A0A096NGY5_PAPAN Loading...

Membrane magnesium transporter

Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. May be involved in Mg(2+) transport.

AlphaFold DB (A0A2K6C6B4), UniProt , Accession A0A096NGY5, Species PAPAN (Papio anubis, Olive baboon), Gene MMGT1, Length 131 aa.

						>A0A096NGY5_PAPAN|A0A096NGY5|MMGT1
MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTTNSSNQDALSSNTSLKLRKLESLRR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.8	Low	84.3	Confident	232 Å²	232	84.5 Å²	84.5	100%	1.143	49%	0.489	S	S	*	.				0	101.8	0	-171.7	122.6	110.4	0	0	106.5
2	A	58.3	Low	85.3	Confident	40 Å²	40	87.1 Å²	87.1	33%	0.331	50%	0.497	S	S	.	.			trans	-57.7	131.9	-179	0	0	0	0	0	108.9	S4 H62	A2-S4 PolarHBondContact O-N 3.35Å; A2-H62 WeakPolarHBondContact CB-O 3.48Å
3	P	74.4	Confident	86.2	Confident	70 Å²	70	80.6 Å²	80.6	46%	0.455	46%	0.461	S	S	.	.			trans	-56.3	140.2	-179.7	20.6	-30.9	0	0	0	109.7	L5 W6	P3-L5 HydrophobicContact CB-CB 4.48Å; P3-L5 PolarHBondContact O-N 3.13Å; P3-W6 VanDerWaalsContact CD-CD1 3.44Å; P3-W6 VanDerWaalsContact CG-CD1 3.47Å; P3-W6 VanDerWaalsContact CG-NE1 3.32Å; P3-W6 PolarHBondContact O-N 2.99Å
4	S	83.1	Confident	87	Confident	98 Å²	98	81.6 Å²	81.6	69%	0.685	46%	0.464	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.7	-20.1	-179.4	52.8	0	0	0	0	113.4	A2 W6 K7 G8	A2-S4 PolarHBondContact O-N 3.35Å; S4-W6 VanDerWaalsContact C-N 3.3Å; S4-W6 PolarHBondContact O-N 3.44Å; S4-K7 WeakPolarHBondContact O-CB 3.4Å; S4-K7 PolarHBondContact O-N 3.37Å; S4-G8 PolarHBondContact O-N 2.85Å
5	L	90.4	Very high	87.8	Confident	131 Å²	131	86.3 Å²	86.3	69%	0.686	48%	0.477	S	S	*	.	H	α-helix	trans	-54	-39.1	173.6	-60.5	175.3	0	0	0	113.4	P3 K7 G8 L9	P3-L5 HydrophobicContact CB-CB 4.48Å; P3-L5 PolarHBondContact O-N 3.13Å; L5-K7 VanDerWaalsContact C-N 3.3Å; L5-K7 PolarHBondContact O-N 3.31Å; L5-G8 WeakPolarHBondContact O-CA 3.46Å; L5-G8 PolarHBondContact O-N 3.04Å; L5-G8 VanDerWaalsContact O-N 3.13Å; L5-L9 PolarHBondContact O-N 2.93Å
6	W	92.8	Very high	88.4	Confident	60 Å²	60	82.5 Å²	82.5	23%	0.227	46%	0.461	C	S	.	.	H	α-helix	trans	-64.4	-36.7	-179.9	-63.9	118.1	0	0	0	112.3	P3 S4 G8 L9 V10 Y58 H62 I63	P3-W6 VanDerWaalsContact CD-CD1 3.44Å; P3-W6 VanDerWaalsContact CG-CD1 3.47Å; P3-W6 VanDerWaalsContact CG-NE1 3.32Å; P3-W6 PolarHBondContact O-N 2.99Å; S4-W6 VanDerWaalsContact C-N 3.3Å; S4-W6 PolarHBondContact O-N 3.44Å; W6-G8 VanDerWaalsContact C-N 3.33Å; W6-L9 HydrophobicContact CE3-CD2 3.72Å; W6-L9 HydrophobicContact CZ3-CD2 3.71Å; W6-L9 WeakPolarHBondContact O-CB 3.3Å; W6-L9 PolarHBondContact O-N 2.84Å; W6-V10 WeakPolarHBondContact O-CG2 2.95Å; W6-V10 PolarHBondContact O-N 3.48Å; W6-Y58 AromaticContact CH2-CE1 3.69Å; W6-Y58 HydrophobicContact CH2-CE1 3.69Å; W6-Y58 AromaticContact CZ3-CD1 3.93Å; W6-Y58 HydrophobicContact CZ3-CD1 3.93Å; W6-Y58 AromaticContact CZ3-CE1 3.51Å; W6-Y58 HydrophobicContact CZ3-CE1 3.51Å; W6-H62 HydrophobicContact CD2-CB 3.79Å; W6-H62 HydrophobicContact CE3-CB 4.2Å; W6-H62 HydrophobicContact CG-CB 3.96Å; W6-H62 AromaticContact CZ2-CD2 3.83Å; W6-I63 HydrophobicContact CB-CD1 4.3Å; W6-I63 HydrophobicContact CB-CG1 3.78Å
7	K	92.9	Very high	88.9	Confident	145 Å²	145	81 Å²	81	63%	0.63	45%	0.451	S	S	*	.	H	α-helix	trans	-64.9	-40.1	175	-61.1	-177.3	176.7	-172.9	0	111.1	S4 L5 G11 I63	S4-K7 WeakPolarHBondContact O-CB 3.4Å; S4-K7 PolarHBondContact O-N 3.37Å; L5-K7 VanDerWaalsContact C-N 3.3Å; L5-K7 PolarHBondContact O-N 3.31Å; K7-G11 PolarHBondContact O-N 3.34Å; K7-I63 HydrophobicContact CB-CD1 4.45Å; K7-I63 HydrophobicContact CG-CD1 3.98Å; K7-I63 HydrophobicContact CG-CG1 4.28Å
8	G	94.3	Very high	89.4	Confident	40 Å²	40	79.9 Å²	79.9	41%	0.412	45%	0.454	S	S	.	.	H	α-helix	trans	-62	-44.1	172.2	0	0	0	0	0	112.3	S4 L5 W6 V10 G11 I12	S4-G8 PolarHBondContact O-N 2.85Å; L5-G8 WeakPolarHBondContact O-CA 3.46Å; L5-G8 PolarHBondContact O-N 3.04Å; L5-G8 VanDerWaalsContact O-N 3.13Å; W6-G8 VanDerWaalsContact C-N 3.33Å; G8-V10 PolarHBondContact O-N 3.26Å; G8-G11 PolarHBondContact O-N 2.7Å; G8-G11 VanDerWaalsContact O-N 3.14Å; G8-I12 WeakPolarHBondContact O-CG1 3.46Å; G8-I12 PolarHBondContact O-N 3.41Å
9	L	95.3	Very high	89.8	Confident	56 Å²	56	80.4 Å²	80.4	29%	0.293	45%	0.452	S	S	.	.	H	α-helix	trans	-60.3	-44.3	177.9	-173	66.8	0	0	0	112.1	L5 W6 G11 I12 G13 V55	L5-L9 PolarHBondContact O-N 2.93Å; W6-L9 HydrophobicContact CE3-CD2 3.72Å; W6-L9 HydrophobicContact CZ3-CD2 3.71Å; W6-L9 WeakPolarHBondContact O-CB 3.3Å; W6-L9 PolarHBondContact O-N 2.84Å; L9-G11 VanDerWaalsContact C-N 3.34Å; L9-I12 PolarHBondContact O-N 2.92Å; L9-G13 PolarHBondContact O-N 3.23Å; L9-V55 HydrophobicContact CD1-CG1 3.73Å; L9-V55 HydrophobicContact CD2-CG1 4.29Å; L9-V55 HydrophobicContact CG-CG1 3.82Å
10	V	96.2	Very high	90.2	Very high	18 Å²	18	76.4 Å²	76.4	11%	0.109	43%	0.43	C	S	.	.	H	α-helix	trans	-63.4	-40.7	174.6	171.7	0	0	0	0	111.3	W6 G8 I12 G13 L14 T56 G59 I60 I63	W6-V10 WeakPolarHBondContact O-CG2 2.95Å; W6-V10 PolarHBondContact O-N 3.48Å; G8-V10 PolarHBondContact O-N 3.26Å; V10-I12 PolarHBondContact O-N 3.39Å; V10-G13 PolarHBondContact O-N 3.46Å; V10-L14 HydrophobicContact CG1-CD1 4.09Å; V10-L14 HydrophobicContact CG1-CG 4.37Å; V10-L14 WeakPolarHBondContact O-CG 3.38Å; V10-L14 PolarHBondContact O-N 2.95Å; V10-T56 HydrophobicContact CG1-CG2 4.29Å; V10-G59 VanDerWaalsContact CG2-C 3.45Å; V10-I60 HydrophobicContact CG1-CG1 4.12Å; V10-I60 HydrophobicContact CG2-CG1 3.95Å; V10-I63 HydrophobicContact CB-CD1 4.17Å; V10-I63 HydrophobicContact CG2-CD1 3.56Å
11	G	96.6	Very high	90.5	Very high	39 Å²	39	75.4 Å²	75.4	40%	0.402	43%	0.431	S	S	.	.	H	α-helix	trans	-59.1	-45.5	174.9	0	0	0	0	0	112.9	K7 G8 L9 L14 F15	K7-G11 PolarHBondContact O-N 3.34Å; G8-G11 PolarHBondContact O-N 2.7Å; G8-G11 VanDerWaalsContact O-N 3.14Å; L9-G11 VanDerWaalsContact C-N 3.34Å; G11-L14 PolarHBondContact O-N 3.41Å; G11-F15 WeakPolarHBondContact O-CB 3.29Å; G11-F15 PolarHBondContact O-N 3.32Å
12	I	96.5	Very high	92.6	Very high	116 Å²	116	70.3 Å²	70.3	60%	0.595	40%	0.403	S	S	*	.	H	α-helix	trans	-64.5	-42.7	176.4	-65.7	167.8	0	0	0	110.8	G8 L9 V10 F15 A16	G8-I12 WeakPolarHBondContact O-CG1 3.46Å; G8-I12 PolarHBondContact O-N 3.41Å; L9-I12 PolarHBondContact O-N 2.92Å; V10-I12 PolarHBondContact O-N 3.39Å; I12-F15 PolarHBondContact O-N 2.95Å; I12-A16 WeakPolarHBondContact O-CB 3.26Å; I12-A16 PolarHBondContact O-N 3.05Å
13	G	96.9	Very high	94.4	Very high	3 Å²	3	69.7 Å²	69.7	3%	0.031	40%	0.396	C	S	.	.	H	α-helix	trans	-59.7	-45.8	176.8	0	0	0	0	0	112.7	L9 V10 A16 L17 T56	L9-G13 PolarHBondContact O-N 3.23Å; V10-G13 PolarHBondContact O-N 3.46Å; G13-A16 PolarHBondContact O-N 3.18Å; G13-L17 WeakPolarHBondContact O-CB 3.36Å; G13-L17 PolarHBondContact O-N 3.25Å; G13-T56 VanDerWaalsContact C-OG1 3.29Å; G13-T56 WeakPolarHBondContact CA-OG1 3.41Å
14	L	97.7	Very high	95.4	Very high	95 Å²	95	67.6 Å²	67.6	50%	0.497	39%	0.385	S	S	.	.	H	α-helix	trans	-64.9	-39.8	176.1	-70.6	174.8	0	0	0	112.5	V10 G11 L17 A18 T56	V10-L14 HydrophobicContact CG1-CD1 4.09Å; V10-L14 HydrophobicContact CG1-CG 4.37Å; V10-L14 WeakPolarHBondContact O-CG 3.38Å; V10-L14 PolarHBondContact O-N 2.95Å; G11-L14 PolarHBondContact O-N 3.41Å; L14-L17 PolarHBondContact O-N 3.41Å; L14-A18 WeakPolarHBondContact O-CB 3.11Å; L14-A18 PolarHBondContact O-N 3.2Å; L14-T56 HydrophobicContact CD2-CG2 3.98Å; L14-T56 HydrophobicContact CG-CG2 4.2Å
