A0A096NEX9_PAPAN Loading...

cAMP-dependent protein kinase inhibitor

Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.

AlphaFold DB (P61926), UniProt , Accession A0A096NEX9, Species PAPAN (Papio anubis, Olive baboon), Gene PKIA, Length 76 aa.

						>A0A096NEX9_PAPAN|A0A096NEX9|PKIA
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	64	Low	74.4	Confident	243 Å²	243	120.4 Å²	120.4	100%	1.197	64%	0.636	S	S	*	*				0	104.6	0	-146.6	89.5	169.4	0	0	105.6
2	T	70.2	Confident	74.5	Confident	128 Å²	128	117.2 Å²	117.2	79%	0.785	62%	0.618	S	S	*	*			trans	-68.2	132.7	172.5	39.6	0	0	0	0	108.1	V4	T2-V4 PolarHBondContact O-N 2.78Å
3	D	78.7	Confident	74.5	Confident	85 Å²	85	114.6 Å²	114.6	46%	0.455	62%	0.624	S	S	.	*			trans	-64.2	124.7	178.9	-170.4	-11.9	0	0	0	109.7	E5 T6 T7	D3-E5 PolarHBondContact O-N 3.12Å; D3-E5 WeakPolarHBondContact OD1-CB 2.93Å; D3-E5 PolarHBondContact OD1-N 3.35Å; D3-T6 PolarHBondContact O-N 3.37Å; D3-T7 PolarHBondContact O-N 3Å; D3-T7 PolarHBondContact O-OG1 3.08Å
4	V	76.1	Confident	74.2	Confident	119 Å²	119	110.8 Å²	110.8	72%	0.721	61%	0.61	S	S	*	*	H	α-helix	trans	-60.7	-32.6	178	175.6	0	0	0	0	110	T2 T7 Y8	T2-V4 PolarHBondContact O-N 2.78Å; V4-T7 PolarHBondContact O-N 2.96Å; V4-Y8 PolarHBondContact O-N 3.42Å; V4-Y8 VanDerWaalsContact O-N 3.1Å
5	E	78	Confident	73.7	Confident	153 Å²	153	105.3 Å²	105.3	72%	0.715	59%	0.589	S	S	*	*	H	α-helix	trans	-70.2	-37.2	-178	-60.3	-178.3	170.5	0	0	111.7	D3 T7 Y8 A9	D3-E5 PolarHBondContact O-N 3.12Å; D3-E5 WeakPolarHBondContact OD1-CB 2.93Å; D3-E5 PolarHBondContact OD1-N 3.35Å; E5-T7 VanDerWaalsContact C-N 3.35Å; E5-Y8 PolarHBondContact O-N 3.41Å; E5-A9 PolarHBondContact O-N 3.04Å
6	T	72.9	Confident	73.2	Confident	78 Å²	78	106.8 Å²	106.8	48%	0.479	58%	0.583	S	S	.	*	H	α-helix	trans	-66.4	-40	174.7	-58	0	0	0	0	110.9	D3 Y8 A9 D10	D3-T6 PolarHBondContact O-N 3.37Å; T6-Y8 VanDerWaalsContact C-N 3.3Å; T6-Y8 PolarHBondContact O-N 2.73Å; T6-A9 PolarHBondContact O-N 3.02Å; T6-D10 PolarHBondContact O-N 3.28Å
7	T	73.2	Confident	72.4	Confident	80 Å²	80	103.9 Å²	103.9	49%	0.491	57%	0.57	S	S	.	*	H	α-helix	trans	-65.7	-34.2	179.4	-51.6	0	0	0	0	111.9	D3 V4 E5 F11	D3-T7 PolarHBondContact O-N 3Å; D3-T7 PolarHBondContact O-OG1 3.08Å; V4-T7 PolarHBondContact O-N 2.96Å; E5-T7 VanDerWaalsContact C-N 3.35Å; T7-F11 PolarHBondContact O-N 2.93Å; T7-F11 VanDerWaalsContact O-N 3.11Å
8	Y	75.9	Confident	71.7	Confident	161 Å²	161	100.9 Å²	100.9	63%	0.631	57%	0.566	S	S	*	*	H	α-helix	trans	-65.1	-44.2	175.7	-176.5	-100.1	0	0	0	111.7	V4 E5 T6 D10 F11 I12	V4-Y8 PolarHBondContact O-N 3.42Å; V4-Y8 VanDerWaalsContact O-N 3.1Å; E5-Y8 PolarHBondContact O-N 3.41Å; T6-Y8 VanDerWaalsContact C-N 3.3Å; T6-Y8 PolarHBondContact O-N 2.73Å; Y8-D10 VanDerWaalsContact C-N 3.32Å; Y8-D10 PolarHBondContact O-N 3.4Å; Y8-F11 PolarHBondContact O-N 3Å; Y8-I12 HydrophobicContact CD1-CG1 4.2Å; Y8-I12 HydrophobicContact CD2-CG1 4.47Å; Y8-I12 HydrophobicContact CE1-CD1 4.5Å; Y8-I12 HydrophobicContact CE1-CG1 3.8Å; Y8-I12 HydrophobicContact CE2-CD1 4.18Å; Y8-I12 HydrophobicContact CE2-CG1 4.11Å; Y8-I12 WeakPolarHBondContact O-CG1 3.04Å; Y8-I12 PolarHBondContact O-N 3.37Å; Y8-I12 VanDerWaalsContact O-N 3.11Å
