A0A096NFZ5_PAPAN Loading...

Heat shock factor-binding protein 1

Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

AlphaFold DB (Q5RDI2), UniProt , Accession A0A096NFZ5, Species PAPAN (Papio anubis, Olive baboon), Gene n/a, Length 76 aa.

						>A0A096NFZ5_PAPAN|A0A096NFZ5
MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELEGENKIPATQKS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.1	Low	80	Confident	230 Å²	230	119.5 Å²	119.5	100%	1.133	65%	0.654	S	S	*	*				0	126.1	0	-63.2	170.4	78.6	0	0	105	E3	M1-E3 PolarHBondContact O-N 2.91Å
2	A	62.5	Low	81.2	Confident	102 Å²	102	118.6 Å²	118.6	84%	0.843	65%	0.647	S	S	*	*			trans	-64.3	103.8	177.3	0	0	0	0	0	106.8	T4	A2-T4 VanDerWaalsContact C-N 3.34Å; A2-T4 PolarHBondContact O-N 2.95Å
3	E	64.5	Low	82.3	Confident	189 Å²	189	114.5 Å²	114.5	88%	0.883	63%	0.628	S	S	*	*			trans	-62.8	102.5	171.4	-68.9	179.8	157.8	0	0	105.8	M1 D5	M1-E3 PolarHBondContact O-N 2.91Å; E3-D5 PolarHBondContact O-N 3.08Å; E3-D5 VanDerWaalsContact O-N 3.08Å
4	T	75.4	Confident	83.3	Confident	107 Å²	107	110.9 Å²	110.9	66%	0.656	62%	0.615	S	S	*	*			trans	-61.1	114.3	168.7	41.4	0	0	0	0	106.9	A2	A2-T4 VanDerWaalsContact C-N 3.34Å; A2-T4 PolarHBondContact O-N 2.95Å
5	D	81.8	Confident	84.2	Confident	89 Å²	89	109.7 Å²	109.7	48%	0.476	61%	0.612	S	S	.	*			trans	-52.6	126.1	178.2	-175	-34.4	0	0	0	109.1	E3 K7 T8 V9	E3-D5 PolarHBondContact O-N 3.08Å; E3-D5 VanDerWaalsContact O-N 3.08Å; D5-K7 PolarHBondContact O-N 2.9Å; D5-K7 WeakPolarHBondContact OD1-CB 3.37Å; D5-K7 PolarHBondContact OD1-N 3.23Å; D5-T8 WeakPolarHBondContact O-CB 3.32Å; D5-T8 PolarHBondContact O-N 3.41Å; D5-V9 PolarHBondContact O-N 2.87Å
6	P	84.9	Confident	85.1	Confident	96 Å²	96	107.1 Å²	107.1	62%	0.623	60%	0.6	S	S	*	*	H	α-helix	trans	-48.5	-34.2	177.3	-29.1	34.9	0	0	0	113.8	V9 Q10	P6-V9 PolarHBondContact O-N 2.93Å; P6-Q10 WeakPolarHBondContact O-CG 3.38Å; P6-Q10 PolarHBondContact O-N 3Å
7	K	86.9	Confident	85.8	Confident	130 Å²	130	107.9 Å²	107.9	57%	0.565	60%	0.597	S	S	*	*	H	α-helix	trans	-65	-41.4	177	-172.7	177.4	178.1	179.9	0	112	D5 V9 Q10 D11	D5-K7 PolarHBondContact O-N 2.9Å; D5-K7 WeakPolarHBondContact OD1-CB 3.37Å; D5-K7 PolarHBondContact OD1-N 3.23Å; K7-V9 VanDerWaalsContact C-N 3.29Å; K7-V9 PolarHBondContact O-N 3.05Å; K7-Q10 PolarHBondContact O-N 3.01Å; K7-D11 VanDerWaalsContact O-CG 3.28Å; K7-D11 PolarHBondContact O-N 2.77Å
8	T	89.7	Confident	86.5	Confident	87 Å²	87	106.3 Å²	106.3	53%	0.534	59%	0.591	S	S	.	*	H	α-helix	trans	-63.3	-37.6	175.8	-58.7	0	0	0	0	111.4	D5 L12	D5-T8 WeakPolarHBondContact O-CB 3.32Å; D5-T8 PolarHBondContact O-N 3.41Å; T8-L12 WeakPolarHBondContact O-CB 3.43Å; T8-L12 PolarHBondContact O-N 3.29Å
9	V	91.4	Very high	87.1	Confident	68 Å²	68	106.5 Å²	106.5	41%	0.412	59%	0.59	S	S	.	*	H	α-helix	trans	-67.4	-40.2	176.6	-179.7	0	0	0	0	111.4	D5 P6 K7 T13	D5-V9 PolarHBondContact O-N 2.87Å; P6-V9 PolarHBondContact O-N 2.93Å; K7-V9 VanDerWaalsContact C-N 3.29Å; K7-V9 PolarHBondContact O-N 3.05Å; V9-T13 WeakPolarHBondContact O-CB 3.37Å; V9-T13 PolarHBondContact O-N 3.26Å; V9-T13 PolarHBondContact O-OG1 3.42Å
10	Q	94	Very high	87.7	Confident	127 Å²	127	106.5 Å²	106.5	59%	0.593	59%	0.589	S	S	*	*	H	α-helix	trans	-63.5	-48.6	175.3	-73.4	175.8	-24.4	0	0	111.7	P6 K7 L12 T13 S14	P6-Q10 WeakPolarHBondContact O-CG 3.38Å; P6-Q10 PolarHBondContact O-N 3Å; K7-Q10 PolarHBondContact O-N 3.01Å; Q10-L12 VanDerWaalsContact C-N 3.33Å; Q10-L12 PolarHBondContact O-N 2.94Å; Q10-T13 WeakPolarHBondContact O-CB 3.35Å; Q10-T13 PolarHBondContact O-N 3.27Å; Q10-T13 VanDerWaalsContact O-N 3.12Å; Q10-S14 PolarHBondContact O-N 2.98Å; Q10-S14 PolarHBondContact O-OG 2.93Å
11	D	94.3	Very high	88.2	Confident	89 Å²	89	106 Å²	106	48%	0.476	58%	0.582	S	S	.	*	H	α-helix	trans	-59.1	-45.1	178.5	-69.1	-23.1	0	0	0	111.1	K7 T13 S14 V15	K7-D11 VanDerWaalsContact O-CG 3.28Å; K7-D11 PolarHBondContact O-N 2.77Å; D11-T13 VanDerWaalsContact C-N 3.34Å; D11-T13 PolarHBondContact O-N 2.97Å; D11-S14 PolarHBondContact O-N 3.46Å; D11-V15 WeakPolarHBondContact O-CG2 3.48Å; D11-V15 PolarHBondContact O-N 3.44Å