15	F	98.1	Very high	96	Very high	151 Å²	151	65.8 Å²	65.8	66%	0.662	38%	0.375	S	S	*	.	H	α-helix	trans	-63	-45.8	174.9	177.1	-98.3	0	0	0	111.7	G11 I12 L17 A18 H19	G11-F15 WeakPolarHBondContact O-CB 3.29Å; G11-F15 PolarHBondContact O-N 3.32Å; I12-F15 PolarHBondContact O-N 2.95Å; F15-L17 VanDerWaalsContact C-N 3.29Å; F15-L17 PolarHBondContact O-N 3.44Å; F15-A18 PolarHBondContact O-N 3.3Å; F15-H19 WeakPolarHBondContact O-CB 3.43Å; F15-H19 PolarHBondContact O-N 3.24Å
16	A	97.3	Very high	96.2	Very high	26 Å²	26	64.6 Å²	64.6	22%	0.215	37%	0.366	C	S	.	.	H	α-helix	trans	-62.6	-36.7	176.2	0	0	0	0	0	112.2	I12 G13 H19 A20 A52	I12-A16 WeakPolarHBondContact O-CB 3.26Å; I12-A16 PolarHBondContact O-N 3.05Å; G13-A16 PolarHBondContact O-N 3.18Å; A16-H19 PolarHBondContact O-N 3.32Å; A16-A20 WeakPolarHBondContact O-CB 3.37Å; A16-A20 PolarHBondContact O-N 2.84Å; A16-A52 HydrophobicContact CB-CB 3.88Å
17	L	97.4	Very high	96.2	Very high	57 Å²	57	63.4 Å²	63.4	30%	0.298	36%	0.363	S	S	.	.	H	α-helix	trans	-67.3	-42.6	176.1	-156.2	73	0	0	0	111.7	G13 L14 F15 A20 A21 T49 A52 F53	G13-L17 WeakPolarHBondContact O-CB 3.36Å; G13-L17 PolarHBondContact O-N 3.25Å; L14-L17 PolarHBondContact O-N 3.41Å; F15-L17 VanDerWaalsContact C-N 3.29Å; F15-L17 PolarHBondContact O-N 3.44Å; L17-A20 PolarHBondContact O-N 3.06Å; L17-A21 WeakPolarHBondContact O-CB 3.49Å; L17-A21 PolarHBondContact O-N 3.22Å; L17-T49 HydrophobicContact CD1-CG2 4.44Å; L17-A52 HydrophobicContact CB-CB 4.28Å; L17-A52 HydrophobicContact CD1-CB 3.9Å; L17-F53 HydrophobicContact CD1-CB 4.36Å
18	A	98.1	Very high	96.1	Very high	61 Å²	61	63.9 Å²	63.9	50%	0.504	36%	0.361	S	S	.	.	H	α-helix	trans	-63.5	-41.2	174.6	0	0	0	0	0	111.8	L14 F15 A21 F22	L14-A18 WeakPolarHBondContact O-CB 3.11Å; L14-A18 PolarHBondContact O-N 3.2Å; F15-A18 PolarHBondContact O-N 3.3Å; A18-A21 PolarHBondContact O-N 2.89Å; A18-F22 PolarHBondContact O-N 3.42Å
19	H	97.6	Very high	96	Very high	90 Å²	90	65.7 Å²	65.7	42%	0.417	37%	0.367	S	S	.	.	H	α-helix	trans	-59.3	-49.1	173.9	-177.9	-78.4	0	0	0	111.3	F15 A16 A21 F22 S23 Q48	F15-H19 WeakPolarHBondContact O-CB 3.43Å; F15-H19 PolarHBondContact O-N 3.24Å; A16-H19 PolarHBondContact O-N 3.32Å; H19-A21 VanDerWaalsContact C-N 3.32Å; H19-A21 PolarHBondContact O-N 3.11Å; H19-F22 WeakPolarHBondContact O-CB 3.41Å; H19-F22 PolarHBondContact O-N 3.22Å; H19-S23 PolarHBondContact O-N 2.9Å; H19-S23 PolarHBondContact O-OG 2.97Å; H19-Q48 PolarHBondContact ND1-NE2 2.87Å
20	A	97	Very high	95.8	Very high	0 Å²	0	70 Å²	70	0%	0	38%	0.381	C	S	.	.	H	α-helix	trans	-65.5	-35.1	179.8	0	0	0	0	0	112.5	A16 L17 S23 A24 Q48 T49	A16-A20 WeakPolarHBondContact O-CB 3.37Å; A16-A20 PolarHBondContact O-N 2.84Å; L17-A20 PolarHBondContact O-N 3.06Å; A20-S23 PolarHBondContact O-N 3.46Å; A20-A24 WeakPolarHBondContact O-CB 3.48Å; A20-A24 PolarHBondContact O-N 3.4Å; A20-Q48 HydrophobicContact CB-CB 4.45Å; A20-Q48 HydrophobicContact CB-CG 4.05Å; A20-T49 HydrophobicContact CB-CG2 3.45Å; A20-T49 VanDerWaalsContact CB-CG2 3.45Å
21	A	96.9	Very high	95.6	Very high	55 Å²	55	70.1 Å²	70.1	46%	0.455	38%	0.38	S	S	.	.	H	α-helix	trans	-64.2	-40.7	172.5	0	0	0	0	0	112.2	L17 A18 H19 A24 A25	L17-A21 WeakPolarHBondContact O-CB 3.49Å; L17-A21 PolarHBondContact O-N 3.22Å; A18-A21 PolarHBondContact O-N 2.89Å; H19-A21 VanDerWaalsContact C-N 3.32Å; H19-A21 PolarHBondContact O-N 3.11Å; A21-A24 PolarHBondContact O-N 2.88Å; A21-A25 WeakPolarHBondContact O-CB 3.41Å; A21-A25 PolarHBondContact O-N 2.94Å
22	F	97.3	Very high	95.2	Very high	126 Å²	126	75.6 Å²	75.6	55%	0.553	39%	0.389	S	S	*	.	H	α-helix	trans	-63.6	-45.1	174.2	-177	-102.6	0	0	0	111.6	A18 H19 A24 A25 Q26	A18-F22 PolarHBondContact O-N 3.42Å; H19-F22 WeakPolarHBondContact O-CB 3.41Å; H19-F22 PolarHBondContact O-N 3.22Å; F22-A24 VanDerWaalsContact C-N 3.35Å; F22-A24 PolarHBondContact O-N 3.46Å; F22-A25 PolarHBondContact O-N 3.33Å; F22-Q26 HydrophobicContact CD1-CG 4.31Å; F22-Q26 HydrophobicContact CE1-CG 3.98Å; F22-Q26 HydrophobicContact CZ-CG 4.1Å; F22-Q26 VanDerWaalsContact CZ-NE2 3.25Å; F22-Q26 WeakPolarHBondContact O-CG 3.47Å; F22-Q26 PolarHBondContact O-N 2.95Å
23	S	96	Very high	94.9	Very high	26 Å²	26	77 Å²	77	18%	0.182	40%	0.397	C	S	.	.	H	α-helix	trans	-59.8	-42.4	174.4	-59.7	0	0	0	0	112.3	H19 A20 Q26 H27	H19-S23 PolarHBondContact O-N 2.9Å; H19-S23 PolarHBondContact O-OG 2.97Å; A20-S23 PolarHBondContact O-N 3.46Å; S23-Q26 PolarHBondContact O-N 3.38Å; S23-H27 WeakPolarHBondContact O-CB 3.28Å; S23-H27 PolarHBondContact O-N 3.44Å
24	A	94.9	Very high	94.6	Very high	27 Å²	27	79 Å²	79	22%	0.223	41%	0.409	C	S	.	.	H	α-helix	trans	-64.4	-40	176	0	0	0	0	0	112.3	A20 A21 F22 H27 R28 L41 I45	A20-A24 WeakPolarHBondContact O-CB 3.48Å; A20-A24 PolarHBondContact O-N 3.4Å; A21-A24 PolarHBondContact O-N 2.88Å; F22-A24 VanDerWaalsContact C-N 3.35Å; F22-A24 PolarHBondContact O-N 3.46Å; A24-H27 PolarHBondContact O-N 2.92Å; A24-R28 WeakPolarHBondContact O-CB 3.18Å; A24-R28 PolarHBondContact O-N 2.93Å; A24-L41 HydrophobicContact CB-CD2 4.26Å; A24-I45 HydrophobicContact CB-CG2 4.09Å
25	A	95.2	Very high	93.9	Very high	59 Å²	59	83 Å²	83	49%	0.488	42%	0.424	S	S	.	.	H	α-helix	trans	-65.1	-42.4	176.2	0	0	0	0	0	111.8	A21 F22 R28 S29	A21-A25 WeakPolarHBondContact O-CB 3.41Å; A21-A25 PolarHBondContact O-N 2.94Å; F22-A25 PolarHBondContact O-N 3.33Å; A25-R28 PolarHBondContact O-N 3.36Å; A25-S29 WeakPolarHBondContact O-CB 3.42Å; A25-S29 PolarHBondContact O-N 3.41Å
26	Q	95.1	Very high	93.1	Very high	107 Å²	107	81.5 Å²	81.5	50%	0.5	42%	0.418	S	S	.	.	H	α-helix	trans	-62.5	-46.3	174.1	-73.9	-173.9	-36	0	0	111.8	F22 S23 R28 S29 Y30	F22-Q26 HydrophobicContact CD1-CG 4.31Å; F22-Q26 HydrophobicContact CE1-CG 3.98Å; F22-Q26 HydrophobicContact CZ-CG 4.1Å; F22-Q26 VanDerWaalsContact CZ-NE2 3.25Å; F22-Q26 WeakPolarHBondContact O-CG 3.47Å; F22-Q26 PolarHBondContact O-N 2.95Å; S23-Q26 PolarHBondContact O-N 3.38Å; Q26-R28 VanDerWaalsContact C-N 3.32Å; Q26-R28 PolarHBondContact O-N 3.17Å; Q26-S29 WeakPolarHBondContact O-CB 3.42Å; Q26-S29 PolarHBondContact O-N 3.4Å; Q26-S29 VanDerWaalsContact O-N 3.15Å; Q26-Y30 WeakPolarHBondContact O-CB 3.41Å; Q26-Y30 PolarHBondContact O-N 2.94Å
27	H	92.7	Very high	91.9	Very high	35 Å²	35	86.9 Å²	86.9	16%	0.162	44%	0.439	C	S	.	.	H	α-helix	trans	-56.9	-46.5	175.8	-176.1	-94.8	0	0	0	111.4	S23 A24 S29 Y30 M31 P42 I45	S23-H27 WeakPolarHBondContact O-CB 3.28Å; S23-H27 PolarHBondContact O-N 3.44Å; A24-H27 PolarHBondContact O-N 2.92Å; H27-S29 VanDerWaalsContact C-N 3.33Å; H27-S29 PolarHBondContact O-N 3.45Å; H27-Y30 WeakPolarHBondContact O-CB 3.45Å; H27-Y30 PolarHBondContact O-N 2.98Å; H27-M31 PolarHBondContact CE1-SD 3.36Å; H27-M31 PolarHBondContact ND1-SD 3.41Å; H27-M31 WeakPolarHBondContact O-CG 3.31Å; H27-M31 PolarHBondContact O-N 3.39Å; H27-P42 WeakPolarHBondContact NE2-CD 3.44Å; H27-I45 HydrophobicContact CB-CD1 4.41Å
