A0A096NHV3_PAPAN Loading...

Coiled-coil domain-containing protein 167

AlphaFold DB (A0A5F7ZJ39), UniProt , Accession A0A096NHV3, Species PAPAN (Papio anubis, Olive baboon), Gene CCDC167, Length 97 aa.

						>A0A096NHV3_PAPAN|A0A096NHV3|CCDC167
MTKKKRENLGVALEIDGLEEKLSQCRKDLEAVNSRLHSQELSPEARRSLEKEKNSLMSKASNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.4	Very low	58.1	Low	231 Å²	231	137.5 Å²	137.5	100%	1.138	67%	0.672	S	S	*	*				0	2	0	-70.7	-61.5	-175.3	0	0	114.8
2	T	52.4	Low	59.3	Low	122 Å²	122	129.8 Å²	129.8	75%	0.748	65%	0.647	S	S	*	*			trans	-103.8	-16.3	-168.2	45.6	0	0	0	0	116.8
3	K	53.6	Low	60.5	Low	173 Å²	173	129 Å²	129	75%	0.752	65%	0.645	S	S	*	*	H	α-helix	trans	-74.1	-45.1	-179	-81.6	-171.8	173.3	-176	0	113.7	K5 R6	K3-K5 PolarHBondContact O-N 3.14Å; K3-K5 VanDerWaalsContact O-N 3.11Å; K3-R6 PolarHBondContact O-N 3.33Å; K3-R6 VanDerWaalsContact O-N 3.14Å
4	K	55	Low	61.8	Low	160 Å²	160	129.8 Å²	129.8	70%	0.696	65%	0.646	S	S	*	*	H	α-helix	trans	-60	-27.1	-177	-157.7	174.2	-173.9	176.4	0	113.8	N8	K4-N8 PolarHBondContact O-N 3.33Å; K4-N8 PolarHBondContact O-ND2 3.11Å
5	K	53.8	Low	63	Low	159 Å²	159	126.7 Å²	126.7	69%	0.691	63%	0.631	S	S	*	*	H	α-helix	trans	-76.1	-29.2	-178.8	-151.9	-180	-174.8	-174.3	0	113	K3 L9	K3-K5 PolarHBondContact O-N 3.14Å; K3-K5 VanDerWaalsContact O-N 3.11Å; K5-L9 WeakPolarHBondContact O-CD1 3.4Å; K5-L9 PolarHBondContact O-N 3.49Å
6	R	56.2	Low	64.2	Low	215 Å²	215	124.6 Å²	124.6	81%	0.811	62%	0.623	S	S	*	*	H	α-helix	trans	-75.3	-38.2	177.2	-84.2	-174.4	-179.7	174.2	-0.2	112.1	K3 L9 G10	K3-R6 PolarHBondContact O-N 3.33Å; K3-R6 VanDerWaalsContact O-N 3.14Å; R6-L9 PolarHBondContact O-N 3.06Å; R6-G10 PolarHBondContact O-N 3.42Å
7	E	57.3	Low	65.4	Low	131 Å²	131	119 Å²	119	61%	0.612	60%	0.604	S	S	*	*	H	α-helix	trans	-67.7	-43.2	178.6	-66.1	169.4	169.8	0	0	111	L9 G10 V11	E7-L9 VanDerWaalsContact C-N 3.28Å; E7-L9 PolarHBondContact O-N 3.31Å; E7-G10 PolarHBondContact O-N 3.06Å; E7-V11 WeakPolarHBondContact O-CG2 3.41Å; E7-V11 PolarHBondContact O-N 3.21Å
8	N	59.5	Low	66.6	Low	102 Å²	102	118.7 Å²	118.7	55%	0.545	60%	0.604	S	S	.	*	H	α-helix	trans	-63.2	-30.6	175.7	-72.7	-17.6	0	0	0	113.7	K4 A12	K4-N8 PolarHBondContact O-N 3.33Å; K4-N8 PolarHBondContact O-ND2 3.11Å; N8-A12 PolarHBondContact O-N 3.3Å; N8-A12 VanDerWaalsContact O-N 3.17Å
9	L	61	Low	67.5	Low	108 Å²	108	119.1 Å²	119.1	57%	0.565	60%	0.603	S	S	*	*	H	α-helix	trans	-72.6	-36.3	175.4	-110.5	121.2	0	0	0	112.1	K5 R6 E7 L13	K5-L9 WeakPolarHBondContact O-CD1 3.4Å; K5-L9 PolarHBondContact O-N 3.49Å; R6-L9 PolarHBondContact O-N 3.06Å; E7-L9 VanDerWaalsContact C-N 3.28Å; E7-L9 PolarHBondContact O-N 3.31Å; L9-L13 WeakPolarHBondContact O-CG 3.38Å; L9-L13 PolarHBondContact O-N 3.28Å
10	G	71.4	Confident	68.5	Low	36 Å²	36	120.5 Å²	120.5	37%	0.371	61%	0.607	S	S	.	*	H	α-helix	trans	-67.1	-42.7	175.1	0	0	0	0	0	112.2	R6 E7 A12 L13 E14	R6-G10 PolarHBondContact O-N 3.42Å; E7-G10 PolarHBondContact O-N 3.06Å; G10-A12 PolarHBondContact O-N 3.38Å; G10-L13 PolarHBondContact O-N 3.17Å; G10-E14 PolarHBondContact O-N 3.17Å
11	V	73.2	Confident	69.5	Low	76 Å²	76	121.9 Å²	121.9	46%	0.461	61%	0.609	S	S	.	*	H	α-helix	trans	-64.6	-39.7	177.6	175.5	0	0	0	0	111.6	E7 L13 E14 I15	E7-V11 WeakPolarHBondContact O-CG2 3.41Å; E7-V11 PolarHBondContact O-N 3.21Å; V11-L13 PolarHBondContact O-N 2.98Å; V11-E14 PolarHBondContact O-N 3.02Å; V11-I15 HydrophobicContact CG1-CD1 3.85Å; V11-I15 HydrophobicContact CG1-CG1 4.44Å; V11-I15 VanDerWaalsContact O-CG1 3.26Å; V11-I15 WeakPolarHBondContact O-CG1 3.46Å; V11-I15 PolarHBondContact O-N 3.48Å