12	L	94.4	Very high	90.3	Very high	109 Å²	109	100.8 Å²	100.8	57%	0.571	56%	0.555	S	S	*	*	H	α-helix	trans	-60.2	-43.8	175.3	178.5	61.1	0	0	0	111.8	T8 Q10 S14 V15 V16	T8-L12 WeakPolarHBondContact O-CB 3.43Å; T8-L12 PolarHBondContact O-N 3.29Å; Q10-L12 VanDerWaalsContact C-N 3.33Å; Q10-L12 PolarHBondContact O-N 2.94Å; L12-S14 VanDerWaalsContact C-N 3.34Å; L12-S14 PolarHBondContact O-N 3.31Å; L12-V15 PolarHBondContact O-N 2.91Å; L12-V16 HydrophobicContact CD1-CG2 4.27Å; L12-V16 WeakPolarHBondContact O-CG2 3.41Å; L12-V16 PolarHBondContact O-N 3.35Å
13	T	95.1	Very high	92	Very high	65 Å²	65	102.3 Å²	102.3	40%	0.399	55%	0.546	S	S	.	.	H	α-helix	trans	-61.3	-44.2	178.6	-58.7	0	0	0	0	110.9	V9 Q10 D11 V15 V16 Q17	V9-T13 WeakPolarHBondContact O-CB 3.37Å; V9-T13 PolarHBondContact O-N 3.26Å; V9-T13 PolarHBondContact O-OG1 3.42Å; Q10-T13 WeakPolarHBondContact O-CB 3.35Å; Q10-T13 PolarHBondContact O-N 3.27Å; Q10-T13 VanDerWaalsContact O-N 3.12Å; D11-T13 VanDerWaalsContact C-N 3.34Å; D11-T13 PolarHBondContact O-N 2.97Å; T13-V15 PolarHBondContact O-N 3.12Å; T13-V16 PolarHBondContact O-N 2.92Å; T13-Q17 HydrophobicContact CG2-CG 4.48Å; T13-Q17 WeakPolarHBondContact O-CB 3.35Å; T13-Q17 WeakPolarHBondContact O-CG 3.33Å; T13-Q17 PolarHBondContact O-N 3.49Å
14	S	96.8	Very high	93.6	Very high	64 Å²	64	98.9 Å²	98.9	45%	0.448	53%	0.53	S	S	.	.	H	α-helix	trans	-63.1	-39.8	176.5	-65.1	0	0	0	0	112.7	Q10 D11 L12 Q17 T18	Q10-S14 PolarHBondContact O-N 2.98Å; Q10-S14 PolarHBondContact O-OG 2.93Å; D11-S14 PolarHBondContact O-N 3.46Å; L12-S14 VanDerWaalsContact C-N 3.34Å; L12-S14 PolarHBondContact O-N 3.31Å; S14-Q17 PolarHBondContact O-N 3.32Å; S14-T18 WeakPolarHBondContact O-CB 3.32Å; S14-T18 PolarHBondContact O-N 3.3Å; S14-T18 PolarHBondContact O-OG1 3.3Å
15	V	97.1	Very high	94.7	Very high	93 Å²	93	97.5 Å²	97.5	56%	0.564	52%	0.519	S	S	*	.	H	α-helix	trans	-62.9	-46.3	174.7	171.6	0	0	0	0	111	D11 L12 T13 T18 L19	D11-V15 WeakPolarHBondContact O-CG2 3.48Å; D11-V15 PolarHBondContact O-N 3.44Å; L12-V15 PolarHBondContact O-N 2.91Å; T13-V15 PolarHBondContact O-N 3.12Å; V15-T18 PolarHBondContact O-N 2.93Å; V15-L19 WeakPolarHBondContact O-CB 3.49Å; V15-L19 PolarHBondContact O-N 3.35Å
16	V	97.6	Very high	95.5	Very high	69 Å²	69	99.6 Å²	99.6	42%	0.418	52%	0.524	S	S	.	.	H	α-helix	trans	-62.9	-44.3	178.6	172.3	0	0	0	0	111.1	L12 T13 T18 L19 L20	L12-V16 HydrophobicContact CD1-CG2 4.27Å; L12-V16 WeakPolarHBondContact O-CG2 3.41Å; L12-V16 PolarHBondContact O-N 3.35Å; T13-V16 PolarHBondContact O-N 2.92Å; V16-T18 PolarHBondContact O-N 3.49Å; V16-L19 PolarHBondContact O-N 2.97Å; V16-L20 HydrophobicContact CG1-CD1 3.97Å; V16-L20 HydrophobicContact CG1-CG 4.36Å; V16-L20 WeakPolarHBondContact O-CB 3.43Å; V16-L20 WeakPolarHBondContact O-CG 3.39Å; V16-L20 PolarHBondContact O-N 2.8Å
17	Q	97.9	Very high	96.2	Very high	120 Å²	120	101.7 Å²	101.7	56%	0.561	52%	0.523	S	S	*	.	H	α-helix	trans	-60.7	-45.3	176.7	-75.1	175.4	2	0	0	111.9	T13 S14 L19 L20 Q21	T13-Q17 HydrophobicContact CG2-CG 4.48Å; T13-Q17 WeakPolarHBondContact O-CB 3.35Å; T13-Q17 WeakPolarHBondContact O-CG 3.33Å; T13-Q17 PolarHBondContact O-N 3.49Å; S14-Q17 PolarHBondContact O-N 3.32Å; Q17-L19 VanDerWaalsContact C-N 3.33Å; Q17-L19 PolarHBondContact O-N 2.98Å; Q17-L20 PolarHBondContact O-N 2.91Å; Q17-Q21 PolarHBondContact O-N 3.45Å
18	T	98.1	Very high	96.7	Very high	80 Å²	80	100 Å²	100	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-61.3	-43.3	177.5	-56.9	0	0	0	0	111.1	S14 V15 V16 Q21 Q22	S14-T18 WeakPolarHBondContact O-CB 3.32Å; S14-T18 PolarHBondContact O-N 3.3Å; S14-T18 PolarHBondContact O-OG1 3.3Å; V15-T18 PolarHBondContact O-N 2.93Å; V16-T18 PolarHBondContact O-N 3.49Å; T18-Q21 PolarHBondContact O-N 3.14Å; T18-Q22 VanDerWaalsContact O-CG 3.32Å; T18-Q22 WeakPolarHBondContact O-CG 3.46Å; T18-Q22 PolarHBondContact O-N 3.3Å
19	L	98.5	Very high	97.1	Very high	109 Å²	109	99.7 Å²	99.7	57%	0.571	52%	0.515	S	S	*	.	H	α-helix	trans	-64.7	-43.3	178.7	179.8	62.1	0	0	0	112.1	V15 V16 Q17 Q21 Q22 M23	V15-L19 WeakPolarHBondContact O-CB 3.49Å; V15-L19 PolarHBondContact O-N 3.35Å; V16-L19 PolarHBondContact O-N 2.97Å; Q17-L19 VanDerWaalsContact C-N 3.33Å; Q17-L19 PolarHBondContact O-N 2.98Å; L19-Q21 VanDerWaalsContact C-N 3.35Å; L19-Q22 PolarHBondContact O-N 3.49Å; L19-M23 WeakPolarHBondContact O-CB 3.34Å; L19-M23 PolarHBondContact O-N 2.94Å
