; R44-E48 PolarHBondContact O-N 2.89Å; V45-E48 PolarHBondContact O-N 3.09Å; E48-Q51 PolarHBondContact O-N 3.23Å; E48-Q52 WeakPolarHBondContact O-CG 3.36Å; E48-Q52 PolarHBondContact O-N 2.99Å
49	L	98.6	Very high	97.9	Very high	73 Å²	73	102.5 Å²	102.5	38%	0.382	50%	0.502	S	S	.	.	H	α-helix	trans	-63.9	-46.5	175.9	177.7	62.7	0	0	0	112.2	V45 M46 T47 Q51 Q52 Q53	V45-L49 WeakPolarHBondContact O-CB 3.48Å; V45-L49 PolarHBondContact O-N 3.25Å; M46-L49 PolarHBondContact O-N 3.03Å; T47-L49 VanDerWaalsContact C-N 3.33Å; T47-L49 PolarHBondContact O-N 2.97Å; L49-Q51 VanDerWaalsContact C-N 3.32Å; L49-Q51 PolarHBondContact O-N 3.47Å; L49-Q52 PolarHBondContact O-N 2.93Å; L49-Q53 WeakPolarHBondContact O-CG 3.46Å; L49-Q53 PolarHBondContact O-N 2.95Å
50	E	98.4	Very high	97.5	Very high	133 Å²	133	105.3 Å²	105.3	62%	0.621	51%	0.513	S	S	*	.	H	α-helix	trans	-61.8	-41.6	178.4	-174.9	175.3	-156.6	0	0	111.3	M46 T47 Q53 F54	M46-E50 WeakPolarHBondContact O-CB 3.47Å; M46-E50 PolarHBondContact O-N 3.33Å; T47-E50 PolarHBondContact O-N 3.34Å; E50-Q53 PolarHBondContact O-N 3.42Å; E50-F54 WeakPolarHBondContact O-CB 3.35Å; E50-F54 PolarHBondContact O-N 3.02Å
51	Q	98.4	Very high	97.1	Very high	97 Å²	97	105.3 Å²	105.3	45%	0.453	52%	0.519	S	S	.	.	H	α-helix	trans	-63.3	-42.8	175.9	-172.4	64.4	60.4	0	0	111.9	T47 E48 L49 Q53 F54 D55	T47-Q51 WeakPolarHBondContact O-CB 3.33Å; T47-Q51 PolarHBondContact O-N 3.27Å; E48-Q51 PolarHBondContact O-N 3.23Å; L49-Q51 VanDerWaalsContact C-N 3.32Å; L49-Q51 PolarHBondContact O-N 3.47Å; Q51-Q53 VanDerWaalsContact C-N 3.34Å; Q51-Q53 PolarHBondContact O-N 2.84Å; Q51-F54 PolarHBondContact O-N 3.46Å; Q51-D55 PolarHBondContact NE2-OD1 2.86Å; Q51-D55 WeakPolarHBondContact O-CB 3.47Å; Q51-D55 VanDerWaalsContact O-CG 3.25Å; Q51-D55 PolarHBondContact O-N 3.46Å
52	Q	98.3	Very high	96.4	Very high	114 Å²	114	109.4 Å²	109.4	53%	0.533	53%	0.528	S	S	.	.	H	α-helix	trans	-59.4	-46.2	176.2	-75.7	174.9	-4.6	0	0	111.6	E48 L49 F54 D55 E56	E48-Q52 WeakPolarHBondContact O-CG 3.36Å; E48-Q52 PolarHBondContact O-N 2.99Å; L49-Q52 PolarHBondContact O-N 2.93Å; Q52-F54 VanDerWaalsContact C-N 3.3Å; Q52-F54 PolarHBondContact O-N 3.34Å; Q52-D55 PolarHBondContact O-N 3.42Å; Q52-E56 WeakPolarHBondContact O-CB 3.48Å; Q52-E56 WeakPolarHBondContact O-CG 3.45Å; Q52-E56 PolarHBondContact O-N 3.02Å
53	Q	97.9	Very high	95.5	Very high	114 Å²	114	109.3 Å²	109.3	53%	0.533	53%	0.534	S	S	.	.	H	α-helix	trans	-60.9	-40.6	176.9	-70.5	175.7	-17.7	0	0	111.7	L49 E50 Q51 F57	L49-Q53 WeakPolarHBondContact O-CG 3.46Å; L49-Q53 PolarHBondContact O-N 2.95Å; E50-Q53 PolarHBondContact O-N 3.42Å; Q51-Q53 VanDerWaalsContact C-N 3.34Å; Q51-Q53 PolarHBondContact O-N 2.84Å; Q53-F57 WeakPolarHBondContact O-CB 3.4Å; Q53-F57 PolarHBondContact O-N 3.02Å