12	A	73.2	Confident	71.6	Confident	45 Å²	45	115.4 Å²	115.4	37%	0.372	58%	0.579	S	S	.	*	H	α-helix	trans	-61.7	-42	176	0	0	0	0	0	112.2	N8 G10 I15 D16	N8-A12 PolarHBondContact O-N 3.3Å; N8-A12 VanDerWaalsContact O-N 3.17Å; G10-A12 PolarHBondContact O-N 3.38Å; A12-I15 PolarHBondContact O-N 3.27Å; A12-D16 PolarHBondContact O-N 2.91Å
13	L	74.2	Confident	73.3	Confident	119 Å²	119	111.9 Å²	111.9	62%	0.623	56%	0.559	S	S	*	*	H	α-helix	trans	-67.2	-35.7	177.3	-73.1	167.8	0	0	0	113	L9 G10 V11 G17	L9-L13 WeakPolarHBondContact O-CG 3.38Å; L9-L13 PolarHBondContact O-N 3.28Å; G10-L13 PolarHBondContact O-N 3.17Å; V11-L13 PolarHBondContact O-N 2.98Å; L13-G17 PolarHBondContact O-N 3.34Å
14	E	79.2	Confident	75.1	Confident	140 Å²	140	108.1 Å²	108.1	65%	0.654	54%	0.544	S	S	*	.	H	α-helix	trans	-67.7	-37.9	173.3	-82.7	-177.4	158.9	0	0	112.2	G10 V11 L18	G10-E14 PolarHBondContact O-N 3.17Å; V11-E14 PolarHBondContact O-N 3.02Å; E14-L18 WeakPolarHBondContact O-CB 3.44Å; E14-L18 WeakPolarHBondContact O-CG 3.26Å; E14-L18 PolarHBondContact O-N 3.47Å
15	I	79.3	Confident	76.7	Confident	83 Å²	83	104.5 Å²	104.5	43%	0.426	54%	0.538	S	S	.	.	H	α-helix	trans	-63.8	-51	174.7	-69.7	166.8	0	0	0	110	V11 A12 G17 L18 E19	V11-I15 HydrophobicContact CG1-CD1 3.85Å; V11-I15 HydrophobicContact CG1-CG1 4.44Å; V11-I15 VanDerWaalsContact O-CG1 3.26Å; V11-I15 WeakPolarHBondContact O-CG1 3.46Å; V11-I15 PolarHBondContact O-N 3.48Å; A12-I15 PolarHBondContact O-N 3.27Å; I15-G17 VanDerWaalsContact C-N 3.29Å; I15-G17 PolarHBondContact O-N 3.44Å; I15-L18 PolarHBondContact O-N 3.3Å; I15-E19 HydrophobicContact CG2-CG 4.33Å; I15-E19 WeakPolarHBondContact O-CG 3.3Å; I15-E19 PolarHBondContact O-N 3.34Å
16	D	82.1	Confident	78.4	Confident	93 Å²	93	105.2 Å²	105.2	50%	0.497	54%	0.537	S	S	.	.	H	α-helix	trans	-58.1	-43	179	-71	-18.2	0	0	0	111.2	A12 L18 E19 E20	A12-D16 PolarHBondContact O-N 2.91Å; D16-L18 VanDerWaalsContact C-N 3.32Å; D16-L18 PolarHBondContact O-N 2.93Å; D16-E19 PolarHBondContact O-N 3.35Å; D16-E20 WeakPolarHBondContact O-CB 3.3Å; D16-E20 PolarHBondContact O-N 3.47Å
17	G	85.1	Confident	80.1	Confident	30 Å²	30	100.7 Å²	100.7	31%	0.309	52%	0.523	S	S	.	.	H	α-helix	trans	-66.1	-30.7	177.2	0	0	0	0	0	114	L13 I15 K21	L13-G17 PolarHBondContact O-N 3.34Å; I15-G17 VanDerWaalsContact C-N 3.29Å; I15-G17 PolarHBondContact O-N 3.44Å; G17-K21 VanDerWaalsContact O-CG 3.3Å; G17-K21 WeakPolarHBondContact O-CG 3.46Å; G17-K21 PolarHBondContact O-N 3.4Å
18	L	86.1	Confident	81.5	Confident	114 Å²	114	98.4 Å²	98.4	60%	0.597	52%	0.515	S	S	*	.	H	α-helix	trans	-77.8	-39.1	174.1	-78.5	171.9	0	0	0	112	E14 I15 D16 E20 K21 L22	E14-L18 WeakPolarHBondContact O-CB 3.44Å; E14-L18 WeakPolarHBondContact O-CG 3.26Å; E14-L18 PolarHBondContact O-N 3.47Å; I15-L18 PolarHBondContact O-N 3.3Å; D16-L18 VanDerWaalsContact C-N 3.32Å; D16-L18 PolarHBondContact O-N 2.93Å; L18-E20 VanDerWaalsContact C-N 3.31Å; L18-E20 PolarHBondContact O-N 2.97Å; L18-K21 PolarHBondContact O-N 3.06Å; L18-L22 WeakPolarHBondContact O-CB 3.5Å; L18-L22 PolarHBondContact O-N 2.85Å
19	E	83.8	Confident	82.8	Confident	126 Å²	126	99.3 Å²	99.3	59%	0.589	52%	0.519	S	S	*	.	H	α-helix	trans	-62.3	-39.9	175.3	-74.3	-170.4	167.7	0	0	111.5	I15 D16 L22 S23	I15-E19 HydrophobicContact CG2-CG 4.33Å; I15-E19 WeakPolarHBondContact O-CG 3.3Å; I15-E19 PolarHBondContact O-N 3.34Å; D16-E19 PolarHBondContact O-N 3.35Å; E19-L22 PolarHBondContact O-N 2.93Å; E19-S23 VanDerWaalsContact O-CB 3.27Å; E19-S23 WeakPolarHBondContact O-CB 3.33Å; E19-S23 PolarHBondContact O-N 3.34Å
20	E	87.6	Confident	84	Confident	147 Å²	147	100.9 Å²	100.9	69%	0.687	52%	0.523	S	S	*	.	H	α-helix	trans	-67.2	-40.6	177.2	-170.1	148.6	-153.3	0	0	112.1	D16 L18 L22 S23 Q24	D16-E20 WeakPolarHBondContact O-CB 3.3Å; D16-E20 PolarHBondContact O-N 3.47Å; L18-E20 VanDerWaalsContact C-N 3.31Å; L18-E20 PolarHBondContact O-N 2.97Å; E20-L22 VanDerWaalsContact C-N 3.34Å; E20-L22 PolarHBondContact O-N 3.32Å; E20-S23 WeakPolarHBondContact O-CB 3.43Å; E20-S23 PolarHBondContact O-N 3.33Å; E20-Q24 WeakPolarHBondContact O-CB 3.43Å; E20-Q24 PolarHBondContact O-N 2.9Å