20	L	98.6	Very high	97.5	Very high	107 Å²	107	100.8 Å²	100.8	56%	0.56	52%	0.517	S	S	*	.	H	α-helix	trans	-63.5	-41.5	177.1	-72.7	173.7	0	0	0	111.5	V16 Q17 M23 Q24	V16-L20 HydrophobicContact CG1-CD1 3.97Å; V16-L20 HydrophobicContact CG1-CG 4.36Å; V16-L20 WeakPolarHBondContact O-CB 3.43Å; V16-L20 WeakPolarHBondContact O-CG 3.39Å; V16-L20 PolarHBondContact O-N 2.8Å; Q17-L20 PolarHBondContact O-N 2.91Å; L20-M23 PolarHBondContact O-N 3.32Å; L20-Q24 WeakPolarHBondContact O-CB 3.32Å; L20-Q24 PolarHBondContact O-N 3Å
21	Q	98.5	Very high	97.7	Very high	97 Å²	97	95.9 Å²	95.9	45%	0.453	50%	0.497	S	S	.	.	H	α-helix	trans	-61.4	-48.2	175.7	-171.5	62.5	57.5	0	0	111.1	Q17 T18 L19 M23 Q24 D25	Q17-Q21 PolarHBondContact O-N 3.45Å; T18-Q21 PolarHBondContact O-N 3.14Å; L19-Q21 VanDerWaalsContact C-N 3.35Å; Q21-M23 VanDerWaalsContact C-N 3.28Å; Q21-M23 PolarHBondContact O-N 3.4Å; Q21-Q24 WeakPolarHBondContact O-CB 3.44Å; Q21-Q24 PolarHBondContact O-N 3.02Å; Q21-Q24 VanDerWaalsContact O-N 3.14Å; Q21-D25 PolarHBondContact NE2-OD1 3.19Å; Q21-D25 PolarHBondContact O-N 2.92Å
22	Q	98.5	Very high	97.9	Very high	120 Å²	120	95.7 Å²	95.7	56%	0.561	50%	0.496	S	S	*	.	H	α-helix	trans	-59.6	-39.2	177.1	-73.1	175.6	-8.9	0	0	112.5	T18 L19 K26	T18-Q22 VanDerWaalsContact O-CG 3.32Å; T18-Q22 WeakPolarHBondContact O-CG 3.46Å; T18-Q22 PolarHBondContact O-N 3.3Å; L19-Q22 PolarHBondContact O-N 3.49Å; Q22-K26 VanDerWaalsContact O-CB 3.31Å; Q22-K26 WeakPolarHBondContact O-CB 3.36Å; Q22-K26 PolarHBondContact O-N 3.48Å
23	M	98.3	Very high	98.1	Very high	133 Å²	133	96.5 Å²	96.5	66%	0.655	50%	0.497	S	S	*	.	H	α-helix	trans	-65.5	-43.2	176.3	-177.4	176.2	175.4	0	0	111.4	L19 L20 Q21 K26 F27	L19-M23 WeakPolarHBondContact O-CB 3.34Å; L19-M23 PolarHBondContact O-N 2.94Å; L20-M23 PolarHBondContact O-N 3.32Å; Q21-M23 VanDerWaalsContact C-N 3.28Å; Q21-M23 PolarHBondContact O-N 3.4Å; M23-K26 PolarHBondContact O-N 3.38Å; M23-F27 WeakPolarHBondContact O-CB 3.48Å; M23-F27 PolarHBondContact O-N 2.81Å
24	Q	98.5	Very high	98.3	Very high	117 Å²	117	98.2 Å²	98.2	55%	0.547	50%	0.503	S	S	.	.	H	α-helix	trans	-62.4	-48.1	176.4	-174.2	178.3	27.2	0	0	111.3	L20 Q21 K26 F27 Q28	L20-Q24 WeakPolarHBondContact O-CB 3.32Å; L20-Q24 PolarHBondContact O-N 3Å; Q21-Q24 WeakPolarHBondContact O-CB 3.44Å; Q21-Q24 PolarHBondContact O-N 3.02Å; Q21-Q24 VanDerWaalsContact O-N 3.14Å; Q24-K26 VanDerWaalsContact C-N 3.3Å; Q24-K26 PolarHBondContact O-N 3.37Å; Q24-F27 PolarHBondContact O-N 2.85Å; Q24-Q28 WeakPolarHBondContact O-CB 3.31Å; Q24-Q28 PolarHBondContact O-N 3.45Å
25	D	98.7	Very high	98.3	Very high	79 Å²	79	99.4 Å²	99.4	42%	0.422	50%	0.503	S	S	.	.	H	α-helix	trans	-60.8	-41.5	180	-63.9	-16.5	0	0	0	111.2	Q21 Q28 T29	Q21-D25 PolarHBondContact NE2-OD1 3.19Å; Q21-D25 PolarHBondContact O-N 2.92Å; D25-Q28 PolarHBondContact O-N 3.15Å; D25-T29 WeakPolarHBondContact O-CB 3.32Å; D25-T29 PolarHBondContact O-N 2.99Å; D25-T29 PolarHBondContact O-OG1 2.77Å
26	K	98.5	Very high	98.4	Very high	133 Å²	133	96.9 Å²	96.9	58%	0.578	50%	0.496	S	S	*	.	H	α-helix	trans	-65.7	-44.3	176.2	-175.4	174.6	179.9	179.2	0	111.7	Q22 M23 Q24 T29 M30	Q22-K26 VanDerWaalsContact O-CB 3.31Å; Q22-K26 WeakPolarHBondContact O-CB 3.36Å; Q22-K26 PolarHBondContact O-N 3.48Å; M23-K26 PolarHBondContact O-N 3.38Å; Q24-K26 VanDerWaalsContact C-N 3.3Å; Q24-K26 PolarHBondContact O-N 3.37Å; K26-T29 PolarHBondContact O-N 3.04Å; K26-M30 HydrophobicContact CD-CE 4.23Å; K26-M30 HydrophobicContact CG-CE 3.9Å; K26-M30 HydrophobicContact CG-SD 4.44Å; K26-M30 WeakPolarHBondContact O-CG 3.39Å; K26-M30 PolarHBondContact O-N 2.86Å
27	F	98.5	Very high	98.5	Very high	140 Å²	140	101.5 Å²	101.5	61%	0.614	51%	0.506	S	S	*	.	H	α-helix	trans	-64.5	-41.2	177.4	-179.5	-97	0	0	0	111.6	M23 Q24 M30 S31	M23-F27 WeakPolarHBondContact O-CB 3.48Å; M23-F27 PolarHBondContact O-N 2.81Å; Q24-F27 PolarHBondContact O-N 2.85Å; F27-M30 PolarHBondContact O-N 3.05Å; F27-S31 WeakPolarHBondContact CE1-OG 3.33Å; F27-S31 WeakPolarHBondContact O-CB 3.39Å; F27-S31 PolarHBondContact O-N 2.86Å; F27-S31 PolarHBondContact O-OG 3.2Å