28	R	91.3	Very high	90.4	Very high	155 Å²	155	92.1 Å²	92.1	59%	0.585	47%	0.467	S	S	*	.	H	α-helix	trans	-63.6	-37.2	177.3	-170.5	174.1	-172.7	124.7	6.2	112.8	A24 A25 Q26 R32	A24-R28 WeakPolarHBondContact O-CB 3.18Å; A24-R28 PolarHBondContact O-N 2.93Å; A25-R28 PolarHBondContact O-N 3.36Å; Q26-R28 VanDerWaalsContact C-N 3.32Å; Q26-R28 PolarHBondContact O-N 3.17Å; R28-R32 VanDerWaalsContact O-CG 3.31Å; R28-R32 WeakPolarHBondContact O-CG 3.41Å; R28-R32 PolarHBondContact O-N 2.91Å
29	S	92.4	Very high	89.5	Confident	78 Å²	78	94.8 Å²	94.8	55%	0.545	47%	0.469	S	S	.	.	H	α-helix	trans	-65.4	-42.2	174.6	-164.7	0	0	0	0	111.4	A25 Q26 H27 R32 L33	A25-S29 WeakPolarHBondContact O-CB 3.42Å; A25-S29 PolarHBondContact O-N 3.41Å; Q26-S29 WeakPolarHBondContact O-CB 3.42Å; Q26-S29 PolarHBondContact O-N 3.4Å; Q26-S29 VanDerWaalsContact O-N 3.15Å; H27-S29 VanDerWaalsContact C-N 3.33Å; H27-S29 PolarHBondContact O-N 3.45Å; S29-R32 PolarHBondContact O-N 3.22Å; S29-L33 PolarHBondContact O-N 2.95Å; S29-L33 VanDerWaalsContact O-N 3.11Å
30	Y	91.2	Very high	88.9	Confident	145 Å²	145	95.3 Å²	95.3	57%	0.569	48%	0.483	S	S	*	.	H	α-helix	trans	-63.9	-44.7	177.8	177.9	-99	0	0	0	112.7	Q26 H27 R32 L33 T34	Q26-Y30 WeakPolarHBondContact O-CB 3.41Å; Q26-Y30 PolarHBondContact O-N 2.94Å; H27-Y30 WeakPolarHBondContact O-CB 3.45Å; H27-Y30 PolarHBondContact O-N 2.98Å; Y30-R32 VanDerWaalsContact C-N 3.34Å; Y30-R32 PolarHBondContact O-N 3.15Å; Y30-L33 PolarHBondContact O-N 3.44Å; Y30-T34 HydrophobicContact CD2-CG2 4.29Å; Y30-T34 HydrophobicContact CE1-CG2 4.14Å; Y30-T34 HydrophobicContact CE2-CG2 3.86Å; Y30-T34 WeakPolarHBondContact O-CG2 3.48Å; Y30-T34 PolarHBondContact O-N 2.9Å; Y30-T34 PolarHBondContact O-OG1 3.41Å
31	M	90.4	Very high	88.5	Confident	21 Å²	21	99 Å²	99	10%	0.103	50%	0.502	C	S	.	.	H	α-helix	trans	-60	-43.4	176.2	-71.6	177.1	73.3	0	0	112.4	H27 L33 T34 E35 K36 E37 E39	H27-M31 PolarHBondContact CE1-SD 3.36Å; H27-M31 PolarHBondContact ND1-SD 3.41Å; H27-M31 WeakPolarHBondContact O-CG 3.31Å; H27-M31 PolarHBondContact O-N 3.39Å; M31-L33 VanDerWaalsContact C-N 3.31Å; M31-L33 PolarHBondContact O-N 3.39Å; M31-T34 PolarHBondContact O-N 3.39Å; M31-T34 PolarHBondContact O-OG1 3.44Å; M31-E35 PolarHBondContact O-N 2.93Å; M31-K36 WeakPolarHBondContact CE-O 3.44Å; M31-K36 PolarHBondContact O-N 3.06Å; M31-E37 VanDerWaalsContact CE-O 3.29Å; M31-E37 WeakPolarHBondContact CE-O 3.47Å; M31-E39 HydrophobicContact CE-CB 3.95Å; M31-E39 WeakPolarHBondContact CE-O 3.44Å
32	R	89.6	Confident	88.3	Confident	155 Å²	155	98.7 Å²	98.7	59%	0.585	50%	0.495	S	S	*	.	H	α-helix	trans	-61.7	-38.3	176.6	-74.8	171.4	172.1	171.2	-3.7	112.4	R28 S29 Y30	R28-R32 VanDerWaalsContact O-CG 3.31Å; R28-R32 WeakPolarHBondContact O-CG 3.41Å; R28-R32 PolarHBondContact O-N 2.91Å; S29-R32 PolarHBondContact O-N 3.22Å; Y30-R32 VanDerWaalsContact C-N 3.34Å; Y30-R32 PolarHBondContact O-N 3.15Å
33	L	90.8	Very high	88.1	Confident	146 Å²	146	99.6 Å²	99.6	76%	0.764	51%	0.505	S	S	*	.	H	α-helix	trans	-73.8	-28.9	-179.6	-171.3	65.7	0	0	0	112.7	S29 Y30 M31	S29-L33 PolarHBondContact O-N 2.95Å; S29-L33 VanDerWaalsContact O-N 3.11Å; Y30-L33 PolarHBondContact O-N 3.44Å; M31-L33 VanDerWaalsContact C-N 3.31Å; M31-L33 PolarHBondContact O-N 3.39Å
34	T	89	Confident	88.1	Confident	45 Å²	45	103.9 Å²	103.9	28%	0.276	53%	0.526	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.5	3.6	-175.6	53.7	0	0	0	0	113.7	Y30 M31 K36	Y30-T34 HydrophobicContact CD2-CG2 4.29Å; Y30-T34 HydrophobicContact CE1-CG2 4.14Å; Y30-T34 HydrophobicContact CE2-CG2 3.86Å; Y30-T34 WeakPolarHBondContact O-CG2 3.48Å; Y30-T34 PolarHBondContact O-N 2.9Å; Y30-T34 PolarHBondContact O-OG1 3.41Å; M31-T34 PolarHBondContact O-N 3.39Å; M31-T34 PolarHBondContact O-OG1 3.44Å; T34-K36 PolarHBondContact O-N 2.93Å
35	E	84.6	Confident	88.1	Confident	177 Å²	177	103.5 Å²	103.5	83%	0.827	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.8	20.3	-176.2	-62.1	-180	167	0	0	113.7	M31 E37	M31-E35 PolarHBondContact O-N 2.93Å; E35-E37 PolarHBondContact O-N 3.27Å
36	K	79.8	Confident	88.1	Confident	120 Å²	120	103.5 Å²	103.5	52%	0.522	51%	0.513	S	S	.	.			trans	-96.8	68.9	174.6	-68.4	-164.9	175.9	67.5	0	109.8	M31 T34 D38	M31-K36 WeakPolarHBondContact CE-O 3.44Å; M31-K36 PolarHBondContact O-N 3.06Å; T34-K36 PolarHBondContact O-N 2.93Å; K36-D38 VanDerWaalsContact C-N 3.26Å; K36-D38 PolarHBondContact O-N 3.43Å
37	E	71.9	Confident	88.2	Confident	140 Å²	140	103 Å²	103	65%	0.654	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.2	-14.2	-175.2	-61	-157.1	149.4	0	0	114.1	M31 E35	M31-E37 VanDerWaalsContact CE-O 3.29Å; M31-E37 WeakPolarHBondContact CE-O 3.47Å; E35-E37 PolarHBondContact O-N 3.27Å
38	D	66.1	Low	88.4	Confident	166 Å²	166	104 Å²	104	89%	0.888	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.1	-2	-172.3	-61.6	-39.7	0	0	0	114.9	K36	K36-D38 VanDerWaalsContact C-N 3.26Å; K36-D38 PolarHBondContact O-N 3.43Å
39	E	79.8	Confident	88.7	Confident	117 Å²	117	98.8 Å²	98.8	55%	0.547	50%	0.504	S	S	.	.	P	Polyproline II helix	trans	-79.1	128.2	-178.3	-120.9	177.3	175.9	0	0	112.2	M31	M31-E39 HydrophobicContact CE-CB 3.95Å; M31-E39 WeakPolarHBondContact CE-O 3.44Å
40	S	85.6	Confident	89	Confident	102 Å²	102	100 Å²	100	71%	0.713	50%	0.504	S	S	*	.	P	Polyproline II helix	trans	-66.9	157.4	176.4	59.1	0	0	0	0	112.1
41	L	88.1	Confident	89.3	Confident	76 Å²	76	98 Å²	98	40%	0.398	50%	0.502	S	S	.	.	P	Polyproline II helix	trans	-59.3	139.7	174.7	-123.8	75.3	0	0	0	111.4	A24 I43 I45 V46	A24-L41 HydrophobicContact CB-CD2 4.26Å; L41-I43 PolarHBondContact O-N 3.44Å; L41-I45 HydrophobicContact CD2-CG2 4.06Å; L41-V46 HydrophobicContact CB-CG2 4.23Å
42	P	92.4	Very high	89.6	Confident	49 Å²	49	97.4 Å²	97.4	32%	0.318	50%	0.501	S	S	.	.	P	Polyproline II helix	trans	-56.4	133.1	175.1	-24.8	32.9	0	0	0	111	H27 D44 I45 V46	H27-P42 WeakPolarHBondContact NE2-CD 3.44Å; P42-D44 PolarHBondContact O-N 3.17Å; P42-D44 VanDerWaalsContact O-N 3.13Å; P42-I45 HydrophobicContact CB-CD1 4.42Å; P42-I45 HydrophobicContact CB-CG1 4.36Å; P42-I45 HydrophobicContact CG-CD1 4.13Å; P42-I45 PolarHBondContact O-N 3.4Å; P42-V46 PolarHBondContact O-N 3.29Å
43	I	93.9	Very high	90	Very high	146 Å²	146	95.9 Å²	95.9	75%	0.749	50%	0.498	S	S	*	.	H	α-helix	trans	-57.2	-31.3	-178	-67.4	156.6	0	0	0	111.6	L41 V46 L47	L41-I43 PolarHBondContact O-N 3.44Å; I43-V46 PolarHBondContact O-N 3.48Å; I43-L47 WeakPolarHBondContact O-CB 3.49Å; I43-L47 PolarHBondContact O-N 2.91Å
44	D	94.8	Very high	90.3	Very high	116 Å²	116	91.6 Å²	91.6	62%	0.62	48%	0.484	S	S	*	.	H	α-helix	trans	-59.6	-46.9	175.9	-174.8	30.8	0	0	0	112.4	P42 V46 L47 Q48	P42-D44 PolarHBondContact O-N 3.17Å; P42-D44 VanDerWaalsContact O-N 3.13Å; D44-V46 VanDerWaalsContact C-N 3.31Å; D44-V46 PolarHBondContact O-N 3.45Å; D44-L47 PolarHBondContact O-N 3.04Å; D44-Q48 WeakPolarHBondContact O-CB 3.24Å; D44-Q48 PolarHBondContact O-N 3.13Å
45	I	95.3	Very high	90.7	Very high	18 Å²	18	92.2 Å²	92.2	9%	0.092	49%	0.488	C	S	.	.	H	α-helix	trans	-64.1	-39.5	178.1	-59.8	179.2	0	0	0	110.6	A24 H27 L41 P42 T49	A24-I45 HydrophobicContact CB-CG2 4.09Å; H27-I45 HydrophobicContact CB-CD1 4.41Å; L41-I45 HydrophobicContact CD2-CG2 4.06Å; P42-I45 HydrophobicContact CB-CD1 4.42Å; P42-I45 HydrophobicContact CB-CG1 4.36Å; P42-I45 HydrophobicContact CG-CD1 4.13Å; P42-I45 PolarHBondContact O-N 3.4Å; I45-T49 WeakPolarHBondContact O-CB 3.5Å; I45-T49 PolarHBondContact O-N 2.84Å; I45-T49 PolarHBondContact O-OG1 2.93Å