21	K	90.1	Very high	84.6	Confident	150 Å²	150	101.2 Å²	101.2	65%	0.652	52%	0.523	S	S	*	.	H	α-helix	trans	-63.4	-38.7	172.9	-73.9	173.3	-176.2	175.8	0	112.3	G17 L18 Q24 C25	G17-K21 VanDerWaalsContact O-CG 3.3Å; G17-K21 WeakPolarHBondContact O-CG 3.46Å; G17-K21 PolarHBondContact O-N 3.4Å; L18-K21 PolarHBondContact O-N 3.06Å; K21-Q24 PolarHBondContact O-N 3.02Å; K21-C25 VanDerWaalsContact O-CB 3.3Å; K21-C25 WeakPolarHBondContact O-CB 3.39Å; K21-C25 PolarHBondContact O-N 3.34Å
22	L	90	Very high	85	Confident	94 Å²	94	102.1 Å²	102.1	49%	0.492	53%	0.528	S	S	.	.	H	α-helix	trans	-70.5	-41.2	178.8	-162.4	154.5	0	0	0	111.2	L18 E19 E20 Q24 C25 R26	L18-L22 WeakPolarHBondContact O-CB 3.5Å; L18-L22 PolarHBondContact O-N 2.85Å; E19-L22 PolarHBondContact O-N 2.93Å; E20-L22 VanDerWaalsContact C-N 3.34Å; E20-L22 PolarHBondContact O-N 3.32Å; L22-Q24 VanDerWaalsContact C-N 3.35Å; L22-C25 PolarHBondContact O-N 2.9Å; L22-R26 HydrophobicContact CD2-CG 4.33Å; L22-R26 PolarHBondContact O-N 2.9Å
23	S	88.6	Confident	85.2	Confident	49 Å²	49	104.8 Å²	104.8	34%	0.343	54%	0.536	S	S	.	.	H	α-helix	trans	-55.9	-48.5	170.6	159.6	0	0	0	0	111.3	E19 E20 R26 K27	E19-S23 VanDerWaalsContact O-CB 3.27Å; E19-S23 WeakPolarHBondContact O-CB 3.33Å; E19-S23 PolarHBondContact O-N 3.34Å; E20-S23 WeakPolarHBondContact O-CB 3.43Å; E20-S23 PolarHBondContact O-N 3.33Å; S23-R26 PolarHBondContact O-N 3.42Å; S23-K27 WeakPolarHBondContact O-CG 3.27Å; S23-K27 PolarHBondContact O-N 2.77Å
24	Q	90.4	Very high	85.1	Confident	94 Å²	94	102 Å²	102	44%	0.439	53%	0.527	S	S	.	.	H	α-helix	trans	-63.6	-45.7	178.2	-169.8	58.8	42.6	0	0	111.5	E20 K21 L22 R26 K27 D28	E20-Q24 WeakPolarHBondContact O-CB 3.43Å; E20-Q24 PolarHBondContact O-N 2.9Å; K21-Q24 PolarHBondContact O-N 3.02Å; L22-Q24 VanDerWaalsContact C-N 3.35Å; Q24-R26 VanDerWaalsContact C-N 3.3Å; Q24-R26 PolarHBondContact O-N 2.83Å; Q24-K27 PolarHBondContact O-N 3.48Å; Q24-K27 VanDerWaalsContact O-N 3.16Å; Q24-D28 PolarHBondContact NE2-OD1 2.8Å; Q24-D28 VanDerWaalsContact O-CG 3.25Å; Q24-D28 PolarHBondContact O-N 3.36Å
25	C	89.1	Confident	84.6	Confident	83 Å²	83	104.1 Å²	104.1	56%	0.561	53%	0.529	S	S	*	.	H	α-helix	trans	-60.5	-38.5	177.6	-171.1	0	0	0	0	112.3	K21 L22 D28 L29	K21-C25 VanDerWaalsContact O-CB 3.3Å; K21-C25 WeakPolarHBondContact O-CB 3.39Å; K21-C25 PolarHBondContact O-N 3.34Å; L22-C25 PolarHBondContact O-N 2.9Å; C25-D28 PolarHBondContact O-N 3.16Å; C25-L29 WeakPolarHBondContact O-CB 3.48Å; C25-L29 PolarHBondContact O-N 3.4Å
26	R	89.3	Confident	83.9	Confident	175 Å²	175	103.7 Å²	103.7	66%	0.66	53%	0.527	S	S	*	.	H	α-helix	trans	-64.4	-44.7	173.8	-88.9	-177.4	171.2	154.2	-1.6	112.6	L22 S23 Q24 D28 L29 E30	L22-R26 HydrophobicContact CD2-CG 4.33Å; L22-R26 PolarHBondContact O-N 2.9Å; S23-R26 PolarHBondContact O-N 3.42Å; Q24-R26 VanDerWaalsContact C-N 3.3Å; Q24-R26 PolarHBondContact O-N 2.83Å; R26-D28 VanDerWaalsContact C-N 3.32Å; R26-D28 PolarHBondContact O-N 3.32Å; R26-L29 WeakPolarHBondContact O-CB 3.3Å; R26-L29 PolarHBondContact O-N 3.29Å; R26-E30 WeakPolarHBondContact O-CB 3.34Å; R26-E30 PolarHBondContact O-N 2.89Å
27	K	91.3	Very high	83.1	Confident	120 Å²	120	104.7 Å²	104.7	52%	0.522	53%	0.528	S	S	.	.	H	α-helix	trans	-62.7	-41.8	177.4	-71.4	174.9	-175.1	173.8	0	111.3	S23 Q24 E30 A31	S23-K27 WeakPolarHBondContact O-CG 3.27Å; S23-K27 PolarHBondContact O-N 2.77Å; Q24-K27 PolarHBondContact O-N 3.48Å; Q24-K27 VanDerWaalsContact O-N 3.16Å; K27-E30 PolarHBondContact O-N 3.39Å; K27-A31 WeakPolarHBondContact O-CB 3.29Å; K27-A31 PolarHBondContact O-N 2.88Å