28	Q	98.6	Very high	98.5	Very high	95 Å²	95	100.4 Å²	100.4	44%	0.444	50%	0.503	S	S	.	.	H	α-helix	trans	-61.5	-49.7	176.1	-172.1	61.7	45.6	0	0	110.5	Q24 D25 M30 S31 D32	Q24-Q28 WeakPolarHBondContact O-CB 3.31Å; Q24-Q28 PolarHBondContact O-N 3.45Å; D25-Q28 PolarHBondContact O-N 3.15Å; Q28-M30 VanDerWaalsContact C-N 3.3Å; Q28-M30 PolarHBondContact O-N 2.86Å; Q28-S31 WeakPolarHBondContact O-CB 3.43Å; Q28-S31 PolarHBondContact O-N 3.48Å; Q28-D32 PolarHBondContact NE2-OD1 3Å; Q28-D32 VanDerWaalsContact O-CG 3.22Å; Q28-D32 PolarHBondContact O-N 2.79Å
29	T	98.5	Very high	98.5	Very high	79 Å²	79	101.2 Å²	101.2	49%	0.485	50%	0.504	S	S	.	.	H	α-helix	trans	-56.7	-44	177.7	-56.5	0	0	0	0	111.9	D25 K26 Q33	D25-T29 WeakPolarHBondContact O-CB 3.32Å; D25-T29 PolarHBondContact O-N 2.99Å; D25-T29 PolarHBondContact O-OG1 2.77Å; K26-T29 PolarHBondContact O-N 3.04Å; T29-Q33 VanDerWaalsContact O-CG 3.32Å; T29-Q33 WeakPolarHBondContact O-CG 3.43Å; T29-Q33 PolarHBondContact O-N 3.35Å; T29-Q33 VanDerWaalsContact O-N 3.15Å
30	M	98.3	Very high	98.5	Very high	91 Å²	91	100.4 Å²	100.4	45%	0.448	50%	0.5	S	S	.	.	H	α-helix	trans	-66.1	-40	176.4	-72.6	178.4	178.5	0	0	112.2	K26 F27 Q28 Q33 I34	K26-M30 HydrophobicContact CD-CE 4.23Å; K26-M30 HydrophobicContact CG-CE 3.9Å; K26-M30 HydrophobicContact CG-SD 4.44Å; K26-M30 WeakPolarHBondContact O-CG 3.39Å; K26-M30 PolarHBondContact O-N 2.86Å; F27-M30 PolarHBondContact O-N 3.05Å; Q28-M30 VanDerWaalsContact C-N 3.3Å; Q28-M30 PolarHBondContact O-N 2.86Å; M30-Q33 PolarHBondContact O-N 3.3Å; M30-I34 VanDerWaalsContact O-CG1 3.32Å; M30-I34 WeakPolarHBondContact O-CG1 3.32Å; M30-I34 PolarHBondContact O-N 3.37Å
31	S	98.6	Very high	98.5	Very high	25 Å²	25	99.5 Å²	99.5	18%	0.175	49%	0.494	C	S	.	.	H	α-helix	trans	-63.1	-46	178.4	-60.3	0	0	0	0	110.8	F27 Q28 Q33 I34 I35	F27-S31 WeakPolarHBondContact CE1-OG 3.33Å; F27-S31 WeakPolarHBondContact O-CB 3.39Å; F27-S31 PolarHBondContact O-N 2.86Å; F27-S31 PolarHBondContact O-OG 3.2Å; Q28-S31 WeakPolarHBondContact O-CB 3.43Å; Q28-S31 PolarHBondContact O-N 3.48Å; S31-Q33 VanDerWaalsContact C-N 3.29Å; S31-Q33 PolarHBondContact O-N 2.95Å; S31-I34 PolarHBondContact O-N 3.14Å; S31-I34 VanDerWaalsContact O-N 3.14Å; S31-I35 WeakPolarHBondContact O-CB 3.27Å; S31-I35 VanDerWaalsContact O-CG1 3.27Å; S31-I35 WeakPolarHBondContact O-CG1 3.35Å; S31-I35 PolarHBondContact O-N 2.9Å
32	D	98.6	Very high	98.5	Very high	85 Å²	85	97.6 Å²	97.6	46%	0.455	49%	0.491	S	S	.	.	H	α-helix	trans	-61.3	-38.9	177.7	-62.4	-20.8	0	0	0	111.4	Q28 G36	Q28-D32 PolarHBondContact NE2-OD1 3Å; Q28-D32 VanDerWaalsContact O-CG 3.22Å; Q28-D32 PolarHBondContact O-N 2.79Å; D32-G36 PolarHBondContact O-N 2.86Å
33	Q	98.5	Very high	98.5	Very high	126 Å²	126	94.8 Å²	94.8	59%	0.589	49%	0.485	S	S	*	.	H	α-helix	trans	-65.8	-40.4	174.6	-74.2	177.5	-15.7	0	0	113	T29 M30 S31 R37	T29-Q33 VanDerWaalsContact O-CG 3.32Å; T29-Q33 WeakPolarHBondContact O-CG 3.43Å; T29-Q33 PolarHBondContact O-N 3.35Å; T29-Q33 VanDerWaalsContact O-N 3.15Å; M30-Q33 PolarHBondContact O-N 3.3Å; S31-Q33 VanDerWaalsContact C-N 3.29Å; S31-Q33 PolarHBondContact O-N 2.95Å; Q33-R37 WeakPolarHBondContact O-CG 3.48Å; Q33-R37 PolarHBondContact O-N 3.22Å
34	I	98.5	Very high	98.6	Very high	101 Å²	101	95.8 Å²	95.8	52%	0.518	48%	0.481	S	S	.	.	H	α-helix	trans	-67.8	-46.1	177.8	-69.5	166.2	0	0	0	110	M30 S31 R37 I38	M30-I34 VanDerWaalsContact O-CG1 3.32Å; M30-I34 WeakPolarHBondContact O-CG1 3.32Å; M30-I34 PolarHBondContact O-N 3.37Å; S31-I34 PolarHBondContact O-N 3.14Å; S31-I34 VanDerWaalsContact O-N 3.14Å; I34-R37 PolarHBondContact O-N 3.36Å; I34-I38 HydrophobicContact CG2-CD1 3.85Å; I34-I38 WeakPolarHBondContact O-CG1 3.38Å; I34-I38 PolarHBondContact O-N 2.83Å
35	I	98.5	Very high	98.6	Very high	88 Å²	88	94.5 Å²	94.5	45%	0.451	48%	0.477	S	S	.	.	H	α-helix	trans	-59.4	-49.2	177.4	-68.1	165.5	0	0	0	110	S31 R37 I38 D39	S31-I35 WeakPolarHBondContact O-CB 3.27Å; S31-I35 VanDerWaalsContact O-CG1 3.27Å; S31-I35 WeakPolarHBondContact O-CG1 3.35Å; S31-I35 PolarHBondContact O-N 2.9Å; I35-R37 PolarHBondContact O-N 3.21Å; I35-I38 CarbonylContact O-C 3.6Å; I35-I38 WeakPolarHBondContact O-CA 3.29Å; I35-I38 WeakPolarHBondContact O-CB 3.44Å; I35-I38 PolarHBondContact O-N 3.07Å; I35-D39 PolarHBondContact O-N 3.16Å
36	G	98.7	Very high	98.5	Very high	40 Å²	40	94.9 Å²	94.9	41%	0.412	48%	0.479	S	S	.	.	H	α-helix	trans	-59.7	-31.9	178.7	0	0	0	0	0	113.8	D32 D40	D32-G36 PolarHBondContact O-N 2.86Å; G36-D40 PolarHBondContact O-N 2.77Å; G36-D40 VanDerWaalsContact O-N 3.16Å