46	V	96.4	Very high	91.3	Very high	60 Å²	60	84.2 Å²	84.2	36%	0.364	45%	0.451	S	S	.	.	H	α-helix	trans	-65	-45.6	177.2	179.7	0	0	0	0	110.6	L41 P42 I43 D44 T49 L50	L41-V46 HydrophobicContact CB-CG2 4.23Å; P42-V46 PolarHBondContact O-N 3.29Å; I43-V46 PolarHBondContact O-N 3.48Å; D44-V46 VanDerWaalsContact C-N 3.31Å; D44-V46 PolarHBondContact O-N 3.45Å; V46-T49 WeakPolarHBondContact CA-OG1 3.31Å; V46-T49 PolarHBondContact O-N 2.66Å; V46-T49 PolarHBondContact O-OG1 2.93Å; V46-L50 HydrophobicContact CG1-CD1 4.05Å; V46-L50 HydrophobicContact CG1-CG 4.5Å; V46-L50 WeakPolarHBondContact O-CB 3.32Å; V46-L50 VanDerWaalsContact O-CG 3.3Å; V46-L50 WeakPolarHBondContact O-CG 3.39Å; V46-L50 PolarHBondContact O-N 2.99Å
47	L	96.6	Very high	92.1	Very high	97 Å²	97	81 Å²	81	51%	0.508	44%	0.442	S	S	.	.	H	α-helix	trans	-66.6	-43.1	179.1	-168.7	66.1	0	0	0	111.2	I43 D44 T49 L50 L51	I43-L47 WeakPolarHBondContact O-CB 3.49Å; I43-L47 PolarHBondContact O-N 2.91Å; D44-L47 PolarHBondContact O-N 3.04Å; L47-T49 PolarHBondContact O-N 3.36Å; L47-L50 PolarHBondContact O-N 2.98Å; L47-L51 HydrophobicContact CD1-CD1 4.43Å; L47-L51 HydrophobicContact CD1-CG 4.46Å; L47-L51 HydrophobicContact CG-CD1 4Å; L47-L51 HydrophobicContact CG-CG 4.4Å; L47-L51 WeakPolarHBondContact O-CB 3.27Å; L47-L51 VanDerWaalsContact O-CG 3.26Å; L47-L51 WeakPolarHBondContact O-CG 3.32Å; L47-L51 PolarHBondContact O-N 3.38Å
48	Q	96.9	Very high	93.2	Very high	55 Å²	55	80.4 Å²	80.4	26%	0.257	44%	0.435	S	S	.	.	H	α-helix	trans	-60.6	-44.6	176.3	-176.1	175.4	-9	0	0	111.7	H19 A20 D44 A52	H19-Q48 PolarHBondContact ND1-NE2 2.87Å; A20-Q48 HydrophobicContact CB-CB 4.45Å; A20-Q48 HydrophobicContact CB-CG 4.05Å; D44-Q48 WeakPolarHBondContact O-CB 3.24Å; D44-Q48 PolarHBondContact O-N 3.13Å; Q48-A52 WeakPolarHBondContact O-CB 3.41Å; Q48-A52 PolarHBondContact O-N 2.92Å
49	T	97.7	Very high	94.6	Very high	45 Å²	45	72.5 Å²	72.5	28%	0.276	39%	0.393	S	S	.	.	H	α-helix	trans	-64.1	-45.7	177	35	0	0	0	0	112.1	L17 A20 I45 V46 L47 A52 F53	L17-T49 HydrophobicContact CD1-CG2 4.44Å; A20-T49 HydrophobicContact CB-CG2 3.45Å; A20-T49 VanDerWaalsContact CB-CG2 3.45Å; I45-T49 WeakPolarHBondContact O-CB 3.5Å; I45-T49 PolarHBondContact O-N 2.84Å; I45-T49 PolarHBondContact O-OG1 2.93Å; V46-T49 WeakPolarHBondContact CA-OG1 3.31Å; V46-T49 PolarHBondContact O-N 2.66Å; V46-T49 PolarHBondContact O-OG1 2.93Å; L47-T49 PolarHBondContact O-N 3.36Å; T49-A52 PolarHBondContact O-N 3.46Å; T49-F53 VanDerWaalsContact O-CB 3.24Å; T49-F53 WeakPolarHBondContact O-CB 3.49Å; T49-F53 PolarHBondContact O-N 3.29Å
50	L	98	Very high	95.3	Very high	104 Å²	104	71.1 Å²	71.1	55%	0.545	39%	0.389	S	S	.	.	H	α-helix	trans	-64.2	-42.9	179.6	-71.9	176.2	0	0	0	112.4	V46 L47 F53 A54	V46-L50 HydrophobicContact CG1-CD1 4.05Å; V46-L50 HydrophobicContact CG1-CG 4.5Å; V46-L50 WeakPolarHBondContact O-CB 3.32Å; V46-L50 VanDerWaalsContact O-CG 3.3Å; V46-L50 WeakPolarHBondContact O-CG 3.39Å; V46-L50 PolarHBondContact O-N 2.99Å; L47-L50 PolarHBondContact O-N 2.98Å; L50-F53 PolarHBondContact O-N 3.46Å; L50-A54 WeakPolarHBondContact O-CB 3.48Å; L50-A54 PolarHBondContact O-N 3.03Å
51	L	97.5	Very high	95.7	Very high	104 Å²	104	71.1 Å²	71.1	55%	0.545	38%	0.384	S	S	.	.	H	α-helix	trans	-66.4	-46.1	176.8	-69.8	176.1	0	0	0	111.4	L47 F53 A54 V55	L47-L51 HydrophobicContact CD1-CD1 4.43Å; L47-L51 HydrophobicContact CD1-CG 4.46Å; L47-L51 HydrophobicContact CG-CD1 4Å; L47-L51 HydrophobicContact CG-CG 4.4Å; L47-L51 WeakPolarHBondContact O-CB 3.27Å; L47-L51 VanDerWaalsContact O-CG 3.26Å; L47-L51 WeakPolarHBondContact O-CG 3.32Å; L47-L51 PolarHBondContact O-N 3.38Å; L51-F53 VanDerWaalsContact C-N 3.29Å; L51-F53 PolarHBondContact O-N 3.25Å; L51-A54 PolarHBondContact O-N 3.14Å; L51-V55 WeakPolarHBondContact O-CB 3.36Å; L51-V55 VanDerWaalsContact O-CG2 3.28Å; L51-V55 WeakPolarHBondContact O-CG2 3.46Å; L51-V55 PolarHBondContact O-N 3.35Å
52	A	97.4	Very high	95.9	Very high	8 Å²	8	70.4 Å²	70.4	7%	0.066	38%	0.378	C	S	.	.	H	α-helix	trans	-60.1	-40.9	176.5	0	0	0	0	0	111.7	A16 L17 Q48 T49 T56	A16-A52 HydrophobicContact CB-CB 3.88Å; L17-A52 HydrophobicContact CB-CB 4.28Å; L17-A52 HydrophobicContact CD1-CB 3.9Å; Q48-A52 WeakPolarHBondContact O-CB 3.41Å; Q48-A52 PolarHBondContact O-N 2.92Å; T49-A52 PolarHBondContact O-N 3.46Å; A52-T56 VanDerWaalsContact O-CB 3.32Å; A52-T56 WeakPolarHBondContact O-CB 3.43Å; A52-T56 PolarHBondContact O-N 2.93Å; A52-T56 PolarHBondContact O-OG1 3.36Å
53	F	97.8	Very high	95.9	Very high	123 Å²	123	71 Å²	71	54%	0.539	38%	0.378	S	S	.	.	H	α-helix	trans	-62.5	-51.5	175.5	176	-107.8	0	0	0	111.9	L17 T49 L50 L51 V55 T56 C57	L17-F53 HydrophobicContact CD1-CB 4.36Å; T49-F53 VanDerWaalsContact O-CB 3.24Å; T49-F53 WeakPolarHBondContact O-CB 3.49Å; T49-F53 PolarHBondContact O-N 3.29Å; L50-F53 PolarHBondContact O-N 3.46Å; L51-F53 VanDerWaalsContact C-N 3.29Å; L51-F53 PolarHBondContact O-N 3.25Å; F53-V55 PolarHBondContact O-N 2.91Å; F53-T56 PolarHBondContact O-N 2.9Å; F53-C57 VanDerWaalsContact CE2-SG 3.59Å; F53-C57 VanDerWaalsContact CZ-SG 3.57Å; F53-C57 PolarHBondContact O-N 3.31Å
54	A	97.7	Very high	95.7	Very high	55 Å²	55	68.2 Å²	68.2	46%	0.455	38%	0.377	S	S	.	.	H	α-helix	trans	-59.3	-44.6	179.9	0	0	0	0	0	112.2	L50 L51 T56 C57 Y58	L50-A54 WeakPolarHBondContact O-CB 3.48Å; L50-A54 PolarHBondContact O-N 3.03Å; L51-A54 PolarHBondContact O-N 3.14Å; A54-T56 VanDerWaalsContact C-N 3.34Å; A54-T56 PolarHBondContact O-N 3.48Å; A54-C57 PolarHBondContact O-N 3.35Å; A54-Y58 VanDerWaalsContact O-CB 3.31Å; A54-Y58 WeakPolarHBondContact O-CB 3.35Å; A54-Y58 PolarHBondContact O-N 2.95Å
55	V	96.3	Very high	95.3	Very high	59 Å²	59	65 Å²	65	36%	0.358	37%	0.371	S	S	.	.	H	α-helix	trans	-62.2	-42.5	176.7	170.5	0	0	0	0	111.3	L9 L51 F53 Y58 G59	L9-V55 HydrophobicContact CD1-CG1 3.73Å; L9-V55 HydrophobicContact CD2-CG1 4.29Å; L9-V55 HydrophobicContact CG-CG1 3.82Å; L51-V55 WeakPolarHBondContact O-CB 3.36Å; L51-V55 VanDerWaalsContact O-CG2 3.28Å; L51-V55 WeakPolarHBondContact O-CG2 3.46Å; L51-V55 PolarHBondContact O-N 3.35Å; F53-V55 PolarHBondContact O-N 2.91Å; V55-Y58 PolarHBondContact O-N 3.28Å; V55-G59 PolarHBondContact O-N 3.47Å
56	T	97	Very high	95	Very high	9 Å²	9	71.8 Å²	71.8	6%	0.055	40%	0.402	C	S	.	.	H	α-helix	trans	-64.5	-47.9	179	-56.6	0	0	0	0	111	V10 G13 L14 A52 F53 A54 Y58 G59 I60	V10-T56 HydrophobicContact CG1-CG2 4.29Å; G13-T56 VanDerWaalsContact C-OG1 3.29Å; G13-T56 WeakPolarHBondContact CA-OG1 3.41Å; L14-T56 HydrophobicContact CD2-CG2 3.98Å; L14-T56 HydrophobicContact CG-CG2 4.2Å; A52-T56 VanDerWaalsContact O-CB 3.32Å; A52-T56 WeakPolarHBondContact O-CB 3.43Å; A52-T56 PolarHBondContact O-N 2.93Å; A52-T56 PolarHBondContact O-OG1 3.36Å; F53-T56 PolarHBondContact O-N 2.9Å; A54-T56 VanDerWaalsContact C-N 3.34Å; A54-T56 PolarHBondContact O-N 3.48Å; T56-Y58 VanDerWaalsContact C-N 3.34Å; T56-Y58 PolarHBondContact O-N 2.93Å; T56-G59 PolarHBondContact O-N 3.47Å; T56-I60 HydrophobicContact CG2-CD1 3.82Å; T56-I60 HydrophobicContact CG2-CG1 4.46Å; T56-I60 VanDerWaalsContact O-CG1 3.27Å; T56-I60 WeakPolarHBondContact O-CG1 3.42Å; T56-I60 PolarHBondContact O-N 3.41Å