28	D	87.6	Confident	81.9	Confident	83 Å²	83	107 Å²	107	44%	0.444	54%	0.54	S	S	.	.	H	α-helix	trans	-66.5	-40.9	177.9	-65.8	-17.6	0	0	0	111	Q24 C25 R26 A31 V32	Q24-D28 PolarHBondContact NE2-OD1 2.8Å; Q24-D28 VanDerWaalsContact O-CG 3.25Å; Q24-D28 PolarHBondContact O-N 3.36Å; C25-D28 PolarHBondContact O-N 3.16Å; R26-D28 VanDerWaalsContact C-N 3.32Å; R26-D28 PolarHBondContact O-N 3.32Å; D28-A31 PolarHBondContact O-N 3.33Å; D28-V32 WeakPolarHBondContact O-CB 3.27Å; D28-V32 VanDerWaalsContact O-CG2 3.29Å; D28-V32 WeakPolarHBondContact O-CG2 3.49Å; D28-V32 PolarHBondContact O-N 2.91Å
29	L	85.4	Confident	80.6	Confident	121 Å²	121	108.8 Å²	108.8	63%	0.634	55%	0.545	S	S	*	.	H	α-helix	trans	-60.8	-45	173.5	-170.2	97.7	0	0	0	111.6	C25 R26 V32 N33	C25-L29 WeakPolarHBondContact O-CB 3.48Å; C25-L29 PolarHBondContact O-N 3.4Å; R26-L29 WeakPolarHBondContact O-CB 3.3Å; R26-L29 PolarHBondContact O-N 3.29Å; L29-V32 PolarHBondContact O-N 3.02Å; L29-N33 VanDerWaalsContact O-CB 3.27Å; L29-N33 WeakPolarHBondContact O-CB 3.35Å; L29-N33 PolarHBondContact O-N 3.49Å
30	E	86.4	Confident	79.2	Confident	141 Å²	141	109.1 Å²	109.1	66%	0.659	55%	0.547	S	S	*	.	H	α-helix	trans	-67.6	-37	179.3	-166.8	170.3	-166.2	0	0	111.9	R26 K27 N33 S34	R26-E30 WeakPolarHBondContact O-CB 3.34Å; R26-E30 PolarHBondContact O-N 2.89Å; K27-E30 PolarHBondContact O-N 3.39Å; E30-N33 PolarHBondContact O-N 3.04Å; E30-S34 VanDerWaalsContact O-CB 3.32Å; E30-S34 WeakPolarHBondContact O-CB 3.41Å; E30-S34 PolarHBondContact O-N 3.45Å; E30-S34 PolarHBondContact O-OG 2.67Å
31	A	83.8	Confident	77.7	Confident	43 Å²	43	104.6 Å²	104.6	36%	0.355	53%	0.527	S	S	.	.	H	α-helix	trans	-65.1	-40.1	171.7	0	0	0	0	0	112.3	K27 D28 S34 R35	K27-A31 WeakPolarHBondContact O-CB 3.29Å; K27-A31 PolarHBondContact O-N 2.88Å; D28-A31 PolarHBondContact O-N 3.33Å; A31-S34 WeakPolarHBondContact CA-OG 3.41Å; A31-S34 PolarHBondContact O-OG 3.47Å; A31-R35 WeakPolarHBondContact O-CB 3.05Å; A31-R35 VanDerWaalsContact O-CG 3.23Å; A31-R35 WeakPolarHBondContact O-CG 3.26Å; A31-R35 PolarHBondContact O-N 3.02Å; A31-R35 VanDerWaalsContact O-N 3.15Å
32	V	81.7	Confident	76.5	Confident	95 Å²	95	99.6 Å²	99.6	58%	0.576	51%	0.511	S	S	*	.	H	α-helix	trans	-68.2	-42	174.3	170.9	0	0	0	0	110.7	D28 L29 R35 L36	D28-V32 WeakPolarHBondContact O-CB 3.27Å; D28-V32 VanDerWaalsContact O-CG2 3.29Å; D28-V32 WeakPolarHBondContact O-CG2 3.49Å; D28-V32 PolarHBondContact O-N 2.91Å; L29-V32 PolarHBondContact O-N 3.02Å; V32-R35 PolarHBondContact O-N 3.35Å; V32-L36 WeakPolarHBondContact O-CB 3.23Å; V32-L36 PolarHBondContact O-N 2.91Å
33	N	77.7	Confident	75.3	Confident	100 Å²	100	99.2 Å²	99.2	54%	0.535	51%	0.514	S	S	.	.	H	α-helix	trans	-71	-36.2	-177.4	-155.8	19.5	0	0	0	112.2	L29 E30 L36 H37	L29-N33 VanDerWaalsContact O-CB 3.27Å; L29-N33 WeakPolarHBondContact O-CB 3.35Å; L29-N33 PolarHBondContact O-N 3.49Å; E30-N33 PolarHBondContact O-N 3.04Å; N33-L36 PolarHBondContact O-N 2.79Å; N33-H37 VanDerWaalsContact O-CB 3.29Å; N33-H37 WeakPolarHBondContact O-CB 3.29Å; N33-H37 PolarHBondContact O-N 3.38Å
34	S	72.4	Confident	74.2	Confident	62 Å²	62	103.9 Å²	103.9	43%	0.434	53%	0.53	S	S	.	.	H	α-helix	trans	-67	-38.5	172.3	54.8	0	0	0	0	112.2	E30 A31 S38	E30-S34 VanDerWaalsContact O-CB 3.32Å; E30-S34 WeakPolarHBondContact O-CB 3.41Å; E30-S34 PolarHBondContact O-N 3.45Å; E30-S34 PolarHBondContact O-OG 2.67Å; A31-S34 WeakPolarHBondContact CA-OG 3.41Å; A31-S34 PolarHBondContact O-OG 3.47Å; S34-S38 VanDerWaalsContact O-CB 3.28Å; S34-S38 WeakPolarHBondContact O-CB 3.4Å; S34-S38 PolarHBondContact O-N 3.19Å; S34-S38 PolarHBondContact O-OG 3.15Å