9	A	80.9	Confident	71.3	Confident	54 Å²	54	108.6 Å²	108.6	45%	0.446	59%	0.586	S	S	.	*	H	α-helix	trans	-59.5	-44.2	178.1	0	0	0	0	0	111.6	E5 T6 I12 A13	E5-A9 PolarHBondContact O-N 3.04Å; T6-A9 PolarHBondContact O-N 3.02Å; A9-I12 PolarHBondContact O-N 3.1Å; A9-A13 WeakPolarHBondContact O-CB 3.04Å; A9-A13 PolarHBondContact O-N 2.95Å
10	D	76.2	Confident	71.2	Confident	105 Å²	105	115.5 Å²	115.5	56%	0.561	60%	0.602	S	S	*	*	H	α-helix	trans	-66	-40.2	179.1	-70.8	-20.3	0	0	0	112.7	T6 Y8 A13 S14	T6-D10 PolarHBondContact O-N 3.28Å; Y8-D10 VanDerWaalsContact C-N 3.32Å; Y8-D10 PolarHBondContact O-N 3.4Å; D10-A13 PolarHBondContact O-N 3.1Å; D10-S14 WeakPolarHBondContact O-CB 3.29Å; D10-S14 PolarHBondContact O-N 3.35Å
11	F	72	Confident	70.5	Confident	118 Å²	118	113.1 Å²	113.1	52%	0.518	59%	0.591	S	S	.	*	H	α-helix	trans	-63.9	-42.2	177.6	179.4	-100.1	0	0	0	112.3	T7 Y8 T17	T7-F11 PolarHBondContact O-N 2.93Å; T7-F11 VanDerWaalsContact O-N 3.11Å; Y8-F11 PolarHBondContact O-N 3Å; F11-T17 HydrophobicContact CD1-CG2 4.42Å; F11-T17 HydrophobicContact CE1-CG2 4.08Å
12	I	75.4	Confident	70.4	Confident	82 Å²	82	104.3 Å²	104.3	42%	0.421	56%	0.556	S	S	.	*	H	α-helix	trans	-71.3	-44.6	177.9	-61	-62.5	0	0	0	110.7	Y8 A9 S14 G15	Y8-I12 HydrophobicContact CD1-CG1 4.2Å; Y8-I12 HydrophobicContact CD2-CG1 4.47Å; Y8-I12 HydrophobicContact CE1-CD1 4.5Å; Y8-I12 HydrophobicContact CE1-CG1 3.8Å; Y8-I12 HydrophobicContact CE2-CD1 4.18Å; Y8-I12 HydrophobicContact CE2-CG1 4.11Å; Y8-I12 WeakPolarHBondContact O-CG1 3.04Å; Y8-I12 PolarHBondContact O-N 3.37Å; Y8-I12 VanDerWaalsContact O-N 3.11Å; A9-I12 PolarHBondContact O-N 3.1Å; I12-S14 VanDerWaalsContact C-N 3.31Å; I12-S14 PolarHBondContact O-N 3.37Å; I12-G15 PolarHBondContact O-N 3.41Å
13	A	74.6	Confident	70	Confident	84 Å²	84	104.2 Å²	104.2	69%	0.694	55%	0.55	S	S	*	.	H	α-helix	trans	-68.2	-29.8	179.2	0	0	0	0	0	112.9	A9 D10 G15	A9-A13 WeakPolarHBondContact O-CB 3.04Å; A9-A13 PolarHBondContact O-N 2.95Å; D10-A13 PolarHBondContact O-N 3.1Å; A13-G15 PolarHBondContact O-N 3.49Å
14	S	70.2	Confident	69.2	Low	61 Å²	61	107.3 Å²	107.3	43%	0.427	56%	0.561	S	S	.	*	T	Hydrogen-bonded Turn	trans	-57.1	-20.9	177.5	176.6	0	0	0	0	112	D10 I12 R16	D10-S14 WeakPolarHBondContact O-CB 3.29Å; D10-S14 PolarHBondContact O-N 3.35Å; I12-S14 VanDerWaalsContact C-N 3.31Å; I12-S14 PolarHBondContact O-N 3.37Å; S14-R16 WeakPolarHBondContact O-CG 3.48Å; S14-R16 PolarHBondContact O-N 3.5Å; S14-R16 WeakPolarHBondContact OG-CB 3.46Å; S14-R16 WeakPolarHBondContact OG-CD 3.46Å; S14-R16 VanDerWaalsContact OG-CG 3.22Å; S14-R16 WeakPolarHBondContact OG-CG 3.37Å