57	C	96.7	Very high	94.7	Very high	51 Å²	51	78.8 Å²	78.8	35%	0.345	43%	0.428	S	S	.	.	H	α-helix	trans	-58.4	-46.2	175.5	-73.4	0	0	0	0	111.7	F53 A54 G59 I60 V61	F53-C57 VanDerWaalsContact CE2-SG 3.59Å; F53-C57 VanDerWaalsContact CZ-SG 3.57Å; F53-C57 PolarHBondContact O-N 3.31Å; A54-C57 PolarHBondContact O-N 3.35Å; C57-G59 VanDerWaalsContact C-N 3.34Å; C57-G59 PolarHBondContact O-N 3.01Å; C57-I60 PolarHBondContact O-N 2.93Å; C57-V61 WeakPolarHBondContact O-CG2 3.49Å; C57-V61 PolarHBondContact O-N 2.91Å
58	Y	95.3	Very high	94.3	Very high	128 Å²	128	81.2 Å²	81.2	50%	0.502	43%	0.434	S	S	.	.	H	α-helix	trans	-59.6	-44.3	178.5	-175.5	-104.1	0	0	0	112	W6 A54 V55 T56 H62	W6-Y58 AromaticContact CH2-CE1 3.69Å; W6-Y58 HydrophobicContact CH2-CE1 3.69Å; W6-Y58 AromaticContact CZ3-CD1 3.93Å; W6-Y58 HydrophobicContact CZ3-CD1 3.93Å; W6-Y58 AromaticContact CZ3-CE1 3.51Å; W6-Y58 HydrophobicContact CZ3-CE1 3.51Å; A54-Y58 VanDerWaalsContact O-CB 3.31Å; A54-Y58 WeakPolarHBondContact O-CB 3.35Å; A54-Y58 PolarHBondContact O-N 2.95Å; V55-Y58 PolarHBondContact O-N 3.28Å; T56-Y58 VanDerWaalsContact C-N 3.34Å; T56-Y58 PolarHBondContact O-N 2.93Å; Y58-H62 AromaticContact CD2-CE1 3.98Å; Y58-H62 AromaticContact CE1-CE1 3.88Å; Y58-H62 AromaticContact CE2-CE1 3.42Å; Y58-H62 VanDerWaalsContact CE2-CE1 3.42Å; Y58-H62 WeakPolarHBondContact CE2-CE1 3.31Å; Y58-H62 AromaticContact CZ-CE1 3.35Å; Y58-H62 PolarHBondContact O-N 3.42Å; Y58-H62 PolarHBondContact O-ND1 2.91Å
59	G	94.4	Very high	93.8	Very high	0 Å²	0	84.1 Å²	84.1	0%	0	45%	0.452	C	S	.	.	H	α-helix	trans	-64.9	-42.3	176.3	0	0	0	0	0	113	V10 V55 T56 C57 V61 H62 I63	V10-G59 VanDerWaalsContact CG2-C 3.45Å; V55-G59 PolarHBondContact O-N 3.47Å; T56-G59 PolarHBondContact O-N 3.47Å; C57-G59 VanDerWaalsContact C-N 3.34Å; C57-G59 PolarHBondContact O-N 3.01Å; G59-V61 PolarHBondContact O-N 3.13Å; G59-H62 PolarHBondContact O-N 2.91Å; G59-I63 VanDerWaalsContact O-CG1 3.31Å; G59-I63 WeakPolarHBondContact O-CG1 3.47Å; G59-I63 PolarHBondContact O-N 3.21Å; G59-I63 VanDerWaalsContact O-N 3.13Å
60	I	95.1	Very high	93.2	Very high	89 Å²	89	91 Å²	91	46%	0.456	48%	0.483	S	S	.	.	H	α-helix	trans	-62.9	-43.1	-179.9	-69.9	166.7	0	0	0	111.2	V10 T56 C57 H62 I63 A64	V10-I60 HydrophobicContact CG1-CG1 4.12Å; V10-I60 HydrophobicContact CG2-CG1 3.95Å; T56-I60 HydrophobicContact CG2-CD1 3.82Å; T56-I60 HydrophobicContact CG2-CG1 4.46Å; T56-I60 VanDerWaalsContact O-CG1 3.27Å; T56-I60 WeakPolarHBondContact O-CG1 3.42Å; T56-I60 PolarHBondContact O-N 3.41Å; C57-I60 PolarHBondContact O-N 2.93Å; I60-H62 PolarHBondContact O-N 3.42Å; I60-I63 PolarHBondContact O-N 3.35Å; I60-A64 PolarHBondContact O-N 3.01Å
61	V	94.5	Very high	92.8	Very high	101 Å²	101	90.2 Å²	90.2	61%	0.612	48%	0.48	S	S	*	.	H	α-helix	trans	-57.6	-40	178	170.9	0	0	0	0	111.3	C57 G59 I63 A64	C57-V61 WeakPolarHBondContact O-CG2 3.49Å; C57-V61 PolarHBondContact O-N 2.91Å; G59-V61 PolarHBondContact O-N 3.13Å; V61-I63 VanDerWaalsContact C-N 3.33Å; V61-I63 PolarHBondContact O-N 3.3Å; V61-A64 PolarHBondContact O-N 3.25Å
62	H	91.9	Very high	92	Very high	62 Å²	62	89 Å²	89	29%	0.287	48%	0.484	S	S	.	.	H	α-helix	trans	-74.8	-20.4	177.5	-71.5	78.4	0	0	0	113.7	A2 W6 Y58 G59 I60	A2-H62 WeakPolarHBondContact CB-O 3.48Å; W6-H62 HydrophobicContact CD2-CB 3.79Å; W6-H62 HydrophobicContact CE3-CB 4.2Å; W6-H62 HydrophobicContact CG-CB 3.96Å; W6-H62 AromaticContact CZ2-CD2 3.83Å; Y58-H62 AromaticContact CD2-CE1 3.98Å; Y58-H62 AromaticContact CE1-CE1 3.88Å; Y58-H62 AromaticContact CE2-CE1 3.42Å; Y58-H62 VanDerWaalsContact CE2-CE1 3.42Å; Y58-H62 WeakPolarHBondContact CE2-CE1 3.31Å; Y58-H62 AromaticContact CZ-CE1 3.35Å; Y58-H62 PolarHBondContact O-N 3.42Å; Y58-H62 PolarHBondContact O-ND1 2.91Å; G59-H62 PolarHBondContact O-N 2.91Å; I60-H62 PolarHBondContact O-N 3.42Å
63	I	92.6	Very high	91.3	Very high	62 Å²	62	92.3 Å²	92.3	32%	0.318	50%	0.504	S	S	.	.	H	α-helix	trans	-84.9	-28.2	174.6	-65.6	167.3	0	0	0	111.5	W6 K7 V10 G59 I60 V61 G65	W6-I63 HydrophobicContact CB-CD1 4.3Å; W6-I63 HydrophobicContact CB-CG1 3.78Å; K7-I63 HydrophobicContact CB-CD1 4.45Å; K7-I63 HydrophobicContact CG-CD1 3.98Å; K7-I63 HydrophobicContact CG-CG1 4.28Å; V10-I63 HydrophobicContact CB-CD1 4.17Å; V10-I63 HydrophobicContact CG2-CD1 3.56Å; G59-I63 VanDerWaalsContact O-CG1 3.31Å; G59-I63 WeakPolarHBondContact O-CG1 3.47Å; G59-I63 PolarHBondContact O-N 3.21Å; G59-I63 VanDerWaalsContact O-N 3.13Å; I60-I63 PolarHBondContact O-N 3.35Å; V61-I63 VanDerWaalsContact C-N 3.33Å; V61-I63 PolarHBondContact O-N 3.3Å; I63-G65 PolarHBondContact O-N 2.99Å
64	A	89.6	Confident	90.6	Very high	87 Å²	87	87.9 Å²	87.9	72%	0.719	49%	0.488	S	S	*	.	S	Bend	trans	-58.6	-19.4	-173.8	0	0	0	0	0	113.8	I60 V61	I60-A64 PolarHBondContact O-N 3.01Å; V61-A64 PolarHBondContact O-N 3.25Å
65	G	86.6	Confident	89.8	Confident	47 Å²	47	89.5 Å²	89.5	49%	0.485	49%	0.486	S	S	.	.			trans	112.5	163.3	173.7	0	0	0	0	0	112.1	I63	I63-G65 PolarHBondContact O-N 2.99Å
66	E	89.2	Confident	89.1	Confident	161 Å²	161	91.3 Å²	91.3	75%	0.752	49%	0.493	S	S	*	.			trans	-81.8	145.7	176.9	-62.3	-61.4	151	0	0	110
67	F	89.8	Confident	88.4	Confident	208 Å²	208	98.8 Å²	98.8	91%	0.912	53%	0.525	S	S	*	.			trans	-65.4	143	169.3	-63.6	-72.9	0	0	0	110
68	K	87.3	Confident	87.8	Confident	147 Å²	147	103.5 Å²	103.5	64%	0.639	55%	0.547	S	S	*	.			trans	-109.6	144	174.8	-167.8	177.3	-172.7	-166.2	0	109.3	M70 E75	K68-M70 PolarHBondContact O-N 2.84Å; K68-E75 WeakPolarHBondContact CE-OE1 3.42Å; K68-E75 IonicContact NZ-OE1 2.58Å; K68-E75 PolarHBondContact NZ-OE1 2.97Å; K68-E75 IonicContact NZ-OE2 2.92Å; K68-E75 PolarHBondContact NZ-OE2 3.17Å
69	D	87.1	Confident	87.3	Confident	116 Å²	116	102.6 Å²	102.6	62%	0.62	55%	0.546	S	S	*	.			trans	-58.1	136.9	177	-66.5	-21.3	0	0	0	111.1	D71	D69-D71 VanDerWaalsContact C-N 3.33Å
70	M	85.7	Confident	87	Confident	190 Å²	190	106.7 Å²	106.7	94%	0.936	57%	0.571	S	S	*	*	S	Bend	trans	-76.6	-22.2	177.5	-174.4	173.3	66.5	0	0	112.5	K68 A72	K68-M70 PolarHBondContact O-N 2.84Å; M70-A72 PolarHBondContact O-N 2.87Å
71	D	89.1	Confident	86.7	Confident	88 Å²	88	109.1 Å²	109.1	47%	0.471	58%	0.578	S	S	.	*			trans	-72.8	113.6	-179.1	179.8	13.3	0	0	0	111.1	D69 T73 S74	D69-D71 VanDerWaalsContact C-N 3.33Å; D71-T73 PolarHBondContact O-N 2.91Å; D71-T73 VanDerWaalsContact O-N 3.14Å; D71-T73 VanDerWaalsContact OD1-CB 3.27Å; D71-T73 WeakPolarHBondContact OD1-CB 3.46Å; D71-T73 PolarHBondContact OD1-N 3.48Å; D71-T73 PolarHBondContact OD1-OG1 3.14Å; D71-S74 WeakPolarHBondContact O-CB 2.95Å; D71-S74 PolarHBondContact O-N 3.44Å; D71-S74 VanDerWaalsContact O-N 3.11Å; D71-S74 PolarHBondContact O-OG 3.47Å
72	A	81.3	Confident	86.3	Confident	77 Å²	77	109.7 Å²	109.7	64%	0.636	58%	0.578	S	S	*	*	H	α-helix	trans	-60.3	-23.6	176.9	0	0	0	0	0	113.4	M70 S74 L76	M70-A72 PolarHBondContact O-N 2.87Å; A72-S74 VanDerWaalsContact C-N 3.29Å; A72-S74 PolarHBondContact O-N 3.14Å; A72-L76 PolarHBondContact O-N 3.27Å