35	R	69.2	Low	73.1	Confident	184 Å²	184	101.2 Å²	101.2	69%	0.694	52%	0.524	S	S	*	.	H	α-helix	trans	-65.4	-44.1	170.6	-73.6	175.1	-177	-167.6	2.5	111.5	A31 V32 S38 Q39	A31-R35 WeakPolarHBondContact O-CB 3.05Å; A31-R35 VanDerWaalsContact O-CG 3.23Å; A31-R35 WeakPolarHBondContact O-CG 3.26Å; A31-R35 PolarHBondContact O-N 3.02Å; A31-R35 VanDerWaalsContact O-N 3.15Å; V32-R35 PolarHBondContact O-N 3.35Å; R35-S38 CarbonylContact O-C 3.51Å; R35-S38 PolarHBondContact O-N 2.77Å; R35-Q39 WeakPolarHBondContact O-CB 3.32Å; R35-Q39 PolarHBondContact O-N 2.95Å
36	L	65.1	Low	72.4	Confident	74 Å²	74	103 Å²	103	39%	0.387	52%	0.519	S	S	.	.	H	α-helix	trans	-60.5	-47	176	-159.3	90.9	0	0	0	110.5	V32 N33 S38 Q39 E40	V32-L36 WeakPolarHBondContact O-CB 3.23Å; V32-L36 PolarHBondContact O-N 2.91Å; N33-L36 PolarHBondContact O-N 2.79Å; L36-S38 VanDerWaalsContact C-N 3.28Å; L36-S38 PolarHBondContact O-N 3.32Å; L36-Q39 CarbonylContact O-C 3.49Å; L36-Q39 PolarHBondContact O-N 2.84Å; L36-E40 VanDerWaalsContact CD2-OE2 3.3Å; L36-E40 WeakPolarHBondContact CD2-OE2 3.44Å; L36-E40 HydrophobicContact CG-CG 4.26Å; L36-E40 VanDerWaalsContact O-CB 3.26Å; L36-E40 WeakPolarHBondContact O-CB 3.47Å; L36-E40 PolarHBondContact O-N 3.44Å
37	H	64.6	Low	71.8	Confident	114 Å²	114	103.2 Å²	103.2	53%	0.528	52%	0.52	S	S	.	.	H	α-helix	trans	-64.6	-32.2	176.6	-166.8	61.1	0	0	0	113.1	N33	N33-H37 VanDerWaalsContact O-CB 3.29Å; N33-H37 WeakPolarHBondContact O-CB 3.29Å; N33-H37 PolarHBondContact O-N 3.38Å
38	S	60.2	Low	71.1	Confident	79 Å²	79	100.9 Å²	100.9	55%	0.552	52%	0.519	S	S	*	.	H	α-helix	trans	-76.2	-25.2	173.2	-56.4	0	0	0	0	112.7	S34 R35 L36	S34-S38 VanDerWaalsContact O-CB 3.28Å; S34-S38 WeakPolarHBondContact O-CB 3.4Å; S34-S38 PolarHBondContact O-N 3.19Å; S34-S38 PolarHBondContact O-OG 3.15Å; R35-S38 CarbonylContact O-C 3.51Å; R35-S38 PolarHBondContact O-N 2.77Å; L36-S38 VanDerWaalsContact C-N 3.28Å; L36-S38 PolarHBondContact O-N 3.32Å
39	Q	57.6	Low	70.8	Confident	151 Å²	151	102 Å²	102	71%	0.706	52%	0.524	S	S	*	.	H	α-helix	trans	-95.7	-33.6	-175.8	-166.6	171.6	14.6	0	0	112.3	R35 L36 L41 S42	R35-Q39 WeakPolarHBondContact O-CB 3.32Å; R35-Q39 PolarHBondContact O-N 2.95Å; L36-Q39 CarbonylContact O-C 3.49Å; L36-Q39 PolarHBondContact O-N 2.84Å; Q39-L41 VanDerWaalsContact C-N 3.32Å; Q39-S42 PolarHBondContact O-N 2.87Å
40	E	55.1	Low	70.7	Confident	133 Å²	133	101.6 Å²	101.6	62%	0.621	52%	0.519	S	S	*	.	H	α-helix	trans	-70.1	-29.3	172.3	-85.8	173.3	143.3	0	0	111.6	L36 S42	L36-E40 VanDerWaalsContact CD2-OE2 3.3Å; L36-E40 WeakPolarHBondContact CD2-OE2 3.44Å; L36-E40 HydrophobicContact CG-CG 4.26Å; L36-E40 VanDerWaalsContact O-CB 3.26Å; L36-E40 WeakPolarHBondContact O-CB 3.47Å; L36-E40 PolarHBondContact O-N 3.44Å; E40-S42 PolarHBondContact O-N 3.11Å
41	L	55.9	Low	70.7	Confident	51 Å²	51	102.7 Å²	102.7	27%	0.267	52%	0.522	S	S	.	.	S	Bend	trans	-97.3	72.5	164.2	-77	165.5	0	0	0	109.9	Q39 R46	Q39-L41 VanDerWaalsContact C-N 3.32Å; L41-R46 HydrophobicContact CB-CG 3.87Å; L41-R46 HydrophobicContact CD2-CG 3.8Å; L41-R46 HydrophobicContact CG-CG 4.27Å
42	S	64.6	Low	71	Confident	45 Å²	45	106.3 Å²	106.3	32%	0.315	53%	0.531	S	S	.	.			trans	-46.6	138.2	161.6	168.1	0	0	0	0	109.1	Q39 E40 E44 A45 R46	Q39-S42 PolarHBondContact O-N 2.87Å; E40-S42 PolarHBondContact O-N 3.11Å; S42-E44 PolarHBondContact O-N 2.84Å; S42-E44 PolarHBondContact OG-N 2.7Å; S42-A45 WeakPolarHBondContact O-CA 3.42Å; S42-A45 WeakPolarHBondContact O-CB 3.25Å; S42-A45 PolarHBondContact O-N 2.95Å; S42-R46 PolarHBondContact O-N 2.95Å; S42-R46 VanDerWaalsContact O-N 3.11Å
43	P	65.7	Low	71.4	Confident	86 Å²	86	108.3 Å²	108.3	56%	0.558	53%	0.532	S	S	*	.	H	α-helix	trans	-53.2	-23.4	178.6	19.7	-32.1	0	0	0	113.3	R47	P43-R47 WeakPolarHBondContact O-CB 3.49Å; P43-R47 WeakPolarHBondContact O-CD 3.28Å; P43-R47 WeakPolarHBondContact O-CG 3.38Å; P43-R47 PolarHBondContact O-N 3.37Å