37	R	98.5	Very high	98.5	Very high	167 Å²	167	92.8 Å²	92.8	63%	0.63	48%	0.475	S	S	*	.	H	α-helix	trans	-73.4	-35.5	173	-71.9	175.6	67.6	-166.8	-0.2	112.7	Q33 I34 I35 M41	Q33-R37 WeakPolarHBondContact O-CG 3.48Å; Q33-R37 PolarHBondContact O-N 3.22Å; I34-R37 PolarHBondContact O-N 3.36Å; I35-R37 PolarHBondContact O-N 3.21Å; R37-M41 HydrophobicContact CB-CE 4.25Å; R37-M41 VanDerWaalsContact O-CG 3.29Å; R37-M41 WeakPolarHBondContact O-CG 3.28Å; R37-M41 PolarHBondContact O-N 3.49Å
38	I	98.7	Very high	98.5	Very high	97 Å²	97	91 Å²	91	50%	0.497	47%	0.471	S	S	.	.	H	α-helix	trans	-67.1	-42.3	175.5	-69.6	167.6	0	0	0	109.7	I34 I35 D40 M41 S42	I34-I38 HydrophobicContact CG2-CD1 3.85Å; I34-I38 WeakPolarHBondContact O-CG1 3.38Å; I34-I38 PolarHBondContact O-N 2.83Å; I35-I38 CarbonylContact O-C 3.6Å; I35-I38 WeakPolarHBondContact O-CA 3.29Å; I35-I38 WeakPolarHBondContact O-CB 3.44Å; I35-I38 PolarHBondContact O-N 3.07Å; I38-D40 PolarHBondContact O-N 2.85Å; I38-M41 CarbonylContact O-C 3.58Å; I38-M41 PolarHBondContact O-N 2.95Å; I38-S42 WeakPolarHBondContact O-CB 3.45Å; I38-S42 PolarHBondContact O-N 3.17Å
39	D	98.6	Very high	98.4	Very high	97 Å²	97	92.2 Å²	92.2	52%	0.519	48%	0.477	S	S	.	.	H	α-helix	trans	-62.5	-43.3	177.9	-66	-17.6	0	0	0	111.6	I35 S42 S43	I35-D39 PolarHBondContact O-N 3.16Å; D39-S42 WeakPolarHBondContact O-CB 3.46Å; D39-S42 PolarHBondContact O-N 2.92Å; D39-S43 PolarHBondContact O-N 3.23Å
40	D	98.6	Very high	98.4	Very high	92 Å²	92	94.8 Å²	94.8	49%	0.492	48%	0.481	S	S	.	.	H	α-helix	trans	-60.4	-45.2	173.1	178.4	72.3	0	0	0	111.8	G36 I38 S42 S43 R44	G36-D40 PolarHBondContact O-N 2.77Å; G36-D40 VanDerWaalsContact O-N 3.16Å; I38-D40 PolarHBondContact O-N 2.85Å; D40-S42 VanDerWaalsContact C-N 3.33Å; D40-S42 PolarHBondContact O-N 3.47Å; D40-S43 PolarHBondContact O-N 3.31Å; D40-R44 VanDerWaalsContact O-CG 3.29Å; D40-R44 WeakPolarHBondContact O-CG 3.44Å; D40-R44 PolarHBondContact O-N 2.72Å; D40-R44 VanDerWaalsContact O-N 3.08Å
41	M	98.6	Very high	98.3	Very high	87 Å²	87	94.8 Å²	94.8	43%	0.429	48%	0.483	S	S	.	.	H	α-helix	trans	-63.1	-39.4	175.3	-71.1	-178.6	-139.8	0	0	111.9	R37 I38 R44 I45	R37-M41 HydrophobicContact CB-CE 4.25Å; R37-M41 VanDerWaalsContact O-CG 3.29Å; R37-M41 WeakPolarHBondContact O-CG 3.28Å; R37-M41 PolarHBondContact O-N 3.49Å; I38-M41 CarbonylContact O-C 3.58Å; I38-M41 PolarHBondContact O-N 2.95Å; M41-R44 PolarHBondContact O-N 3.12Å; M41-I45 VanDerWaalsContact O-CG1 3.28Å; M41-I45 WeakPolarHBondContact O-CG1 3.23Å; M41-I45 PolarHBondContact O-N 3.44Å
42	S	98.6	Very high	98.2	Very high	57 Å²	57	98.4 Å²	98.4	40%	0.399	50%	0.499	S	S	.	.	H	α-helix	trans	-61.6	-49.3	177.1	-165.2	0	0	0	0	110.8	I38 D39 D40 R44 I45 D46	I38-S42 WeakPolarHBondContact O-CB 3.45Å; I38-S42 PolarHBondContact O-N 3.17Å; D39-S42 WeakPolarHBondContact O-CB 3.46Å; D39-S42 PolarHBondContact O-N 2.92Å; D40-S42 VanDerWaalsContact C-N 3.33Å; D40-S42 PolarHBondContact O-N 3.47Å; S42-R44 VanDerWaalsContact C-N 3.26Å; S42-R44 PolarHBondContact O-N 3.08Å; S42-I45 WeakPolarHBondContact O-CB 3.45Å; S42-I45 PolarHBondContact O-N 2.83Å; S42-D46 VanDerWaalsContact O-CG 3.29Å; S42-D46 PolarHBondContact O-N 3.06Å
43	S	98.5	Very high	97.9	Very high	61 Å²	61	96.8 Å²	96.8	43%	0.427	50%	0.498	S	S	.	.	H	α-helix	trans	-59	-38.7	177.2	-178.5	0	0	0	0	112.2	D39 D40 I45 D46 D47	D39-S43 PolarHBondContact O-N 3.23Å; D40-S43 PolarHBondContact O-N 3.31Å; S43-I45 VanDerWaalsContact C-N 3.34Å; S43-D46 PolarHBondContact O-N 3.41Å; S43-D47 PolarHBondContact O-N 2.96Å
44	R	98.5	Very high	97.8	Very high	154 Å²	154	94.2 Å²	94.2	58%	0.581	49%	0.488	S	S	*	.	H	α-helix	trans	-69.7	-32.7	177.1	-70.5	172.9	61.4	-165.5	-3.6	112.5	D40 M41 S42 L48	D40-R44 VanDerWaalsContact O-CG 3.29Å; D40-R44 WeakPolarHBondContact O-CG 3.44Å; D40-R44 PolarHBondContact O-N 2.72Å; D40-R44 VanDerWaalsContact O-N 3.08Å; M41-R44 PolarHBondContact O-N 3.12Å; S42-R44 VanDerWaalsContact C-N 3.26Å; S42-R44 PolarHBondContact O-N 3.08Å; R44-L48 WeakPolarHBondContact O-CB 3.46Å; R44-L48 VanDerWaalsContact O-CG 3.23Å; R44-L48 WeakPolarHBondContact O-CG 3.5Å; R44-L48 PolarHBondContact O-N 2.86Å