73	T	83.4	Confident	86.1	Confident	79 Å²	79	110.8 Å²	110.8	49%	0.485	59%	0.589	S	S	.	*	H	α-helix	trans	-69.1	-30.3	178.9	-40.9	0	0	0	0	111.4	D71 E75 L76 K77	D71-T73 PolarHBondContact O-N 2.91Å; D71-T73 VanDerWaalsContact O-N 3.14Å; D71-T73 VanDerWaalsContact OD1-CB 3.27Å; D71-T73 WeakPolarHBondContact OD1-CB 3.46Å; D71-T73 PolarHBondContact OD1-N 3.48Å; D71-T73 PolarHBondContact OD1-OG1 3.14Å; T73-E75 VanDerWaalsContact C-N 3.33Å; T73-E75 PolarHBondContact O-N 3.47Å; T73-L76 PolarHBondContact O-N 3.11Å; T73-L76 VanDerWaalsContact O-N 3.14Å; T73-K77 WeakPolarHBondContact O-CG 3.27Å; T73-K77 PolarHBondContact O-N 3.03Å
74	S	81.6	Confident	85.8	Confident	30 Å²	30	112.4 Å²	112.4	21%	0.21	60%	0.598	C	S	.	*	H	α-helix	trans	-63.7	-39.7	-179.1	76.1	0	0	0	0	111.5	D71 A72 L76	D71-S74 WeakPolarHBondContact O-CB 2.95Å; D71-S74 PolarHBondContact O-N 3.44Å; D71-S74 VanDerWaalsContact O-N 3.11Å; D71-S74 PolarHBondContact O-OG 3.47Å; A72-S74 VanDerWaalsContact C-N 3.29Å; A72-S74 PolarHBondContact O-N 3.14Å; S74-L76 VanDerWaalsContact C-N 3.33Å
75	E	81.6	Confident	85.9	Confident	88 Å²	88	116.2 Å²	116.2	41%	0.411	59%	0.593	S	S	.	*	H	α-helix	trans	-70.5	-29.7	175	-66.8	-165.1	-141.8	0	0	113	K68 T73	K68-E75 WeakPolarHBondContact CE-OE1 3.42Å; K68-E75 IonicContact NZ-OE1 2.58Å; K68-E75 PolarHBondContact NZ-OE1 2.97Å; K68-E75 IonicContact NZ-OE2 2.92Å; K68-E75 PolarHBondContact NZ-OE2 3.17Å; T73-E75 VanDerWaalsContact C-N 3.33Å; T73-E75 PolarHBondContact O-N 3.47Å
76	L	81	Confident	86.1	Confident	97 Å²	97	117.8 Å²	117.8	51%	0.508	59%	0.591	S	S	.	*	H	α-helix	trans	-83	-22.6	-176.5	-147.8	75.3	0	0	0	112.8	A72 T73 S74 N78 K79	A72-L76 PolarHBondContact O-N 3.27Å; T73-L76 PolarHBondContact O-N 3.11Å; T73-L76 VanDerWaalsContact O-N 3.14Å; S74-L76 VanDerWaalsContact C-N 3.33Å; L76-N78 PolarHBondContact O-N 2.92Å; L76-N78 VanDerWaalsContact O-N 3.17Å; L76-K79 HydrophobicContact CD1-CD 3.85Å; L76-K79 PolarHBondContact O-N 2.58Å
77	K	81.9	Confident	86.2	Confident	166 Å²	166	115.7 Å²	115.7	72%	0.722	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.6	-32.2	177.4	-80.8	177.8	-178.3	-175.3	0	113.7	T73	T73-K77 WeakPolarHBondContact O-CG 3.27Å; T73-K77 PolarHBondContact O-N 3.03Å
78	N	84.8	Confident	86.3	Confident	150 Å²	150	109.9 Å²	109.9	80%	0.802	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.6	-0.9	179.1	-69	-47.6	0	0	0	113.7	L76	L76-N78 PolarHBondContact O-N 2.92Å; L76-N78 VanDerWaalsContact O-N 3.17Å
79	K	85.6	Confident	86.7	Confident	110 Å²	110	108 Å²	108	48%	0.478	57%	0.57	S	S	.	*			trans	-91.8	127.7	177.7	-87.6	167.6	174.9	141.3	0	110.6	L76	L76-K79 HydrophobicContact CD1-CD 3.85Å; L76-K79 PolarHBondContact O-N 2.58Å
80	T	87.9	Confident	87	Confident	86 Å²	86	110.5 Å²	110.5	53%	0.528	58%	0.575	S	S	.	*			trans	-95.6	153.2	175.6	-58.7	0	0	0	0	110.5	D82 T83 L84	T80-D82 HydrophobicContact CG2-CB 4.45Å; T80-D82 PolarHBondContact O-N 3.44Å; T80-D82 VanDerWaalsContact O-N 3.12Å; T80-T83 PolarHBondContact O-N 2.96Å; T80-T83 PolarHBondContact O-OG1 3.12Å; T80-L84 PolarHBondContact O-N 2.68Å
81	F	88	Confident	87.4	Confident	140 Å²	140	106.5 Å²	106.5	61%	0.614	55%	0.551	S	S	*	*	H	α-helix	trans	-53.5	-32.4	178.2	-172.1	-105.9	0	0	0	113.6	T83 L84 R85	F81-T83 VanDerWaalsContact C-N 3.28Å; F81-T83 PolarHBondContact O-N 2.85Å; F81-L84 PolarHBondContact O-N 3.1Å; F81-L84 VanDerWaalsContact O-N 3.1Å; F81-R85 HydrophobicContact CD1-CB 4.44Å; F81-R85 HydrophobicContact CE1-CB 4.17Å; F81-R85 HydrophobicContact CE1-CG 4.38Å; F81-R85 HydrophobicContact CZ-CB 4.48Å; F81-R85 WeakPolarHBondContact O-CB 3.4Å; F81-R85 PolarHBondContact O-N 3.31Å
82	D	85.9	Confident	87.6	Confident	112 Å²	112	107.4 Å²	107.4	60%	0.599	56%	0.559	S	S	*	*	H	α-helix	trans	-60.1	-36	175.9	-68.9	-32	0	0	0	113.2	T80	T80-D82 HydrophobicContact CG2-CB 4.45Å; T80-D82 PolarHBondContact O-N 3.44Å; T80-D82 VanDerWaalsContact O-N 3.12Å
83	T	88.6	Confident	88.1	Confident	86 Å²	86	110.5 Å²	110.5	53%	0.528	56%	0.558	S	S	.	*	H	α-helix	trans	-74.1	-29.3	176	64.4	0	0	0	0	112.7	T80 F81	T80-T83 PolarHBondContact O-N 2.96Å; T80-T83 PolarHBondContact O-OG1 3.12Å; F81-T83 VanDerWaalsContact C-N 3.28Å; F81-T83 PolarHBondContact O-N 2.85Å
84	L	86.7	Confident	88.4	Confident	95 Å²	95	112.6 Å²	112.6	50%	0.497	57%	0.566	S	S	.	*	H	α-helix	trans	-82.9	-37.8	-179.4	-67.1	176.7	0	0	0	112.7	T80 F81 N86	T80-L84 PolarHBondContact O-N 2.68Å; F81-L84 PolarHBondContact O-N 3.1Å; F81-L84 VanDerWaalsContact O-N 3.1Å; L84-N86 PolarHBondContact O-N 3.33Å
85	R	89.8	Confident	88.8	Confident	167 Å²	167	116.4 Å²	116.4	63%	0.63	58%	0.581	S	S	*	*	H	α-helix	trans	-66.6	-24.4	-179.9	-172.2	177.4	75.7	170.5	-1.4	112.5	F81 H87	F81-R85 HydrophobicContact CD1-CB 4.44Å; F81-R85 HydrophobicContact CE1-CB 4.17Å; F81-R85 HydrophobicContact CE1-CG 4.38Å; F81-R85 HydrophobicContact CZ-CB 4.48Å; F81-R85 WeakPolarHBondContact O-CB 3.4Å; F81-R85 PolarHBondContact O-N 3.31Å; R85-H87 PolarHBondContact O-CD2 3.35Å; R85-H87 PolarHBondContact O-N 2.77Å; R85-H87 VanDerWaalsContact O-N 3.11Å
86	N	91.2	Very high	89.2	Confident	81 Å²	81	122.1 Å²	122.1	43%	0.433	60%	0.599	S	S	.	*			trans	-73.7	99.4	-179.2	-176	59.5	0	0	0	110.5	L84 P88 Y91	L84-N86 PolarHBondContact O-N 3.33Å; N86-P88 WeakPolarHBondContact O-CD 3.33Å; N86-Y91 PolarHBondContact ND2-OH 3.11Å; N86-Y91 WeakPolarHBondContact OD1-CE1 3.35Å; N86-Y91 PolarHBondContact OD1-OH 3.39Å; N86-Y91 VanDerWaalsContact OD1-OH 3.12Å
87	H	92.4	Very high	89.6	Confident	116 Å²	116	118.1 Å²	118.1	54%	0.537	58%	0.58	S	S	.	*			trans	-98.1	103.9	177.1	-70.9	-73.7	0	0	0	111.4	R85 S89 F90 Y91	R85-H87 PolarHBondContact O-CD2 3.35Å; R85-H87 PolarHBondContact O-N 2.77Å; R85-H87 VanDerWaalsContact O-N 3.11Å; H87-S89 PolarHBondContact O-N 3.12Å; H87-F90 HydrophobicContact CB-CB 4.45Å; H87-F90 HydrophobicContact CB-CD2 3.99Å; H87-F90 PolarHBondContact O-N 3.12Å; H87-Y91 WeakPolarHBondContact O-CD1 3.09Å
88	P	91.9	Very high	89.8	Confident	87 Å²	87	117.7 Å²	117.7	57%	0.565	57%	0.574	S	S	*	*	G	3₁₀ helix	trans	-60.7	-31	-174.6	-24.2	35.8	0	0	0	114.1	N86 F90 Y91	N86-P88 WeakPolarHBondContact O-CD 3.33Å; P88-F90 PolarHBondContact O-N 3.3Å; P88-Y91 HydrophobicContact CB-CE1 4.49Å; P88-Y91 HydrophobicContact CB-CE2 4.26Å
89	S	94.7	Very high	90	Very high	108 Å²	108	116.1 Å²	116.1	76%	0.755	57%	0.57	S	S	*	*	G	3₁₀ helix	trans	-66.9	-18.7	177.9	-52	0	0	0	0	113.9	H87	H87-S89 PolarHBondContact O-N 3.12Å
90	F	95	Very high	90.1	Very high	168 Å²	168	116.3 Å²	116.3	74%	0.737	58%	0.576	S	S	*	*	G	3₁₀ helix	trans	-118.6	26.8	-175.2	-62.7	-72.2	0	0	0	112.7	H87 P88 V92	H87-F90 HydrophobicContact CB-CB 4.45Å; H87-F90 HydrophobicContact CB-CD2 3.99Å; H87-F90 PolarHBondContact O-N 3.12Å; P88-F90 PolarHBondContact O-N 3.3Å; F90-V92 PolarHBondContact O-N 2.92Å
91	Y	93.6	Very high	90.1	Very high	106 Å²	106	120.4 Å²	120.4	42%	0.416	59%	0.586	S	S	.	*			trans	-64.5	129	176.4	-74.8	-9.5	0	0	0	112.2	N86 H87 P88 F93	N86-Y91 PolarHBondContact ND2-OH 3.11Å; N86-Y91 WeakPolarHBondContact OD1-CE1 3.35Å; N86-Y91 PolarHBondContact OD1-OH 3.39Å; N86-Y91 VanDerWaalsContact OD1-OH 3.12Å; H87-Y91 WeakPolarHBondContact O-CD1 3.09Å; P88-Y91 HydrophobicContact CB-CE1 4.49Å; P88-Y91 HydrophobicContact CB-CE2 4.26Å; Y91-F93 HydrophobicContact CD2-CE1 4.4Å; Y91-F93 HydrophobicContact CD2-CZ 4.3Å