15	G	66.9	Low	68.5	Low	29 Å²	29	108.2 Å²	108.2	30%	0.299	56%	0.562	S	S	.	*	T	Hydrogen-bonded Turn	trans	55.4	26.6	-179.7	0	0	0	0	0	111.6	I12 A13 N21	I12-G15 PolarHBondContact O-N 3.41Å; A13-G15 PolarHBondContact O-N 3.49Å; G15-N21 WeakPolarHBondContact O-CA 3.41Å; G15-N21 WeakPolarHBondContact O-CB 3.42Å; G15-N21 PolarHBondContact O-ND2 3.26Å; G15-N21 PolarHBondContact O-OD1 2.92Å
16	R	65.5	Low	67.4	Low	128 Å²	128	106.6 Å²	106.6	48%	0.483	56%	0.557	S	S	.	*			trans	-104	-11.1	177.5	-71.1	178.9	102.3	157.3	8.3	113.2	S14 G18 N21 I23	S14-R16 WeakPolarHBondContact O-CG 3.48Å; S14-R16 PolarHBondContact O-N 3.5Å; S14-R16 WeakPolarHBondContact OG-CB 3.46Å; S14-R16 WeakPolarHBondContact OG-CD 3.46Å; S14-R16 VanDerWaalsContact OG-CG 3.22Å; S14-R16 WeakPolarHBondContact OG-CG 3.37Å; R16-G18 PolarHBondContact O-N 2.99Å; R16-N21 VanDerWaalsContact CA-O 3.32Å; R16-N21 WeakPolarHBondContact CA-O 3.32Å; R16-I23 PolarHBondContact NH2-O 2.76Å
17	T	59.6	Low	66.7	Low	59 Å²	59	110.2 Å²	110.2	36%	0.362	57%	0.573	S	S	.	*	S	Bend	trans	-71.9	117.3	173.2	163.9	0	0	0	0	110.1	F11 N21	F11-T17 HydrophobicContact CD1-CG2 4.42Å; F11-T17 HydrophobicContact CE1-CG2 4.08Å; T17-N21 WeakPolarHBondContact O-CB 3.46Å; T17-N21 PolarHBondContact O-ND2 3.45Å
18	G	60.6	Low	65.7	Low	49 Å²	49	113.8 Å²	113.8	51%	0.505	59%	0.594	S	S	.	*	S	Bend	trans	105.9	152.1	179.9	0	0	0	0	0	114.7	R16 R20 N21 A22	R16-G18 PolarHBondContact O-N 2.99Å; G18-R20 PolarHBondContact O-N 3.45Å; G18-N21 VanDerWaalsContact O-CB 3.32Å; G18-N21 WeakPolarHBondContact O-CB 3.49Å; G18-N21 PolarHBondContact O-N 3.39Å; G18-A22 PolarHBondContact O-N 3.28Å
19	R	64.5	Low	64.6	Low	248 Å²	248	111 Å²	111	94%	0.936	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.4	-25.3	-178	-179.1	174.3	161	165	-4.1	114.2	N21	R19-N21 VanDerWaalsContact C-N 3.28Å
20	R	69.3	Low	63.3	Low	245 Å²	245	112.5 Å²	112.5	93%	0.925	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.6	-2.1	-179.2	-64	-172.9	-65	161.8	0.6	114.2	G18	G18-R20 PolarHBondContact O-N 3.45Å
21	N	56.4	Low	62.4	Low	67 Å²	67	112.5 Å²	112.5	36%	0.358	62%	0.62	S	S	.	*	T	Hydrogen-bonded Turn	trans	-124.5	-10	-162.8	-93.9	5.9	0	0	0	111.7	G15 R16 T17 G18 R19 I23	G15-N21 WeakPolarHBondContact O-CA 3.41Å; G15-N21 WeakPolarHBondContact O-CB 3.42Å; G15-N21 PolarHBondContact O-ND2 3.26Å; G15-N21 PolarHBondContact O-OD1 2.92Å; R16-N21 VanDerWaalsContact CA-O 3.32Å; R16-N21 WeakPolarHBondContact CA-O 3.32Å; T17-N21 WeakPolarHBondContact O-CB 3.46Å; T17-N21 PolarHBondContact O-ND2 3.45Å; G18-N21 VanDerWaalsContact O-CB 3.32Å; G18-N21 WeakPolarHBondContact O-CB 3.49Å; G18-N21 PolarHBondContact O-N 3.39Å; R19-N21 VanDerWaalsContact C-N 3.28Å; N21-I23 PolarHBondContact O-N 3.4Å
22	A	61.7	Low	61.6	Low	57 Å²	57	111.7 Å²	111.7	47%	0.471	63%	0.629	S	S	.	*			trans	-66.2	94.3	168	0	0	0	0	0	109.9	G18 H24	G18-A22 PolarHBondContact O-N 3.28Å; A22-H24 PolarHBondContact O-N 3.22Å