45	I	98.7	Very high	97.6	Very high	90 Å²	90	94.3 Å²	94.3	46%	0.462	49%	0.489	S	S	.	.	H	α-helix	trans	-67	-46.8	173.2	-70.4	163.8	0	0	0	109.3	M41 S42 S43 D47 L48 E49	M41-I45 VanDerWaalsContact O-CG1 3.28Å; M41-I45 WeakPolarHBondContact O-CG1 3.23Å; M41-I45 PolarHBondContact O-N 3.44Å; S42-I45 WeakPolarHBondContact O-CB 3.45Å; S42-I45 PolarHBondContact O-N 2.83Å; S43-I45 VanDerWaalsContact C-N 3.34Å; I45-D47 VanDerWaalsContact C-N 3.29Å; I45-D47 PolarHBondContact O-N 3.03Å; I45-L48 CarbonylContact O-C 3.59Å; I45-L48 WeakPolarHBondContact O-CA 3.26Å; I45-L48 WeakPolarHBondContact O-CB 3.47Å; I45-L48 PolarHBondContact O-N 3.32Å; I45-E49 HydrophobicContact CG2-CG 4.26Å; I45-E49 WeakPolarHBondContact O-CG 3.29Å; I45-E49 PolarHBondContact O-N 3.04Å
46	D	98.4	Very high	97.2	Very high	87 Å²	87	94 Å²	94	47%	0.465	49%	0.487	S	S	.	.	H	α-helix	trans	-56.6	-43.8	177.2	-60.9	-22.4	0	0	0	111.4	S42 S43 E49 K50	S42-D46 VanDerWaalsContact O-CG 3.29Å; S42-D46 PolarHBondContact O-N 3.06Å; S43-D46 PolarHBondContact O-N 3.41Å; D46-E49 PolarHBondContact O-N 3.28Å; D46-K50 WeakPolarHBondContact O-CB 3.12Å; D46-K50 PolarHBondContact O-N 2.83Å
47	D	98.5	Very high	96.9	Very high	89 Å²	89	97.4 Å²	97.4	48%	0.476	50%	0.5	S	S	.	.	H	α-helix	trans	-63.9	-40.1	175.6	-75.6	-25.1	0	0	0	112.3	S43 I45 N51	S43-D47 PolarHBondContact O-N 2.96Å; I45-D47 VanDerWaalsContact C-N 3.29Å; I45-D47 PolarHBondContact O-N 3.03Å; D47-N51 WeakPolarHBondContact O-CB 3.26Å; D47-N51 PolarHBondContact O-N 2.72Å; D47-N51 PolarHBondContact O-ND2 3.33Å
48	L	98.1	Very high	96.6	Very high	103 Å²	103	96.9 Å²	96.9	54%	0.539	50%	0.504	S	S	.	.	H	α-helix	trans	-66.9	-43.5	176.8	-75.8	171.5	0	0	0	111.6	R44 I45 K50 N51 I52	R44-L48 WeakPolarHBondContact O-CB 3.46Å; R44-L48 VanDerWaalsContact O-CG 3.23Å; R44-L48 WeakPolarHBondContact O-CG 3.5Å; R44-L48 PolarHBondContact O-N 2.86Å; I45-L48 CarbonylContact O-C 3.59Å; I45-L48 WeakPolarHBondContact O-CA 3.26Å; I45-L48 WeakPolarHBondContact O-CB 3.47Å; I45-L48 PolarHBondContact O-N 3.32Å; L48-K50 VanDerWaalsContact C-N 3.32Å; L48-K50 PolarHBondContact O-N 2.91Å; L48-N51 PolarHBondContact O-N 3.35Å; L48-I52 WeakPolarHBondContact O-CB 3.5Å; L48-I52 VanDerWaalsContact O-CG1 3.26Å; L48-I52 WeakPolarHBondContact O-CG1 3.48Å; L48-I52 PolarHBondContact O-N 2.89Å
49	E	96.8	Very high	96.2	Very high	120 Å²	120	95.5 Å²	95.5	56%	0.561	51%	0.508	S	S	*	.	H	α-helix	trans	-59	-45	176.2	-72.9	-176.4	160.6	0	0	110.9	I45 D46 I52 A53	I45-E49 HydrophobicContact CG2-CG 4.26Å; I45-E49 WeakPolarHBondContact O-CG 3.29Å; I45-E49 PolarHBondContact O-N 3.04Å; D46-E49 PolarHBondContact O-N 3.28Å; E49-I52 PolarHBondContact O-N 2.84Å; E49-A53 WeakPolarHBondContact O-CB 3.42Å; E49-A53 PolarHBondContact O-N 3.03Å
50	K	97.2	Very high	95.6	Very high	134 Å²	134	93.8 Å²	93.8	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-60.5	-48.8	174.4	-178.3	179	176.8	178.3	0	112.2	D46 L48 I52 A53 D54	D46-K50 WeakPolarHBondContact O-CB 3.12Å; D46-K50 PolarHBondContact O-N 2.83Å; L48-K50 VanDerWaalsContact C-N 3.32Å; L48-K50 PolarHBondContact O-N 2.91Å; K50-I52 VanDerWaalsContact C-N 3.27Å; K50-I52 PolarHBondContact O-N 3.26Å; K50-A53 PolarHBondContact O-N 3.43Å; K50-D54 PolarHBondContact O-N 2.92Å
51	N	96.6	Very high	94.6	Very high	91 Å²	91	93 Å²	93	49%	0.487	51%	0.511	S	S	.	.	H	α-helix	trans	-60.8	-38	179.1	-74.5	-45.5	0	0	0	111.9	D47 L48 L55	D47-N51 WeakPolarHBondContact O-CB 3.26Å; D47-N51 PolarHBondContact O-N 2.72Å; D47-N51 PolarHBondContact O-ND2 3.33Å; L48-N51 PolarHBondContact O-N 3.35Å; N51-L55 WeakPolarHBondContact O-CB 3.23Å; N51-L55 VanDerWaalsContact O-CG 3.23Å; N51-L55 WeakPolarHBondContact O-CG 3.41Å; N51-L55 PolarHBondContact O-N 2.84Å
52	I	96	Very high	93.3	Very high	100 Å²	100	97 Å²	97	51%	0.513	53%	0.528	S	S	.	.	H	α-helix	trans	-67.1	-45	175.9	-69.4	165.4	0	0	0	110.6	L48 E49 K50 D54 L55 M56	L48-I52 WeakPolarHBondContact O-CB 3.5Å; L48-I52 VanDerWaalsContact O-CG1 3.26Å; L48-I52 WeakPolarHBondContact O-CG1 3.48Å; L48-I52 PolarHBondContact O-N 2.89Å; E49-I52 PolarHBondContact O-N 2.84Å; K50-I52 VanDerWaalsContact C-N 3.27Å; K50-I52 PolarHBondContact O-N 3.26Å; I52-D54 VanDerWaalsContact C-N 3.31Å; I52-D54 PolarHBondContact O-N 2.97Å; I52-L55 PolarHBondContact O-N 2.82Å; I52-M56 HydrophobicContact CG2-CG 4.19Å; I52-M56 WeakPolarHBondContact O-CB 3.43Å; I52-M56 VanDerWaalsContact O-CG 3.29Å; I52-M56 WeakPolarHBondContact O-CG 3.48Å; I52-M56 PolarHBondContact O-N 3.19Å