92	V	92.8	Very high	89.8	Confident	106 Å²	106	119.2 Å²	119.2	64%	0.642	58%	0.578	S	S	*	*			trans	-113	117.1	170.5	179.4	0	0	0	0	108.1	F90 N94	F90-V92 PolarHBondContact O-N 2.92Å; V92-N94 HydrophobicContact CG1-CB 4.04Å; V92-N94 PolarHBondContact O-N 3.24Å
93	F	91.6	Very high	89.2	Confident	142 Å²	142	117.7 Å²	117.7	62%	0.623	57%	0.574	S	S	*	*			trans	-83.2	5.3	-175.9	-57.9	-73.8	0	0	0	114.1	Y91 H95	Y91-F93 HydrophobicContact CD2-CE1 4.4Å; Y91-F93 HydrophobicContact CD2-CZ 4.3Å; F93-H95 VanDerWaalsContact C-N 3.26Å; F93-H95 PolarHBondContact O-N 3.06Å; F93-H95 VanDerWaalsContact O-N 3.09Å; F93-H95 PolarHBondContact O-ND1 3.26Å
94	N	89.6	Confident	88.2	Confident	123 Å²	123	118.5 Å²	118.5	66%	0.658	58%	0.583	S	S	*	*			trans	-85.1	59.8	174.9	-65.8	-34.2	0	0	0	111.5	V92 R98	V92-N94 HydrophobicContact CG1-CB 4.04Å; V92-N94 PolarHBondContact O-N 3.24Å; N94-R98 PolarHBondContact OD1-NH1 3.04Å
95	H	90.8	Very high	87	Confident	110 Å²	110	120.8 Å²	120.8	51%	0.509	60%	0.596	S	S	.	*	S	Bend	trans	-118.3	166.4	178.5	64.3	-77.6	0	0	0	111.6	F93 G97 R98	F93-H95 VanDerWaalsContact C-N 3.26Å; F93-H95 PolarHBondContact O-N 3.06Å; F93-H95 VanDerWaalsContact O-N 3.09Å; F93-H95 PolarHBondContact O-ND1 3.26Å; H95-G97 PolarHBondContact CD2-N 3.28Å; H95-G97 VanDerWaalsContact CD2-N 3.3Å; H95-G97 PolarHBondContact O-N 3.01Å; H95-G97 VanDerWaalsContact O-N 3.12Å; H95-R98 VanDerWaalsContact O-CB 3.31Å; H95-R98 WeakPolarHBondContact O-CB 3.49Å; H95-R98 PolarHBondContact O-N 3.3Å
96	R	89.4	Confident	85.4	Confident	209 Å²	209	115.6 Å²	115.6	79%	0.789	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.2	-28.6	-176	-62.3	177.2	70.9	-162.7	1.6	113.3	R98 V99 L100	R96-R98 PolarHBondContact O-N 3.19Å; R96-V99 PolarHBondContact O-N 3.2Å; R96-V99 VanDerWaalsContact O-N 3.16Å; R96-L100 HydrophobicContact CB-CD1 4.24Å; R96-L100 WeakPolarHBondContact O-CG 3.45Å; R96-L100 PolarHBondContact O-N 3.34Å
97	G	90.4	Very high	83.7	Confident	12 Å²	12	115.5 Å²	115.5	12%	0.124	59%	0.585	C	S	.	*	H	α-helix	trans	-57.7	-27.4	176.1	0	0	0	0	0	113.9	H95 V99 L100 F101	H95-G97 PolarHBondContact CD2-N 3.28Å; H95-G97 VanDerWaalsContact CD2-N 3.3Å; H95-G97 PolarHBondContact O-N 3.01Å; H95-G97 VanDerWaalsContact O-N 3.12Å; G97-V99 PolarHBondContact O-N 3.17Å; G97-L100 PolarHBondContact O-N 3.16Å; G97-F101 WeakPolarHBondContact O-CB 3.31Å; G97-F101 PolarHBondContact O-N 3.22Å
98	R	86	Confident	81.7	Confident	157 Å²	157	116.2 Å²	116.2	59%	0.592	59%	0.593	S	S	*	*	H	α-helix	trans	-59.6	-32.4	176.8	-170.9	175.1	73.4	178.6	0.9	113.6	N94 H95 R96	N94-R98 PolarHBondContact OD1-NH1 3.04Å; H95-R98 VanDerWaalsContact O-CB 3.31Å; H95-R98 WeakPolarHBondContact O-CB 3.49Å; H95-R98 PolarHBondContact O-N 3.3Å; R96-R98 PolarHBondContact O-N 3.19Å
99	V	87.3	Confident	79.8	Confident	118 Å²	118	114.8 Å²	114.8	72%	0.715	59%	0.585	S	S	*	*	H	α-helix	trans	-95.7	-36.5	180	-177.3	0	0	0	0	110.8	R96 G97	R96-V99 PolarHBondContact O-N 3.2Å; R96-V99 VanDerWaalsContact O-N 3.16Å; G97-V99 PolarHBondContact O-N 3.17Å
100	L	88.7	Confident	77.8	Confident	114 Å²	114	111.6 Å²	111.6	60%	0.597	56%	0.563	S	S	*	*	H	α-helix	trans	-74.9	-30.6	-176.2	-66.2	172.3	0	0	0	113.6	R96 G97	R96-L100 HydrophobicContact CB-CD1 4.24Å; R96-L100 WeakPolarHBondContact O-CG 3.45Å; R96-L100 PolarHBondContact O-N 3.34Å; G97-L100 PolarHBondContact O-N 3.16Å
101	F	87.9	Confident	75.7	Confident	171 Å²	171	109.4 Å²	109.4	75%	0.75	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.3	28.4	-174.9	-54.9	-67.5	0	0	0	112.7	G97	G97-F101 WeakPolarHBondContact O-CB 3.31Å; G97-F101 PolarHBondContact O-N 3.22Å
102	R	82.1	Confident	73.8	Confident	116 Å²	116	111 Å²	111	44%	0.438	57%	0.57	S	S	.	*			trans	-70.7	128.9	177.7	-169.1	173.8	179.8	172.3	-3.9	110	T106 S110	R102-T106 PolarHBondContact NH2-O 3.09Å; R102-S110 VanDerWaalsContact NH2-CB 3.33Å; R102-S110 PolarHBondContact NH2-OG 3.36Å
103	P	73.6	Confident	71.9	Confident	79 Å²	79	111 Å²	111	51%	0.513	57%	0.566	S	S	.	*			trans	-64.5	138.1	171.5	-14.8	28.2	0	0	0	110.2	D105 T106	P103-D105 PolarHBondContact O-N 2.75Å; P103-T106 PolarHBondContact O-N 3.44Å; P103-T106 PolarHBondContact O-OG1 2.96Å
104	S	66.4	Low	70.2	Confident	103 Å²	103	106.5 Å²	106.5	72%	0.72	56%	0.555	S	S	*	*	G	3₁₀ helix	trans	-60.5	-16	179.6	30.5	0	0	0	0	114.1	T107	S104-T107 PolarHBondContact O-OG1 3.33Å
105	D	61.5	Low	68.4	Low	143 Å²	143	106.3 Å²	106.3	77%	0.765	55%	0.554	S	S	*	*	G	3₁₀ helix	trans	-79.7	-19.2	-179.2	-56.5	-28.5	0	0	0	113.1	P103 T107	P103-D105 PolarHBondContact O-N 2.75Å; D105-T107 VanDerWaalsContact C-N 3.31Å; D105-T107 PolarHBondContact O-N 2.81Å
106	T	56.9	Low	66.6	Low	59 Å²	59	104.6 Å²	104.6	36%	0.362	55%	0.554	S	S	.	*	G	3₁₀ helix	trans	-84.6	-3.3	-177.3	-21.9	0	0	0	0	113.5	R102 P103 N108 S109	R102-T106 PolarHBondContact NH2-O 3.09Å; P103-T106 PolarHBondContact O-N 3.44Å; P103-T106 PolarHBondContact O-OG1 2.96Å; T106-N108 VanDerWaalsContact C-N 3.25Å; T106-N108 PolarHBondContact O-N 3.4Å; T106-S109 PolarHBondContact O-N 2.85Å
107	T	54.7	Low	65.1	Low	78 Å²	78	97.4 Å²	97.4	48%	0.479	54%	0.536	S	S	.	.	G	3₁₀ helix	trans	-68	-23.5	-174.7	-22.5	0	0	0	0	112.9	S104 D105	S104-T107 PolarHBondContact O-OG1 3.33Å; D105-T107 VanDerWaalsContact C-N 3.31Å; D105-T107 PolarHBondContact O-N 2.81Å
108	N	50	Low	63.6	Low	131 Å²	131	101.8 Å²	101.8	70%	0.701	56%	0.557	S	S	*	*	G	3₁₀ helix	trans	-88.5	-17.3	179.4	-73	-20.7	0	0	0	114.7	T106	T106-N108 VanDerWaalsContact C-N 3.25Å; T106-N108 PolarHBondContact O-N 3.4Å
109	S	52	Low	62.4	Low	57 Å²	57	98.1 Å²	98.1	40%	0.399	55%	0.552	S	S	.	*	T	Hydrogen-bonded Turn	trans	-91.4	-34	-176	168.1	0	0	0	0	113.3	T106 N111 Q112 D113	T106-S109 PolarHBondContact O-N 2.85Å; S109-N111 VanDerWaalsContact C-N 3.25Å; S109-N111 PolarHBondContact O-N 3.17Å; S109-Q112 WeakPolarHBondContact O-CB 3.38Å; S109-Q112 PolarHBondContact O-N 3.25Å; S109-D113 PolarHBondContact O-N 3.16Å; S109-D113 VanDerWaalsContact O-N 3.16Å
110	S	54	Low	61	Low	42 Å²	42	95.7 Å²	95.7	29%	0.294	54%	0.54	S	S	.	.	H	α-helix	trans	-67.5	-23.6	179.2	52.4	0	0	0	0	114.2	R102 Q112 A114	R102-S110 VanDerWaalsContact NH2-CB 3.33Å; R102-S110 PolarHBondContact NH2-OG 3.36Å; S110-Q112 VanDerWaalsContact C-N 3.28Å; S110-A114 WeakPolarHBondContact O-CB 3.47Å; S110-A114 PolarHBondContact O-N 2.76Å; S110-A114 VanDerWaalsContact O-N 3.17Å
111	N	51.1	Low	59.7	Low	122 Å²	122	95.7 Å²	95.7	65%	0.652	54%	0.54	S	S	*	.	H	α-helix	trans	-70.8	-25.8	171.7	-77.2	-16.8	0	0	0	112	S109 L115	S109-N111 VanDerWaalsContact C-N 3.25Å; S109-N111 PolarHBondContact O-N 3.17Å; N111-L115 WeakPolarHBondContact O-CB 3.35Å; N111-L115 PolarHBondContact O-N 3.46Å
112	Q	52.6	Low	58.4	Low	139 Å²	139	94.8 Å²	94.8	65%	0.65	54%	0.536	S	S	*	.	H	α-helix	trans	-81.7	-40.4	176.3	-62.8	-176.1	37.5	0	0	111.6	S109 S110 L115 S116	S109-Q112 WeakPolarHBondContact O-CB 3.38Å; S109-Q112 PolarHBondContact O-N 3.25Å; S110-Q112 VanDerWaalsContact C-N 3.28Å; Q112-L115 PolarHBondContact O-N 3.33Å; Q112-S116 WeakPolarHBondContact O-CB 3.41Å; Q112-S116 PolarHBondContact O-N 3.45Å