23	I	61.1	Low	60.9	Low	126 Å²	126	110 Å²	110	65%	0.646	63%	0.632	S	S	*	*			trans	-59.3	110	159.3	-61.8	-179	0	0	0	105.6	R16 N21 D25	R16-I23 PolarHBondContact NH2-O 2.76Å; N21-I23 PolarHBondContact O-N 3.4Å; I23-D25 PolarHBondContact O-N 3.29Å
24	H	62	Low	60.3	Low	150 Å²	150	110.1 Å²	110.1	69%	0.694	62%	0.621	S	S	*	*			trans	-60.5	106.2	172.9	-76.8	-87.4	0	0	0	107.5	A22 I26	A22-H24 PolarHBondContact O-N 3.22Å; H24-I26 HydrophobicContact CB-CD1 4.32Å; H24-I26 HydrophobicContact CB-CG1 4.2Å; H24-I26 PolarHBondContact O-N 3.31Å
25	D	61.3	Low	60.4	Low	138 Å²	138	111.9 Å²	111.9	74%	0.738	63%	0.633	S	S	*	*			trans	-78.6	47.5	172.4	-159.8	10	0	0	0	109.8	I23	I23-D25 PolarHBondContact O-N 3.29Å
26	I	56.3	Low	61	Low	119 Å²	119	115.9 Å²	115.9	61%	0.61	65%	0.647	S	S	*	*			trans	-112.1	101.4	179.9	-48.6	176	0	0	0	104.5	H24 V28	H24-I26 HydrophobicContact CB-CD1 4.32Å; H24-I26 HydrophobicContact CB-CG1 4.2Å; H24-I26 PolarHBondContact O-N 3.31Å; I26-V28 PolarHBondContact O-N 3Å
27	L	56.3	Low	61.8	Low	154 Å²	154	114 Å²	114	81%	0.806	65%	0.645	S	S	*	*			trans	-38.8	125.7	166.9	-61.6	171.5	0	0	0	108.5	S29	L27-S29 PolarHBondContact O-N 3.37Å
28	V	52.7	Low	62.9	Low	156 Å²	156	117 Å²	117	95%	0.945	66%	0.658	S	S	*	*	S	Bend	trans	-37.9	85.7	-179.1	-179.5	0	0	0	0	111.2	I26	I26-V28 PolarHBondContact O-N 3Å
29	S	53.3	Low	64.2	Low	102 Å²	102	117.4 Å²	117.4	71%	0.713	66%	0.656	S	S	*	*			trans	-124.7	85.5	170.5	-174.6	0	0	0	0	104.8	L27	L27-S29 PolarHBondContact O-N 3.37Å
30	S	53.5	Low	65.4	Low	85 Å²	85	111.8 Å²	111.8	59%	0.594	64%	0.644	S	S	*	*			trans	64.6	50.7	156.4	-162	0	0	0	0	117.4	S32	S30-S32 PolarHBondContact O-N 2.87Å; S30-S32 VanDerWaalsContact O-N 3.08Å; S30-S32 PolarHBondContact OG-OG 2.65Å
31	A	57.1	Low	66.2	Low	106 Å²	106	106.5 Å²	106.5	88%	0.876	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.5	24.6	152.5	0	0	0	0	0	112.3	G33	A31-G33 PolarHBondContact O-N 3.09Å
32	S	55.2	Low	67.8	Low	100 Å²	100	108.9 Å²	108.9	70%	0.699	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.8	1.9	164.2	58.3	0	0	0	0	112.5	S30 N34	S30-S32 PolarHBondContact O-N 2.87Å; S30-S32 VanDerWaalsContact O-N 3.08Å; S30-S32 PolarHBondContact OG-OG 2.65Å; S32-N34 PolarHBondContact O-N 3.19Å; S32-N34 VanDerWaalsContact O-N 3.1Å
33	G	60	Low	69.2	Low	47 Å²	47	110.3 Å²	110.3	49%	0.485	65%	0.652	S	S	.	*	S	Bend	trans	-66.8	103	164.7	0	0	0	0	0	109.4	A31 S35	A31-G33 PolarHBondContact O-N 3.09Å; G33-S35 PolarHBondContact O-N 3.18Å
34	N	63.5	Low	70.5	Confident	86 Å²	86	106.2 Å²	106.2	46%	0.46	64%	0.64	S	S	.	*			trans	-45.1	130.4	176.3	58.4	81.2	0	0	0	110.9	S32 N36 E37	S32-N34 PolarHBondContact O-N 3.19Å; S32-N34 VanDerWaalsContact O-N 3.1Å; N34-N36 HydrophobicContact CB-CB 4.42Å; N34-N36 PolarHBondContact O-N 3.45Å; N34-N36 WeakPolarHBondContact OD1-CB 3.2Å; N34-E37 PolarHBondContact O-N 2.91Å; N34-E37 VanDerWaalsContact O-N 3.1Å; N34-E37 WeakPolarHBondContact OD1-CB 2.85Å; N34-E37 PolarHBondContact OD1-N 3.04Å