44	E	65.6	Low	72.1	Confident	148 Å²	148	107.9 Å²	107.9	69%	0.692	53%	0.53	S	S	*	.	H	α-helix	trans	-72.5	-41.6	171.9	-74	169.5	151.7	0	0	113.2	S42 R47 S48	S42-E44 PolarHBondContact O-N 2.84Å; S42-E44 PolarHBondContact OG-N 2.7Å; E44-R47 PolarHBondContact O-N 2.92Å; E44-S48 PolarHBondContact O-N 3.34Å; E44-S48 PolarHBondContact O-OG 2.86Å
45	A	67.3	Low	73	Confident	38 Å²	38	107.2 Å²	107.2	31%	0.314	53%	0.526	S	S	.	.	H	α-helix	trans	-67.4	-35.1	176.6	0	0	0	0	0	112.1	S42 S48 L49	S42-A45 WeakPolarHBondContact O-CA 3.42Å; S42-A45 WeakPolarHBondContact O-CB 3.25Å; S42-A45 PolarHBondContact O-N 2.95Å; A45-S48 WeakPolarHBondContact CA-OG 3.26Å; A45-S48 PolarHBondContact O-OG 3.3Å; A45-L49 VanDerWaalsContact O-CB 3.26Å; A45-L49 WeakPolarHBondContact O-CB 3.49Å; A45-L49 PolarHBondContact O-N 3.17Å
46	R	73.9	Confident	74.2	Confident	120 Å²	120	103.7 Å²	103.7	45%	0.453	52%	0.52	S	S	.	.	H	α-helix	trans	-64.4	-46.7	171	-75.7	-176.9	174.9	171.3	5.2	111.7	L41 S42 S48 L49 E50	L41-R46 HydrophobicContact CB-CG 3.87Å; L41-R46 HydrophobicContact CD2-CG 3.8Å; L41-R46 HydrophobicContact CG-CG 4.27Å; S42-R46 PolarHBondContact O-N 2.95Å; S42-R46 VanDerWaalsContact O-N 3.11Å; R46-S48 PolarHBondContact O-N 3.34Å; R46-L49 PolarHBondContact O-N 2.86Å; R46-E50 VanDerWaalsContact O-CB 3.25Å; R46-E50 WeakPolarHBondContact O-CB 3.22Å; R46-E50 PolarHBondContact O-N 3.02Å
47	R	75.9	Confident	75.6	Confident	179 Å²	179	106.4 Å²	106.4	68%	0.675	53%	0.532	S	S	*	.	H	α-helix	trans	-64.2	-39.1	178.2	-74.9	172.6	-175.4	172.1	2.7	112.2	P43 E44 K51	P43-R47 WeakPolarHBondContact O-CB 3.49Å; P43-R47 WeakPolarHBondContact O-CD 3.28Å; P43-R47 WeakPolarHBondContact O-CG 3.38Å; P43-R47 PolarHBondContact O-N 3.37Å; E44-R47 PolarHBondContact O-N 2.92Å; R47-K51 VanDerWaalsContact O-CB 3.25Å; R47-K51 WeakPolarHBondContact O-CB 3.31Å; R47-K51 PolarHBondContact O-N 2.92Å
48	S	77.9	Confident	76.9	Confident	71 Å²	71	103.7 Å²	103.7	50%	0.497	53%	0.526	S	S	.	.	H	α-helix	trans	-66.1	-44	176.5	63.6	0	0	0	0	111.3	E44 A45 R46 K51 E52	E44-S48 PolarHBondContact O-N 3.34Å; E44-S48 PolarHBondContact O-OG 2.86Å; A45-S48 WeakPolarHBondContact CA-OG 3.26Å; A45-S48 PolarHBondContact O-OG 3.3Å; R46-S48 PolarHBondContact O-N 3.34Å; S48-K51 PolarHBondContact O-N 2.87Å; S48-E52 WeakPolarHBondContact O-CB 3.46Å; S48-E52 PolarHBondContact O-N 3.49Å
49	L	80.5	Confident	78.5	Confident	106 Å²	106	105.3 Å²	105.3	56%	0.555	52%	0.523	S	S	*	.	H	α-helix	trans	-67.4	-37.5	178.7	-161.1	73.4	0	0	0	112	A45 R46 E52 K53	A45-L49 VanDerWaalsContact O-CB 3.26Å; A45-L49 WeakPolarHBondContact O-CB 3.49Å; A45-L49 PolarHBondContact O-N 3.17Å; R46-L49 PolarHBondContact O-N 2.86Å; L49-E52 PolarHBondContact O-N 2.87Å; L49-K53 VanDerWaalsContact O-CB 3.31Å; L49-K53 WeakPolarHBondContact O-CB 3.48Å; L49-K53 PolarHBondContact O-N 2.83Å
50	E	82.9	Confident	80.2	Confident	114 Å²	114	100.5 Å²	100.5	53%	0.533	51%	0.509	S	S	.	.	H	α-helix	trans	-69.3	-37.9	175.9	-170.1	158.1	-151.4	0	0	111.8	R46 K53 N54	R46-E50 VanDerWaalsContact O-CB 3.25Å; R46-E50 WeakPolarHBondContact O-CB 3.22Å; R46-E50 PolarHBondContact O-N 3.02Å; E50-K53 PolarHBondContact O-N 3.37Å; E50-N54 WeakPolarHBondContact O-CB 3.31Å; E50-N54 PolarHBondContact O-N 2.9Å; E50-N54 PolarHBondContact O-ND2 3.38Å
51	K	87.9	Confident	82	Confident	163 Å²	163	96.4 Å²	96.4	71%	0.709	50%	0.495	S	S	*	.	H	α-helix	trans	-64.5	-42	171.9	-170.4	177.4	-177.9	-178.4	0	111.5	R47 S48 N54 S55	R47-K51 VanDerWaalsContact O-CB 3.25Å; R47-K51 WeakPolarHBondContact O-CB 3.31Å; R47-K51 PolarHBondContact O-N 2.92Å; S48-K51 PolarHBondContact O-N 2.87Å; K51-N54 PolarHBondContact O-N 3.44Å; K51-S55 WeakPolarHBondContact O-CB 3.25Å; K51-S55 PolarHBondContact O-N 2.93Å