113	D	54	Low	57.5	Low	105 Å²	105	94.6 Å²	94.6	56%	0.561	54%	0.543	S	S	*	.	H	α-helix	trans	-69.7	-37.6	179.6	-66.5	-29.3	0	0	0	112.9	S109 L115 S116 S117	S109-D113 PolarHBondContact O-N 3.16Å; S109-D113 VanDerWaalsContact O-N 3.16Å; D113-L115 VanDerWaalsContact C-N 3.31Å; D113-S116 PolarHBondContact O-N 2.96Å; D113-S117 PolarHBondContact O-N 3.44Å; D113-S117 PolarHBondContact O-OG 2.95Å
114	A	55.6	Low	57.1	Low	48 Å²	48	100 Å²	100	40%	0.397	55%	0.553	S	S	.	*	H	α-helix	trans	-69.6	-28	173.4	0	0	0	0	0	112.5	S110 S117 N118	S110-A114 WeakPolarHBondContact O-CB 3.47Å; S110-A114 PolarHBondContact O-N 2.76Å; S110-A114 VanDerWaalsContact O-N 3.17Å; A114-S117 PolarHBondContact O-OG 3.18Å; A114-N118 PolarHBondContact O-N 3.21Å; A114-N118 PolarHBondContact O-ND2 3.15Å
115	L	52.6	Low	57	Low	120 Å²	120	102.4 Å²	102.4	63%	0.628	55%	0.551	S	S	*	*	H	α-helix	trans	-75.3	-39.6	174.3	-160.6	74.2	0	0	0	111	N111 Q112 D113 N118 T119	N111-L115 WeakPolarHBondContact O-CB 3.35Å; N111-L115 PolarHBondContact O-N 3.46Å; Q112-L115 PolarHBondContact O-N 3.33Å; D113-L115 VanDerWaalsContact C-N 3.31Å; L115-N118 PolarHBondContact O-N 3.44Å; L115-T119 WeakPolarHBondContact O-CG2 3.42Å; L115-T119 PolarHBondContact O-N 3.08Å; L115-T119 PolarHBondContact O-OG1 3.26Å; L115-T119 VanDerWaalsContact O-OG1 3.12Å
116	S	53	Low	57.1	Low	73 Å²	73	101.2 Å²	101.2	51%	0.51	54%	0.543	S	S	.	.	H	α-helix	trans	-67.7	-38.5	178.2	-171.5	0	0	0	0	113.5	Q112 D113 T119 S120	Q112-S116 WeakPolarHBondContact O-CB 3.41Å; Q112-S116 PolarHBondContact O-N 3.45Å; D113-S116 PolarHBondContact O-N 2.96Å; S116-T119 WeakPolarHBondContact CA-OG1 3.45Å; S116-T119 PolarHBondContact O-OG1 3.04Å; S116-S120 WeakPolarHBondContact O-CB 3.46Å; S116-S120 PolarHBondContact O-N 3.02Å; S116-S120 VanDerWaalsContact O-N 3.08Å; S116-S120 PolarHBondContact O-OG 3.12Å
117	S	57.5	Low	57.6	Low	58 Å²	58	104.6 Å²	104.6	41%	0.406	56%	0.555	S	S	.	*	H	α-helix	trans	-68.1	-36.9	175.1	65.6	0	0	0	0	112.3	D113 A114 S120 L121	D113-S117 PolarHBondContact O-N 3.44Å; D113-S117 PolarHBondContact O-OG 2.95Å; A114-S117 PolarHBondContact O-OG 3.18Å; S117-S120 PolarHBondContact O-OG 3.01Å; S117-L121 WeakPolarHBondContact O-CG 3.48Å; S117-L121 PolarHBondContact O-N 3.26Å
118	N	57.4	Low	58.1	Low	105 Å²	105	105.4 Å²	105.4	56%	0.561	56%	0.564	S	S	*	*	H	α-helix	trans	-72.9	-36	177	-76.4	-46.6	0	0	0	112.9	A114 L115 K122	A114-N118 PolarHBondContact O-N 3.21Å; A114-N118 PolarHBondContact O-ND2 3.15Å; L115-N118 PolarHBondContact O-N 3.44Å; N118-K122 WeakPolarHBondContact O-CB 3.4Å; N118-K122 PolarHBondContact O-N 2.94Å
119	T	60.9	Low	58.7	Low	80 Å²	80	105.8 Å²	105.8	49%	0.491	57%	0.565	S	S	.	*	H	α-helix	trans	-70.4	-40.7	176.4	51.3	0	0	0	0	112	L115 S116 K122 L123	L115-T119 WeakPolarHBondContact O-CG2 3.42Å; L115-T119 PolarHBondContact O-N 3.08Å; L115-T119 PolarHBondContact O-OG1 3.26Å; L115-T119 VanDerWaalsContact O-OG1 3.12Å; S116-T119 WeakPolarHBondContact CA-OG1 3.45Å; S116-T119 PolarHBondContact O-OG1 3.04Å; T119-K122 PolarHBondContact O-N 3.09Å; T119-L123 WeakPolarHBondContact O-CB 3.44Å; T119-L123 PolarHBondContact O-N 3.01Å
120	S	58.3	Low	59	Low	67 Å²	67	113.8 Å²	113.8	47%	0.469	59%	0.587	S	S	.	*	H	α-helix	trans	-63.1	-41.3	176.7	63.6	0	0	0	0	113.2	S116 S117 K122 L123 R124	S116-S120 WeakPolarHBondContact O-CB 3.46Å; S116-S120 PolarHBondContact O-N 3.02Å; S116-S120 VanDerWaalsContact O-N 3.08Å; S116-S120 PolarHBondContact O-OG 3.12Å; S117-S120 PolarHBondContact O-OG 3.01Å; S120-K122 VanDerWaalsContact C-N 3.35Å; S120-L123 PolarHBondContact O-N 3.42Å; S120-R124 WeakPolarHBondContact O-CB 3.48Å; S120-R124 PolarHBondContact O-N 2.91Å
121	L	60.8	Low	58.8	Low	114 Å²	114	126.1 Å²	126.1	60%	0.597	63%	0.627	S	S	*	*	H	α-helix	trans	-65.3	-37.6	174.5	-74.1	171.1	0	0	0	112.1	S117 K125	S117-L121 WeakPolarHBondContact O-CG 3.48Å; S117-L121 PolarHBondContact O-N 3.26Å; L121-K125 WeakPolarHBondContact O-CB 3.35Å; L121-K125 PolarHBondContact O-N 3.25Å; L121-K125 VanDerWaalsContact O-N 3.09Å
122	K	62.3	Low	59.2	Low	151 Å²	151	126.3 Å²	126.3	66%	0.657	63%	0.625	S	S	*	*	H	α-helix	trans	-70.2	-37.2	177.8	-150.3	179.3	-172.6	-175.5	0	112	N118 T119 S120 K125 L126	N118-K122 WeakPolarHBondContact O-CB 3.4Å; N118-K122 PolarHBondContact O-N 2.94Å; T119-K122 PolarHBondContact O-N 3.09Å; S120-K122 VanDerWaalsContact C-N 3.35Å; K122-K125 PolarHBondContact O-N 3.18Å; K122-L126 PolarHBondContact O-N 3.35Å
123	L	62.7	Low	59.6	Low	113 Å²	113	125.6 Å²	125.6	59%	0.592	62%	0.624	S	S	*	*	H	α-helix	trans	-69.1	-44	177.4	-157.9	149.4	0	0	0	111.2	T119 S120 K125 L126 E127	T119-L123 WeakPolarHBondContact O-CB 3.44Å; T119-L123 PolarHBondContact O-N 3.01Å; S120-L123 PolarHBondContact O-N 3.42Å; L123-K125 VanDerWaalsContact C-N 3.29Å; L123-K125 PolarHBondContact O-N 3.03Å; L123-L126 PolarHBondContact O-N 3.4Å; L123-E127 WeakPolarHBondContact O-CB 3.4Å; L123-E127 PolarHBondContact O-N 3.18Å
124	R	64.1	Low	59.9	Low	192 Å²	192	126.8 Å²	126.8	73%	0.725	63%	0.628	S	S	*	*	H	α-helix	trans	-61.3	-35.6	173.1	-171.7	178	-84.6	-176	-5.4	112.5	S120 S128	S120-R124 WeakPolarHBondContact O-CB 3.48Å; S120-R124 PolarHBondContact O-N 2.91Å; R124-S128 PolarHBondContact O-N 2.96Å
125	K	65.9	Low	60.1	Low	154 Å²	154	131.4 Å²	131.4	67%	0.67	64%	0.641	S	S	*	*	H	α-helix	trans	-70.3	-35.9	175.6	-164.8	173.7	-174.8	-179.6	0	112.8	L121 K122 L123	L121-K125 WeakPolarHBondContact O-CB 3.35Å; L121-K125 PolarHBondContact O-N 3.25Å; L121-K125 VanDerWaalsContact O-N 3.09Å; K122-K125 PolarHBondContact O-N 3.18Å; L123-K125 VanDerWaalsContact C-N 3.29Å; L123-K125 PolarHBondContact O-N 3.03Å
126	L	63.8	Low	60.6	Low	117 Å²	117	132.1 Å²	132.1	61%	0.613	64%	0.642	S	S	*	*	H	α-helix	trans	-71.1	-36	175.1	-83.7	169.1	0	0	0	112.5	K122 L123 L129	K122-L126 PolarHBondContact O-N 3.35Å; L123-L126 PolarHBondContact O-N 3.4Å; L126-L129 PolarHBondContact O-N 3.28Å
127	E	66.1	Low	61.1	Low	131 Å²	131	136.1 Å²	136.1	61%	0.612	65%	0.651	S	S	*	*	H	α-helix	trans	-70.2	-33.8	178.5	-150.4	161.2	-155.9	0	0	112.1	L123 L129 R130	L123-E127 WeakPolarHBondContact O-CB 3.4Å; L123-E127 PolarHBondContact O-N 3.18Å; E127-L129 PolarHBondContact O-N 3.24Å; E127-R130 PolarHBondContact O-N 3.35Å
128	S	64.7	Low	61.4	Low	94 Å²	94	141.6 Å²	141.6	66%	0.657	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.7	-21.1	171.2	-179.5	0	0	0	0	114.3	R124	R124-S128 PolarHBondContact O-N 2.96Å
129	L	63.9	Low	61.7	Low	140 Å²	140	144.5 Å²	144.5	73%	0.733	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.2	-3.4	178.7	-76.3	166.9	0	0	0	112.8	L126 E127	L126-L129 PolarHBondContact O-N 3.28Å; E127-L129 PolarHBondContact O-N 3.24Å
130	R	58.4	Low	61.7	Low	225 Å²	225	149.8 Å²	149.8	85%	0.849	69%	0.692	S	S	*	*			trans	-101.9	1.7	-177.6	-153.5	179.3	-153.4	157.8	8	113.6	E127	E127-R130 PolarHBondContact O-N 3.35Å
131	R	49.8	Very low	62	Low	300 Å²	300	157.4 Å²	157.4	100%	1.132	71%	0.712	S	S	*	*			trans	-102.1	0	170.5	-87.7	-169.9	-174.3	-164.1	2.2	110.9

Retrieved 131 of 131 residues in 388.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).