54	F	97.8	Very high	94.6	Very high	117 Å²	117	111.5 Å²	111.5	51%	0.513	55%	0.553	S	S	.	*	H	α-helix	trans	-66.8	-44.9	176.9	-176.6	-100.6	0	0	0	112.4	E50 Q51 Q52 E56 F57 C58	E50-F54 WeakPolarHBondContact O-CB 3.35Å; E50-F54 PolarHBondContact O-N 3.02Å; Q51-F54 PolarHBondContact O-N 3.46Å; Q52-F54 VanDerWaalsContact C-N 3.3Å; Q52-F54 PolarHBondContact O-N 3.34Å; F54-E56 VanDerWaalsContact C-N 3.33Å; F54-E56 PolarHBondContact O-N 3.18Å; F54-F57 WeakPolarHBondContact O-CB 3.32Å; F54-F57 PolarHBondContact O-N 2.8Å; F54-C58 WeakPolarHBondContact CE1-SG 3.38Å; F54-C58 VanDerWaalsContact CZ-SG 3.53Å; F54-C58 PolarHBondContact O-N 3.44Å
55	D	97.4	Very high	93.6	Very high	71 Å²	71	106.7 Å²	106.7	38%	0.38	56%	0.557	S	S	.	*	H	α-helix	trans	-63.5	-40.2	178.9	-70.9	-11.5	0	0	0	111.6	Q51 Q52 C58 K59	Q51-D55 PolarHBondContact NE2-OD1 2.86Å; Q51-D55 WeakPolarHBondContact O-CB 3.47Å; Q51-D55 VanDerWaalsContact O-CG 3.25Å; Q51-D55 PolarHBondContact O-N 3.46Å; Q52-D55 PolarHBondContact O-N 3.42Å; D55-C58 PolarHBondContact O-N 3.42Å; D55-K59 WeakPolarHBondContact O-CG 3.41Å; D55-K59 PolarHBondContact O-N 3Å
56	E	96.8	Very high	91.4	Very high	116 Å²	116	115.6 Å²	115.6	54%	0.542	59%	0.593	S	S	.	*	H	α-helix	trans	-61.7	-44	173	-75.7	178.4	-172.4	0	0	111.7	Q52 F54 K59 Q60	Q52-E56 WeakPolarHBondContact O-CB 3.48Å; Q52-E56 WeakPolarHBondContact O-CG 3.45Å; Q52-E56 PolarHBondContact O-N 3.02Å; F54-E56 VanDerWaalsContact C-N 3.33Å; F54-E56 PolarHBondContact O-N 3.18Å; E56-K59 PolarHBondContact O-N 3.49Å; E56-Q60 WeakPolarHBondContact O-CG 3.48Å; E56-Q60 PolarHBondContact O-N 3.11Å; E56-Q60 VanDerWaalsContact O-N 3.11Å
57	F	95.9	Very high	91	Very high	108 Å²	108	116.5 Å²	116.5	47%	0.474	60%	0.598	S	S	.	*	H	α-helix	trans	-60.4	-47.3	175.3	175.4	-99.6	0	0	0	111.7	Q53 F54 K59 Q60 M61	Q53-F57 WeakPolarHBondContact O-CB 3.4Å; Q53-F57 PolarHBondContact O-N 3.02Å; F54-F57 WeakPolarHBondContact O-CB 3.32Å; F54-F57 PolarHBondContact O-N 2.8Å; F57-K59 VanDerWaalsContact C-N 3.33Å; F57-K59 PolarHBondContact O-N 3.35Å; F57-Q60 PolarHBondContact O-N 3.23Å; F57-M61 HydrophobicContact CD1-CG 4.5Å; F57-M61 HydrophobicContact CD2-CG 4.49Å; F57-M61 HydrophobicContact CE1-CG 4.07Å; F57-M61 HydrophobicContact CE2-CG 4.07Å; F57-M61 HydrophobicContact CE2-SD 4.42Å; F57-M61 HydrophobicContact CZ-CE 4.03Å; F57-M61 HydrophobicContact CZ-CG 3.84Å; F57-M61 HydrophobicContact CZ-SD 4.33Å; F57-M61 WeakPolarHBondContact O-CG 3.37Å; F57-M61 PolarHBondContact O-N 3.46Å; F57-M61 VanDerWaalsContact O-N 3.16Å
58	C	95.6	Very high	90.6	Very high	56 Å²	56	117.9 Å²	117.9	38%	0.378	60%	0.601	S	S	.	*	H	α-helix	trans	-60.2	-41.2	177.4	-75.8	0	0	0	0	112.5	F54 D55 Q60 M61 Q62	F54-C58 WeakPolarHBondContact CE1-SG 3.38Å; F54-C58 VanDerWaalsContact CZ-SG 3.53Å; F54-C58 PolarHBondContact O-N 3.44Å; D55-C58 PolarHBondContact O-N 3.42Å; C58-Q60 VanDerWaalsContact C-N 3.33Å; C58-Q60 PolarHBondContact O-N 3.41Å; C58-M61 PolarHBondContact O-N 3.17Å; C58-Q62 PolarHBondContact O-N 3.16Å