52	E	88.5	Confident	83.8	Confident	120 Å²	120	98.4 Å²	98.4	56%	0.561	51%	0.506	S	S	*	.	H	α-helix	trans	-65.1	-46.5	176.4	-170.4	176.8	-173.9	0	0	111.3	S48 L49 N54 S55 L56	S48-E52 WeakPolarHBondContact O-CB 3.46Å; S48-E52 PolarHBondContact O-N 3.49Å; L49-E52 PolarHBondContact O-N 2.87Å; E52-N54 VanDerWaalsContact C-N 3.33Å; E52-N54 PolarHBondContact O-N 3.21Å; E52-S55 CarbonylContact O-C 3.57Å; E52-S55 WeakPolarHBondContact O-CB 3.34Å; E52-S55 PolarHBondContact O-N 2.8Å; E52-S55 VanDerWaalsContact O-N 3.13Å; E52-L56 PolarHBondContact O-N 3.13Å
53	K	90.7	Very high	85.2	Confident	137 Å²	137	103.8 Å²	103.8	60%	0.596	52%	0.521	S	S	*	.	H	α-helix	trans	-54.4	-48.5	173.3	177.5	-172.7	169.2	-174.8	0	111.4	L49 E50 S55 L56 M57	L49-K53 VanDerWaalsContact O-CB 3.31Å; L49-K53 WeakPolarHBondContact O-CB 3.48Å; L49-K53 PolarHBondContact O-N 2.83Å; E50-K53 PolarHBondContact O-N 3.37Å; K53-S55 VanDerWaalsContact C-N 3.33Å; K53-S55 PolarHBondContact O-N 3.14Å; K53-L56 PolarHBondContact O-N 3.38Å; K53-M57 WeakPolarHBondContact O-CB 3.46Å; K53-M57 PolarHBondContact O-N 3.31Å
54	N	92.3	Very high	86.4	Confident	90 Å²	90	105.6 Å²	105.6	48%	0.481	52%	0.522	S	S	.	.	H	α-helix	trans	-65.1	-37.7	179.2	-70.9	-17.5	0	0	0	111.8	E50 K51 E52 S58	E50-N54 WeakPolarHBondContact O-CB 3.31Å; E50-N54 PolarHBondContact O-N 2.9Å; E50-N54 PolarHBondContact O-ND2 3.38Å; K51-N54 PolarHBondContact O-N 3.44Å; E52-N54 VanDerWaalsContact C-N 3.33Å; E52-N54 PolarHBondContact O-N 3.21Å; N54-S58 WeakPolarHBondContact O-CB 3.35Å; N54-S58 PolarHBondContact O-N 2.98Å; N54-S58 PolarHBondContact O-OG 3.37Å
55	S	92.6	Very high	87.7	Confident	49 Å²	49	105.2 Å²	105.2	34%	0.343	52%	0.518	S	S	.	.	H	α-helix	trans	-66.3	-37	173	-178.9	0	0	0	0	112.7	K51 E52 K53 S58 K59	K51-S55 WeakPolarHBondContact O-CB 3.25Å; K51-S55 PolarHBondContact O-N 2.93Å; E52-S55 CarbonylContact O-C 3.57Å; E52-S55 WeakPolarHBondContact O-CB 3.34Å; E52-S55 PolarHBondContact O-N 2.8Å; E52-S55 VanDerWaalsContact O-N 3.13Å; K53-S55 VanDerWaalsContact C-N 3.33Å; K53-S55 PolarHBondContact O-N 3.14Å; S55-S58 PolarHBondContact O-OG 2.98Å; S55-K59 VanDerWaalsContact O-CG 3.31Å; S55-K59 WeakPolarHBondContact O-CG 3.38Å; S55-K59 PolarHBondContact O-N 3.47Å; S55-K59 VanDerWaalsContact O-N 3.14Å
56	L	94.6	Very high	88.8	Confident	109 Å²	109	109 Å²	109	57%	0.571	53%	0.529	S	S	*	.	H	α-helix	trans	-69.8	-42.4	177.9	-129.7	75.4	0	0	0	110.4	E52 K53 K59 A60	E52-L56 PolarHBondContact O-N 3.13Å; K53-L56 PolarHBondContact O-N 3.38Å; L56-K59 PolarHBondContact O-N 2.94Å; L56-A60 WeakPolarHBondContact O-CB 3.42Å; L56-A60 PolarHBondContact O-N 3.5Å
57	M	92.5	Very high	89.6	Confident	132 Å²	132	107.5 Å²	107.5	65%	0.65	53%	0.529	S	S	*	.	H	α-helix	trans	-63.4	-41.4	177.7	-169.7	169.5	178.8	0	0	111.7	K53 A60 S61	K53-M57 WeakPolarHBondContact O-CB 3.46Å; K53-M57 PolarHBondContact O-N 3.31Å; M57-A60 PolarHBondContact O-N 3.46Å; M57-S61 PolarHBondContact O-N 3.42Å
58	S	92.6	Very high	90.2	Very high	57 Å²	57	105.9 Å²	105.9	40%	0.399	53%	0.527	S	S	.	.	H	α-helix	trans	-65.8	-44.5	176.1	69.2	0	0	0	0	111.9	N54 S55 A60 S61 N62	N54-S58 WeakPolarHBondContact O-CB 3.35Å; N54-S58 PolarHBondContact O-N 2.98Å; N54-S58 PolarHBondContact O-OG 3.37Å; S55-S58 PolarHBondContact O-OG 2.98Å; S58-A60 PolarHBondContact O-N 3.48Å; S58-S61 PolarHBondContact O-N 3.3Å; S58-S61 PolarHBondContact O-OG 3.18Å; S58-N62 PolarHBondContact O-N 3.39Å
59	K	94.3	Very high	90.8	Very high	112 Å²	112	107.8 Å²	107.8	49%	0.487	53%	0.527	S	S	.	.	H	α-helix	trans	-58.2	-46.9	174	-75.9	176.8	-179	179	0	112	S55 L56 S61 N62 Y63	S55-K59 VanDerWaalsContact O-CG 3.31Å; S55-K59 WeakPolarHBondContact O-CG 3.38Å; S55-K59 PolarHBondContact O-N 3.47Å; S55-K59 VanDerWaalsContact O-N 3.14Å; L56-K59 PolarHBondContact O-N 2.94Å; K59-S61 VanDerWaalsContact C-N 3.33Å; K59-S61 PolarHBondContact O-N 2.98Å; K59-N62 PolarHBondContact O-N 2.75Å; K59-Y63 HydrophobicContact CB-CE2 4.42Å; K59-Y63 WeakPolarHBondContact O-CD2 3.24Å; K59-Y63 PolarHBondContact O-N 3.42Å