53	A	93.3	Very high	91.6	Very high	51 Å²	51	102.9 Å²	102.9	42%	0.421	55%	0.549	S	S	.	.	H	α-helix	trans	-59.5	-42.4	176.8	0	0	0	0	0	111.9	E49 K50 M56 T57	E49-A53 WeakPolarHBondContact O-CB 3.42Å; E49-A53 PolarHBondContact O-N 3.03Å; K50-A53 PolarHBondContact O-N 3.43Å; A53-M56 PolarHBondContact O-N 2.97Å; A53-T57 WeakPolarHBondContact O-CB 3.39Å; A53-T57 PolarHBondContact O-N 3.46Å; A53-T57 PolarHBondContact O-OG1 3.01Å
54	D	95.2	Very high	89.9	Confident	73 Å²	73	107.6 Å²	107.6	39%	0.39	57%	0.569	S	S	.	*	H	α-helix	trans	-63.6	-43.1	175.5	-72.5	-21.4	0	0	0	111.3	K50 I52 T57 Q58	K50-D54 PolarHBondContact O-N 2.92Å; I52-D54 VanDerWaalsContact C-N 3.31Å; I52-D54 PolarHBondContact O-N 2.97Å; D54-T57 PolarHBondContact O-N 2.64Å; D54-Q58 WeakPolarHBondContact O-CB 3.29Å; D54-Q58 VanDerWaalsContact O-CG 3.25Å; D54-Q58 WeakPolarHBondContact O-CG 3.49Å; D54-Q58 PolarHBondContact O-N 2.88Å
55	L	95.1	Very high	88	Confident	102 Å²	102	108.8 Å²	108.8	53%	0.534	58%	0.581	S	S	.	*	H	α-helix	trans	-65.8	-41.7	176.7	-75.5	171.1	0	0	0	112.8	N51 I52 T57 Q58 A59	N51-L55 WeakPolarHBondContact O-CB 3.23Å; N51-L55 VanDerWaalsContact O-CG 3.23Å; N51-L55 WeakPolarHBondContact O-CG 3.41Å; N51-L55 PolarHBondContact O-N 2.84Å; I52-L55 PolarHBondContact O-N 2.82Å; L55-T57 VanDerWaalsContact C-N 3.35Å; L55-Q58 PolarHBondContact O-N 3.45Å; L55-A59 VanDerWaalsContact O-CB 3.24Å; L55-A59 WeakPolarHBondContact O-CB 3.4Å; L55-A59 PolarHBondContact O-N 2.93Å
56	M	90.7	Very high	86.1	Confident	82 Å²	82	107.6 Å²	107.6	40%	0.404	59%	0.592	S	S	.	*	H	α-helix	trans	-62.6	-43.5	175.9	-70.5	-69.9	93.9	0	0	111.2	I52 A53 Q58 A59 G60 V61	I52-M56 HydrophobicContact CG2-CG 4.19Å; I52-M56 WeakPolarHBondContact O-CB 3.43Å; I52-M56 VanDerWaalsContact O-CG 3.29Å; I52-M56 WeakPolarHBondContact O-CG 3.48Å; I52-M56 PolarHBondContact O-N 3.19Å; A53-M56 PolarHBondContact O-N 2.97Å; M56-Q58 PolarHBondContact O-N 3.42Å; M56-A59 PolarHBondContact O-N 2.8Å; M56-G60 PolarHBondContact O-N 3.21Å; M56-G60 VanDerWaalsContact O-N 3.17Å; M56-V61 HydrophobicContact CE-CB 4.46Å; M56-V61 HydrophobicContact CE-CG2 4.25Å; M56-V61 PolarHBondContact O-N 2.84Å; M56-V61 HydrophobicContact SD-CB 3.87Å; M56-V61 HydrophobicContact SD-CG1 3.86Å; M56-V61 HydrophobicContact SD-CG2 4.26Å
57	T	91.8	Very high	84	Confident	112 Å²	112	110.4 Å²	110.4	69%	0.687	60%	0.602	S	S	*	*	H	α-helix	trans	-60.7	-45.1	174.7	-56.8	0	0	0	0	111.3	A53 D54 L55 G60	A53-T57 WeakPolarHBondContact O-CB 3.39Å; A53-T57 PolarHBondContact O-N 3.46Å; A53-T57 PolarHBondContact O-OG1 3.01Å; D54-T57 PolarHBondContact O-N 2.64Å; L55-T57 VanDerWaalsContact C-N 3.35Å; T57-G60 PolarHBondContact O-N 2.78Å
58	Q	91.7	Very high	82.1	Confident	156 Å²	156	113.2 Å²	113.2	73%	0.729	62%	0.617	S	S	*	*	H	α-helix	trans	-68.3	-35.4	178.3	-73.9	173.8	34.6	0	0	113.3	D54 L55 M56 G60	D54-Q58 WeakPolarHBondContact O-CB 3.29Å; D54-Q58 VanDerWaalsContact O-CG 3.25Å; D54-Q58 WeakPolarHBondContact O-CG 3.49Å; D54-Q58 PolarHBondContact O-N 2.88Å; L55-Q58 PolarHBondContact O-N 3.45Å; M56-Q58 PolarHBondContact O-N 3.42Å; Q58-G60 PolarHBondContact O-N 3.48Å
59	A	91.2	Very high	80.4	Confident	68 Å²	68	115.6 Å²	115.6	56%	0.562	62%	0.623	S	S	*	*	H	α-helix	trans	-75.1	-8.1	177.5	0	0	0	0	0	112.9	L55 M56 V61	L55-A59 VanDerWaalsContact O-CB 3.24Å; L55-A59 WeakPolarHBondContact O-CB 3.4Å; L55-A59 PolarHBondContact O-N 2.93Å; M56-A59 PolarHBondContact O-N 2.8Å; A59-V61 HydrophobicContact CB-CG2 3.84Å; A59-V61 PolarHBondContact O-N 2.97Å
60	G	86.5	Confident	78.7	Confident	60 Å²	60	116.1 Å²	116.1	62%	0.619	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	65	25	-174.5	0	0	0	0	0	112.7	M56 T57 Q58 E62	M56-G60 PolarHBondContact O-N 3.21Å; M56-G60 VanDerWaalsContact O-N 3.17Å; T57-G60 PolarHBondContact O-N 2.78Å; Q58-G60 PolarHBondContact O-N 3.48Å; G60-E62 PolarHBondContact O-N 3.37Å; G60-E62 VanDerWaalsContact O-N 3.12Å