35	S	70.7	Confident	71.8	Confident	98 Å²	98	105.2 Å²	105.2	69%	0.685	64%	0.64	S	S	*	*	H	α-helix	trans	-53.4	-21.9	173.5	-175	0	0	0	0	112.5	G33 E37 L38 A39	G33-S35 PolarHBondContact O-N 3.18Å; S35-E37 PolarHBondContact O-N 3.43Å; S35-L38 PolarHBondContact O-N 2.98Å; S35-A39 PolarHBondContact O-N 3.36Å; S35-A39 VanDerWaalsContact O-N 3.09Å
36	N	80.5	Confident	73.1	Confident	113 Å²	113	102.3 Å²	102.3	60%	0.604	62%	0.624	S	S	*	*	H	α-helix	trans	-61.5	-40.3	177.2	-61.4	-52.7	0	0	0	113.1	N34 L38 A39 L40	N34-N36 HydrophobicContact CB-CB 4.42Å; N34-N36 PolarHBondContact O-N 3.45Å; N34-N36 WeakPolarHBondContact OD1-CB 3.2Å; N36-L38 VanDerWaalsContact C-N 3.3Å; N36-L38 PolarHBondContact O-N 3.32Å; N36-A39 WeakPolarHBondContact O-CB 3.32Å; N36-A39 PolarHBondContact O-N 2.88Å; N36-L40 VanDerWaalsContact O-CG 3.29Å; N36-L40 WeakPolarHBondContact O-CG 3.48Å; N36-L40 PolarHBondContact O-N 2.98Å
37	E	82.4	Confident	74.7	Confident	90 Å²	90	104.1 Å²	104.1	42%	0.421	63%	0.633	S	S	.	*	H	α-helix	trans	-61.9	-43.2	179.3	-177.2	-174.7	171	0	0	110.4	N34 S35 A39 L40 K41	N34-E37 PolarHBondContact O-N 2.91Å; N34-E37 VanDerWaalsContact O-N 3.1Å; N34-E37 WeakPolarHBondContact OD1-CB 2.85Å; N34-E37 PolarHBondContact OD1-N 3.04Å; S35-E37 PolarHBondContact O-N 3.43Å; E37-A39 VanDerWaalsContact C-N 3.34Å; E37-A39 PolarHBondContact O-N 2.88Å; E37-L40 PolarHBondContact O-N 3.5Å; E37-K41 WeakPolarHBondContact O-CG 3.47Å; E37-K41 PolarHBondContact O-N 2.99Å; E37-K41 WeakPolarHBondContact OE1-CE 3.37Å; E37-K41 IonicContact OE1-NZ 2.78Å; E37-K41 PolarHBondContact OE1-NZ 3.04Å
38	L	83.3	Confident	76.3	Confident	122 Å²	122	102.9 Å²	102.9	64%	0.639	63%	0.627	S	S	*	*	H	α-helix	trans	-62.7	-43.1	176.1	-179.1	60.4	0	0	0	111.3	S35 N36 L40 K41 L42	S35-L38 PolarHBondContact O-N 2.98Å; N36-L38 VanDerWaalsContact C-N 3.3Å; N36-L38 PolarHBondContact O-N 3.32Å; L38-L40 VanDerWaalsContact C-N 3.32Å; L38-L40 PolarHBondContact O-N 2.98Å; L38-K41 PolarHBondContact O-N 3.11Å; L38-L42 WeakPolarHBondContact O-CB 3.16Å; L38-L42 PolarHBondContact O-N 3.45Å
39	A	87.4	Confident	77.8	Confident	57 Å²	57	99.3 Å²	99.3	47%	0.471	60%	0.599	S	S	.	*	H	α-helix	trans	-60.6	-41	175.8	0	0	0	0	0	112	S35 N36 E37 L42 A43	S35-A39 PolarHBondContact O-N 3.36Å; S35-A39 VanDerWaalsContact O-N 3.09Å; N36-A39 WeakPolarHBondContact O-CB 3.32Å; N36-A39 PolarHBondContact O-N 2.88Å; E37-A39 VanDerWaalsContact C-N 3.34Å; E37-A39 PolarHBondContact O-N 2.88Å; A39-L42 PolarHBondContact O-N 3.5Å; A39-A43 WeakPolarHBondContact O-CB 3.22Å; A39-A43 PolarHBondContact O-N 3.44Å