59	K	93.9	Very high	90.2	Very high	148 Å²	148	119.4 Å²	119.4	64%	0.643	61%	0.611	S	S	*	*	H	α-helix	trans	-62.9	-37.9	176.8	-75.8	171	-176.1	171.3	0	112.6	D55 E56 F57 M61 Q62	D55-K59 WeakPolarHBondContact O-CG 3.41Å; D55-K59 PolarHBondContact O-N 3Å; E56-K59 PolarHBondContact O-N 3.49Å; F57-K59 VanDerWaalsContact C-N 3.33Å; F57-K59 PolarHBondContact O-N 3.35Å; K59-M61 VanDerWaalsContact C-N 3.29Å; K59-M61 PolarHBondContact O-N 3.39Å; K59-Q62 PolarHBondContact O-N 3.21Å
60	Q	92.2	Very high	89.7	Confident	153 Å²	153	122.2 Å²	122.2	72%	0.715	62%	0.624	S	S	*	*	H	α-helix	trans	-67.9	-32	176.9	-70.1	174.5	31.2	0	0	112.4	E56 F57 C58 Q62	E56-Q60 WeakPolarHBondContact O-CG 3.48Å; E56-Q60 PolarHBondContact O-N 3.11Å; E56-Q60 VanDerWaalsContact O-N 3.11Å; F57-Q60 PolarHBondContact O-N 3.23Å; C58-Q60 VanDerWaalsContact C-N 3.33Å; C58-Q60 PolarHBondContact O-N 3.41Å; Q60-Q62 VanDerWaalsContact C-N 3.33Å
61	M	88.6	Confident	89.1	Confident	128 Å²	128	121.5 Å²	121.5	63%	0.631	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.7	-4.9	-179.4	-63.8	-69.4	-91.8	0	0	113.2	F57 C58 K59 P63	F57-M61 HydrophobicContact CD1-CG 4.5Å; F57-M61 HydrophobicContact CD2-CG 4.49Å; F57-M61 HydrophobicContact CE1-CG 4.07Å; F57-M61 HydrophobicContact CE2-CG 4.07Å; F57-M61 HydrophobicContact CE2-SD 4.42Å; F57-M61 HydrophobicContact CZ-CE 4.03Å; F57-M61 HydrophobicContact CZ-CG 3.84Å; F57-M61 HydrophobicContact CZ-SD 4.33Å; F57-M61 WeakPolarHBondContact O-CG 3.37Å; F57-M61 PolarHBondContact O-N 3.46Å; F57-M61 VanDerWaalsContact O-N 3.16Å; C58-M61 PolarHBondContact O-N 3.17Å; K59-M61 VanDerWaalsContact C-N 3.29Å; K59-M61 PolarHBondContact O-N 3.39Å; M61-P63 WeakPolarHBondContact O-CD 3.35Å
62	Q	83.8	Confident	88.5	Confident	147 Å²	147	123.1 Å²	123.1	69%	0.687	64%	0.636	S	S	*	*	S	Bend	trans	-70.5	118	177.9	-169.6	171.7	-3.7	0	0	109.2	C58 K59 Q60	C58-Q62 PolarHBondContact O-N 3.16Å; K59-Q62 PolarHBondContact O-N 3.21Å; Q60-Q62 VanDerWaalsContact C-N 3.33Å
63	P	81.6	Confident	87.8	Confident	100 Å²	100	123.8 Å²	123.8	65%	0.649	64%	0.643	S	S	*	*	P	Polyproline II helix	trans	-63.1	146.2	177.9	25.8	-32.2	0	0	0	109.5	M61 G65	M61-P63 WeakPolarHBondContact O-CD 3.35Å; P63-G65 PolarHBondContact O-N 3.13Å; P63-G65 VanDerWaalsContact O-N 3.13Å
64	P	78.6	Confident	87	Confident	128 Å²	128	124.5 Å²	124.5	83%	0.831	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-56.4	123.6	170.6	23.4	-29.9	0	0	0	107.8
65	G	77.4	Confident	86.1	Confident	72 Å²	72	125.2 Å²	125.2	74%	0.742	66%	0.663	S	S	*	*	P	Polyproline II helix	trans	-57.6	142.3	178.7	0	0	0	0	0	110.5	P63	P63-G65 PolarHBondContact O-N 3.13Å; P63-G65 VanDerWaalsContact O-N 3.13Å
66	E	51.9	Low	85.1	Confident	275 Å²	275	130.1 Å²	130.1	100%	1.285	69%	0.689	S	S	*	*			trans	-51.6	0	173.6	-72.3	-176.7	143.2	0	0	112.9

Retrieved 66 of 66 residues in 15.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).