61	V	77.2	Confident	77.2	Confident	75 Å²	75	115.3 Å²	115.3	46%	0.455	64%	0.637	S	S	.	*			trans	-80.6	94.2	174.8	-178.6	0	0	0	0	106.6	M56 A59 E63	M56-V61 HydrophobicContact CE-CB 4.46Å; M56-V61 HydrophobicContact CE-CG2 4.25Å; M56-V61 PolarHBondContact O-N 2.84Å; M56-V61 HydrophobicContact SD-CB 3.87Å; M56-V61 HydrophobicContact SD-CG1 3.86Å; M56-V61 HydrophobicContact SD-CG2 4.26Å; A59-V61 HydrophobicContact CB-CG2 3.84Å; A59-V61 PolarHBondContact O-N 2.97Å; V61-E63 PolarHBondContact O-N 3.34Å
62	E	70.9	Confident	75.5	Confident	171 Å²	171	114.9 Å²	114.9	80%	0.799	65%	0.646	S	S	*	*			trans	-61.9	131.4	161.2	-69.5	175.5	175	0	0	107.2	G60 L64	G60-E62 PolarHBondContact O-N 3.37Å; G60-E62 VanDerWaalsContact O-N 3.12Å; E62-L64 PolarHBondContact O-N 3.32Å
63	E	63.8	Low	73.6	Confident	181 Å²	181	115.7 Å²	115.7	85%	0.846	66%	0.655	S	S	*	*			trans	-51.6	101.3	177.2	-169.2	171.6	-163.9	0	0	108.1	V61 E65	V61-E63 PolarHBondContact O-N 3.34Å; E63-E65 VanDerWaalsContact C-N 3.3Å; E63-E65 PolarHBondContact O-N 2.93Å
64	L	61.1	Low	71.7	Confident	160 Å²	160	121.3 Å²	121.3	84%	0.838	67%	0.673	S	S	*	*			trans	-65.3	103.4	171.1	-70.8	179.1	0	0	0	104.4	E62 G66	E62-L64 PolarHBondContact O-N 3.32Å; L64-G66 PolarHBondContact O-N 3.45Å
65	E	59.8	Low	69.8	Low	179 Å²	179	127.4 Å²	127.4	84%	0.836	70%	0.696	S	S	*	*			trans	-58	74.3	166.8	-67.4	-176.4	153.5	0	0	107.9	E63 E67	E63-E65 VanDerWaalsContact C-N 3.3Å; E63-E65 PolarHBondContact O-N 2.93Å; E65-E67 PolarHBondContact O-N 3.06Å
66	G	57.4	Low	67.9	Low	66 Å²	66	131.7 Å²	131.7	68%	0.68	74%	0.735	S	S	*	*			trans	-74.5	80.2	174.1	0	0	0	0	0	106.3	L64 N68	L64-G66 PolarHBondContact O-N 3.45Å; G66-N68 PolarHBondContact O-N 3.12Å
67	E	56	Low	66.7	Low	145 Å²	145	134.2 Å²	134.2	68%	0.678	75%	0.751	S	S	*	*			trans	-37.3	104.7	167.1	-71.9	-175.7	104.6	0	0	108.1	E65 K69	E65-E67 PolarHBondContact O-N 3.06Å; E67-K69 HydrophobicContact CB-CG 4.03Å; E67-K69 VanDerWaalsContact CD-CE 3.46Å; E67-K69 PolarHBondContact O-N 3.29Å; E67-K69 WeakPolarHBondContact OE1-CE 3.25Å; E67-K69 IonicContact OE1-NZ 3.53Å; E67-K69 WeakPolarHBondContact OE2-CE 3.24Å; E67-K69 IonicContact OE2-NZ 3.92Å
68	N	57.5	Low	65.4	Low	148 Å²	148	135.4 Å²	135.4	79%	0.791	76%	0.755	S	S	*	*			trans	-71.3	73.4	170.5	-147.6	-48.4	0	0	0	105.9	G66 I70	G66-N68 PolarHBondContact O-N 3.12Å; N68-I70 PolarHBondContact O-N 3.17Å
69	K	61.8	Low	64	Low	154 Å²	154	134.2 Å²	134.2	67%	0.67	76%	0.756	S	S	*	*			trans	-72.3	84.3	168.5	-65.6	-148.2	-177.2	-172.4	0	105.9	E67 P71	E67-K69 HydrophobicContact CB-CG 4.03Å; E67-K69 VanDerWaalsContact CD-CE 3.46Å; E67-K69 PolarHBondContact O-N 3.29Å; E67-K69 WeakPolarHBondContact OE1-CE 3.25Å; E67-K69 IonicContact OE1-NZ 3.53Å; E67-K69 WeakPolarHBondContact OE2-CE 3.24Å; E67-K69 IonicContact OE2-NZ 3.92Å; K69-P71 VanDerWaalsContact O-CD 3.26Å; K69-P71 WeakPolarHBondContact O-CD 3.45Å; K69-P71 VanDerWaalsContact O-N 3.11Å
70	I	63	Low	62.4	Low	131 Å²	131	138.1 Å²	138.1	67%	0.672	77%	0.767	S	S	*	*			trans	-46.6	119.6	163.5	-48.1	172.5	0	0	0	105.5	N68 A72	N68-I70 PolarHBondContact O-N 3.17Å; I70-A72 PolarHBondContact O-N 3.37Å
71	P	63.9	Low	60.9	Low	117 Å²	117	143 Å²	143	76%	0.76	78%	0.777	S	S	*	*			trans	-71.3	74.9	172.4	26.5	-29.4	0	0	0	108	K69 T73	K69-P71 VanDerWaalsContact O-CD 3.26Å; K69-P71 WeakPolarHBondContact O-CD 3.45Å; K69-P71 VanDerWaalsContact O-N 3.11Å; P71-T73 VanDerWaalsContact C-N 3.3Å; P71-T73 PolarHBondContact O-N 3.49Å; P71-T73 VanDerWaalsContact O-N 3.12Å
72	A	61.1	Low	59.8	Low	82 Å²	82	147.5 Å²	147.5	68%	0.678	80%	0.798	S	S	*	*			trans	-76.1	88.8	164.2	0	0	0	0	0	106.3	I70	I70-A72 PolarHBondContact O-N 3.37Å
73	T	57.7	Low	59	Low	116 Å²	116	145.9 Å²	145.9	71%	0.712	80%	0.798	S	S	*	*			trans	172.3	140.8	158.7	34.6	0	0	0	0	108.6	P71	P71-T73 VanDerWaalsContact C-N 3.3Å; P71-T73 PolarHBondContact O-N 3.49Å; P71-T73 VanDerWaalsContact O-N 3.12Å
74	Q	53	Low	58.6	Low	170 Å²	170	143.2 Å²	143.2	79%	0.794	79%	0.794	S	S	*	*			cis	-172.9	124.8	-7.8	175.7	165.7	-26	0	0	104.2
75	K	54.4	Low	58.4	Low	200 Å²	200	141.8 Å²	141.8	87%	0.87	79%	0.791	S	S	*	*			trans	2.5	130.9	152.5	-76.7	171.9	167	178.3	0	117.4
76	S	55.2	Low	58.3	Low	193 Å²	193	138.4 Å²	138.4	100%	1.35	79%	0.787	S	S	*	*			trans	107	0	140	-153.2	0	0	0	0	117.4

Retrieved 76 of 76 residues in 34.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).