40	L	89.5	Confident	79.1	Confident	129 Å²	129	99.3 Å²	99.3	68%	0.675	60%	0.595	S	S	*	*	H	α-helix	trans	-66.1	-45	177.1	-70.5	170.3	0	0	0	112.3	N36 E37 L38 L42 A43 G44	N36-L40 VanDerWaalsContact O-CG 3.29Å; N36-L40 WeakPolarHBondContact O-CG 3.48Å; N36-L40 PolarHBondContact O-N 2.98Å; E37-L40 PolarHBondContact O-N 3.5Å; L38-L40 VanDerWaalsContact C-N 3.32Å; L38-L40 PolarHBondContact O-N 2.98Å; L40-L42 VanDerWaalsContact C-N 3.31Å; L40-L42 PolarHBondContact O-N 2.85Å; L40-A43 PolarHBondContact O-N 3.33Å; L40-G44 PolarHBondContact O-N 3.3Å
41	K	86.8	Confident	80	Confident	134 Å²	134	104.9 Å²	104.9	58%	0.583	61%	0.612	S	S	*	*	H	α-helix	trans	-62.1	-40.1	176.3	-69.6	-172.6	-154.3	-75.4	0	111.4	E37 L38 G44 L45	E37-K41 WeakPolarHBondContact O-CG 3.47Å; E37-K41 PolarHBondContact O-N 2.99Å; E37-K41 WeakPolarHBondContact OE1-CE 3.37Å; E37-K41 IonicContact OE1-NZ 2.78Å; E37-K41 PolarHBondContact OE1-NZ 3.04Å; L38-K41 PolarHBondContact O-N 3.11Å; K41-G44 PolarHBondContact O-N 3.33Å; K41-L45 PolarHBondContact O-N 2.81Å
42	L	89.7	Confident	80.3	Confident	118 Å²	118	103.5 Å²	103.5	62%	0.618	61%	0.607	S	S	*	*	H	α-helix	trans	-66.6	-37.9	177.4	-176.8	59.7	0	0	0	112.3	L38 A39 L40 G44 L45	L38-L42 WeakPolarHBondContact O-CB 3.16Å; L38-L42 PolarHBondContact O-N 3.45Å; A39-L42 PolarHBondContact O-N 3.5Å; L40-L42 VanDerWaalsContact C-N 3.31Å; L40-L42 PolarHBondContact O-N 2.85Å; L42-G44 PolarHBondContact O-N 3.11Å; L42-L45 HydrophobicContact CD1-CD2 4.18Å; L42-L45 WeakPolarHBondContact O-CB 3.35Å; L42-L45 PolarHBondContact O-N 3.22Å
43	A	90.9	Very high	80.5	Confident	87 Å²	87	106.6 Å²	106.6	72%	0.719	61%	0.611	S	S	*	*	H	α-helix	trans	-65	-27.5	175.9	0	0	0	0	0	113.2	A39 L40	A39-A43 WeakPolarHBondContact O-CB 3.22Å; A39-A43 PolarHBondContact O-N 3.44Å; L40-A43 PolarHBondContact O-N 3.33Å
44	G	87.6	Confident	80.5	Confident	40 Å²	40	109.2 Å²	109.2	41%	0.412	61%	0.611	S	S	.	*	T	Hydrogen-bonded Turn	trans	-89.6	-0.3	178.1	0	0	0	0	0	115.4	L40 K41 L42 D46 K49	L40-G44 PolarHBondContact O-N 3.3Å; K41-G44 PolarHBondContact O-N 3.33Å; L42-G44 PolarHBondContact O-N 3.11Å; G44-D46 PolarHBondContact O-N 3.15Å; G44-K49 PolarHBondContact O-NZ 3.33Å
45	L	89.3	Confident	80.1	Confident	129 Å²	129	112.1 Å²	112.1	68%	0.675	63%	0.626	S	S	*	*			trans	-75.6	116.1	-179	-179.1	65.8	0	0	0	110.3	K41 L42	K41-L45 PolarHBondContact O-N 2.81Å; L42-L45 HydrophobicContact CD1-CD2 4.18Å; L42-L45 WeakPolarHBondContact O-CB 3.35Å; L42-L45 PolarHBondContact O-N 3.22Å
46	D	89	Confident	79.2	Confident	76 Å²	76	111.2 Å²	111.2	41%	0.406	63%	0.625	S	S	.	*			trans	-135.8	128.2	175.6	171.9	11.7	0	0	0	109.3	G44 N48 K49	G44-D46 PolarHBondContact O-N 3.15Å; D46-N48 PolarHBondContact O-N 3.27Å; D46-N48 PolarHBondContact OD1-N 3.1Å; D46-N48 PolarHBondContact OD1-ND2 3.39Å; D46-K49 HydrophobicContact CB-CD 3.71Å; D46-K49 HydrophobicContact CB-CG 3.82Å; D46-K49 WeakPolarHBondContact O-CB 3.14Å; D46-K49 PolarHBondContact O-N 3.39Å
47	I	89.1	Confident	77.9	Confident	158 Å²	158	113.5 Å²	113.5	81%	0.81	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.6	-13.9	-175.4	63.3	174.3	0	0	0	113.2
48	N	91.5	Very high	76.6	Confident	127 Å²	127	118.8 Å²	118.8	68%	0.679	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.5	-4.8	179.8	-52	-74.3	0	0	0	112	D46 T50	D46-N48 PolarHBondContact O-N 3.27Å; D46-N48 PolarHBondContact OD1-N 3.1Å; D46-N48 PolarHBondContact OD1-ND2 3.39Å; N48-T50 PolarHBondContact O-N 3.42Å
49	K	83.4	Confident	75	Confident	81 Å²	81	116.6 Å²	116.6	35%	0.352	64%	0.642	S	S	.	*			trans	-66.3	121.7	175.4	-76.4	172.5	167.5	-156.3	0	109.4	G44 D46 E51 E54	G44-K49 PolarHBondContact O-NZ 3.33Å; D46-K49 HydrophobicContact CB-CD 3.71Å; D46-K49 HydrophobicContact CB-CG 3.82Å; D46-K49 WeakPolarHBondContact O-CB 3.14Å; D46-K49 PolarHBondContact O-N 3.39Å; K49-E51 PolarHBondContact O-N 3.36Å; K49-E54 WeakPolarHBondContact CD-OE1 3.32Å; K49-E54 WeakPolarHBondContact CE-OE1 3.38Å; K49-E54 VanDerWaalsContact NZ-CD 3.27Å; K49-E54 IonicContact NZ-OE1 2.73Å; K49-E54 PolarHBondContact NZ-OE1 3.3Å; K49-E54 IonicContact NZ-OE2 3.04Å; K49-E54 PolarHBondContact NZ-OE2 3.31Å
50	T	81.4	Confident	73.1	Confident	103 Å²	103	118.1 Å²	118.1	63%	0.632	65%	0.65	S	S	*	*			trans	-73.1	113.7	165.7	47.8	0	0	0	0	107.6	N48 G52	N48-T50 PolarHBondContact O-N 3.42Å; T50-G52 PolarHBondContact O-N 2.95Å
51	E	70.8	Confident	71.1	Confident	202 Å²	202	117.5 Å²	117.5	94%	0.944	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.6	110.5	178.6	-61.2	-177.8	173.6	0	0	109.9	K49	K49-E51 PolarHBondContact O-N 3.36Å
52	G	64.2	Low	69.3	Low	76 Å²	76	118.8 Å²	118.8	78%	0.784	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	149.6	-12.6	173.4	0	0	0	0	0	119.1	T50	T50-G52 PolarHBondContact O-N 2.95Å
53	E	58.8	Low	67.4	Low	166 Å²	166	121.3 Å²	121.3	78%	0.776	67%	0.668	S	S	*	*	S	Bend	trans	-102.6	-12.5	-168	-75.2	-177.9	163.2	0	0	116.8
54	E	60.1	Low	65.4	Low	102 Å²	102	122 Å²	122	48%	0.477	67%	0.668	S	S	.	*	S	Bend	trans	-126.9	-5.9	-165.9	51.5	-176.1	161.8	0	0	116.8	K49	K49-E54 WeakPolarHBondContact CD-OE1 3.32Å; K49-E54 WeakPolarHBondContact CE-OE1 3.38Å; K49-E54 VanDerWaalsContact NZ-CD 3.27Å; K49-E54 IonicContact NZ-OE1 2.73Å; K49-E54 PolarHBondContact NZ-OE1 3.3Å; K49-E54 IonicContact NZ-OE2 3.04Å; K49-E54 PolarHBondContact NZ-OE2 3.31Å
55	D	56.3	Low	63.4	Low	147 Å²	147	123.5 Å²	123.5	79%	0.786	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.2	-12.2	179.4	-153.2	31.4	0	0	0	113.5
56	A	52.1	Low	61.5	Low	79 Å²	79	126 Å²	126	65%	0.653	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81	-16.3	-178.4	0	0	0	0	0	114.4
57	Q	51.3	Low	59.6	Low	161 Å²	161	127 Å²	127	75%	0.752	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.7	-15.2	-172.3	-63	-137.6	-87.3	0	0	114.7
58	R	55.3	Low	57.6	Low	200 Å²	200	128.9 Å²	128.9	76%	0.755	72%	0.716	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	-28.4	178.7	-62.6	-166.4	-164	170.4	7.7	113.6	S60	R58-S60 VanDerWaalsContact C-N 3.27Å; R58-S60 PolarHBondContact O-N 3.29Å
59	S	49.7	Very low	55.4	Low	76 Å²	76	126 Å²	126	53%	0.531	72%	0.716	S	S	.	*	H	α-helix	trans	-72.2	-19.4	178.5	76.5	0	0	0	0	113.8
60	S	47.6	Very low	53.9	Low	90 Å²	90	131.9 Å²	131.9	63%	0.629	75%	0.745	S	S	*	*	H	α-helix	trans	-86	-15.9	-178.1	-168.8	0	0	0	0	114.6	R58	R58-S60 VanDerWaalsContact C-N 3.27Å; R58-S60 PolarHBondContact O-N 3.29Å
61	T	48	Very low	52.5	Low	115 Å²	115	132 Å²	132	71%	0.706	76%	0.756	S	S	*	*	H	α-helix	trans	-91.9	-23.4	-174.1	-62.3	0	0	0	0	113
62	E	49.5	Very low	51.7	Low	161 Å²	161	126.4 Å²	126.4	75%	0.752	75%	0.745	S	S	*	*	H	α-helix	trans	-91.8	-20.6	-176.8	-66.5	-176.5	146.9	0	0	113.7
63	Q	50.5	Low	51	Low	171 Å²	171	131 Å²	131	80%	0.799	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89	-4.7	-177.5	-72.6	-168.5	-76.6	0	0	115.8
64	S	47.2	Very low	50.5	Low	103 Å²	103	129.2 Å²	129.2	72%	0.72	75%	0.749	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.6	-0.5	-175.3	-168.1	0	0	0	0	114.9
65	G	46.6	Very low	49.7	Very low	71 Å²	71	131.8 Å²	131.8	73%	0.732	76%	0.761	S	S	*	*	S	Bend	trans	-93.1	-14	-173	0	0	0	0	0	116.3
66	E	48.4	Very low	49.5	Very low	181 Å²	181	134.4 Å²	134.4	85%	0.846	79%	0.791	S	S	*	*	S	Bend	trans	-111.1	-5	-158.8	-51.6	-171.8	163.3	0	0	114.8
67	A	49.5	Very low	49.3	Very low	98 Å²	98	137.2 Å²	137.2	81%	0.81	80%	0.798	S	S	*	*	S	Bend	trans	-106.6	5.9	-171.1	0	0	0	0	0	115.8
68	Q	48.5	Very low	49.2	Very low	196 Å²	196	135.9 Å²	135.9	92%	0.916	80%	0.8	S	S	*	*	S	Bend	trans	-116.5	80.9	179.7	-72	-170.7	-42.3	0	0	111.1
69	G	44.6	Very low	48.9	Very low	66 Å²	66	132.4 Å²	132.4	68%	0.68	80%	0.803	S	S	*	*			trans	-164	-25.4	173.8	0	0	0	0	0	116.1	A71	G69-A71 VanDerWaalsContact C-N 3.29Å; G69-A71 PolarHBondContact O-N 3.32Å; G69-A71 VanDerWaalsContact O-N 3.12Å
70	E	52.2	Low	48.8	Very low	206 Å²	206	135.7 Å²	135.7	96%	0.963	82%	0.819	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.7	23.4	-166.7	-149.8	164.5	140.9	0	0	115.7
71	A	51	Low	48.9	Very low	105 Å²	105	138.6 Å²	138.6	87%	0.868	83%	0.83	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.3	9.7	-176.9	0	0	0	0	0	115.3	G69	G69-A71 VanDerWaalsContact C-N 3.29Å; G69-A71 PolarHBondContact O-N 3.32Å; G69-A71 VanDerWaalsContact O-N 3.12Å
72	A	55.4	Low	49	Very low	85 Å²	85	140.1 Å²	140.1	70%	0.702	84%	0.839	S	S	*	*	S	Bend	trans	-116	106.1	-177.2	0	0	0	0	0	112.4
73	K	48.9	Very low	48.9	Very low	173 Å²	173	138.6 Å²	138.6	75%	0.752	85%	0.845	S	S	*	*			trans	67.7	109.8	165.7	-69.9	172.8	163.7	-173.4	0	115.1
74	S	48.4	Very low	48.8	Very low	128 Å²	128	136.2 Å²	136.2	90%	0.895	85%	0.848	S	S	*	*			cis	42.8	52	31	-60.9	0	0	0	0	113.8
75	E	42.3	Very low	49	Very low	155 Å²	155	138.9 Å²	138.9	72%	0.724	86%	0.859	S	S	*	*			trans	-168.1	85.1	158.2	-135.7	176.5	119.4	0	0	112.2
76	S	51.7	Low	49.2	Very low	203 Å²	203	145.1 Å²	145.1	100%	1.42	87%	0.871	S	S	*	*			trans	170.9	0	146.1	-84.9	0	0	0	0	111

Retrieved 76 of 76 residues in 88.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).