60	A	92.2	Very high	91	Very high	51 Å²	51	107.3 Å²	107.3	42%	0.421	52%	0.524	S	S	.	.	H	α-helix	trans	-58.4	-45.6	177.1	0	0	0	0	0	111.5	L56 M57 S58 N62 Y63 E64	L56-A60 WeakPolarHBondContact O-CB 3.42Å; L56-A60 PolarHBondContact O-N 3.5Å; M57-A60 PolarHBondContact O-N 3.46Å; S58-A60 PolarHBondContact O-N 3.48Å; A60-N62 VanDerWaalsContact C-N 3.3Å; A60-N62 PolarHBondContact O-N 3.26Å; A60-Y63 PolarHBondContact O-N 3.45Å; A60-E64 PolarHBondContact O-N 3.38Å
61	S	92.9	Very high	91.3	Very high	46 Å²	46	109.6 Å²	109.6	32%	0.322	53%	0.528	S	S	.	.	H	α-helix	trans	-64.7	-32.9	178	77	0	0	0	0	113.4	M57 S58 K59 K65	M57-S61 PolarHBondContact O-N 3.42Å; S58-S61 PolarHBondContact O-N 3.3Å; S58-S61 PolarHBondContact O-OG 3.18Å; K59-S61 VanDerWaalsContact C-N 3.33Å; K59-S61 PolarHBondContact O-N 2.98Å; S61-K65 WeakPolarHBondContact O-CG 3.48Å; S61-K65 PolarHBondContact O-N 2.88Å
62	N	94.4	Very high	91.3	Very high	94 Å²	94	107.2 Å²	107.2	50%	0.503	52%	0.519	S	S	.	.	H	α-helix	trans	-70.1	-45	175.6	-84.2	-1.4	0	0	0	111.2	S58 K59 A60 E64 K65 E66	S58-N62 PolarHBondContact O-N 3.39Å; K59-N62 PolarHBondContact O-N 2.75Å; A60-N62 VanDerWaalsContact C-N 3.3Å; A60-N62 PolarHBondContact O-N 3.26Å; N62-E64 VanDerWaalsContact C-N 3.29Å; N62-E64 PolarHBondContact O-N 2.98Å; N62-K65 WeakPolarHBondContact O-CB 3.49Å; N62-K65 PolarHBondContact O-N 3.02Å; N62-K65 VanDerWaalsContact O-N 3.14Å; N62-E66 PolarHBondContact O-N 2.89Å
63	Y	93.3	Very high	91.2	Very high	158 Å²	158	105.4 Å²	105.4	62%	0.62	51%	0.511	S	S	*	.	H	α-helix	trans	-60.4	-39.1	175.6	-65.9	-38.4	0	0	0	112.2	K59 A60 K65 E66 L67	K59-Y63 HydrophobicContact CB-CE2 4.42Å; K59-Y63 WeakPolarHBondContact O-CD2 3.24Å; K59-Y63 PolarHBondContact O-N 3.42Å; A60-Y63 PolarHBondContact O-N 3.45Å; Y63-K65 VanDerWaalsContact C-N 3.34Å; Y63-K65 PolarHBondContact O-N 3.01Å; Y63-E66 PolarHBondContact O-N 2.99Å; Y63-L67 VanDerWaalsContact O-CB 3.24Å; Y63-L67 WeakPolarHBondContact O-CB 3.38Å; Y63-L67 PolarHBondContact O-N 3.14Å
64	E	92	Very high	91	Very high	123 Å²	123	104.2 Å²	104.2	58%	0.575	51%	0.511	S	S	*	.	H	α-helix	trans	-61.8	-40.9	174.7	-76.2	-169.1	166	0	0	113	A60 N62 K68	A60-E64 PolarHBondContact O-N 3.38Å; N62-E64 VanDerWaalsContact C-N 3.29Å; N62-E64 PolarHBondContact O-N 2.98Å; E64-K68 WeakPolarHBondContact O-CB 3.5Å; E64-K68 WeakPolarHBondContact O-CG 3.32Å; E64-K68 PolarHBondContact O-N 3.46Å
65	K	92.6	Very high	90.7	Very high	140 Å²	140	109 Å²	109	61%	0.609	52%	0.522	S	S	*	.	H	α-helix	trans	-64.6	-46.4	177.7	-73.6	172.9	-176.3	173.2	0	111.1	S61 N62 Y63 K68 F69	S61-K65 WeakPolarHBondContact O-CG 3.48Å; S61-K65 PolarHBondContact O-N 2.88Å; N62-K65 WeakPolarHBondContact O-CB 3.49Å; N62-K65 PolarHBondContact O-N 3.02Å; N62-K65 VanDerWaalsContact O-N 3.14Å; Y63-K65 VanDerWaalsContact C-N 3.34Å; Y63-K65 PolarHBondContact O-N 3.01Å; K65-K68 PolarHBondContact O-N 2.98Å; K65-F69 WeakPolarHBondContact O-CB 3.33Å; K65-F69 PolarHBondContact O-N 3.35Å
66	E	90.9	Very high	90.6	Very high	119 Å²	119	112.1 Å²	112.1	56%	0.556	53%	0.53	S	S	*	.	H	α-helix	trans	-64	-41.8	179.1	-165.9	167.2	-166.3	0	0	111.3	N62 Y63 K68 F69 L70	N62-E66 PolarHBondContact O-N 2.89Å; Y63-E66 PolarHBondContact O-N 2.99Å; E66-K68 PolarHBondContact O-N 3.4Å; E66-F69 WeakPolarHBondContact O-CB 3.32Å; E66-F69 PolarHBondContact O-N 3.42Å; E66-L70 HydrophobicContact CG-CD1 4.41Å; E66-L70 WeakPolarHBondContact O-CB 3.46Å; E66-L70 WeakPolarHBondContact O-CG 3.43Å; E66-L70 PolarHBondContact O-N 3.23Å
67	L	90.1	Very high	90.3	Very high	87 Å²	87	111.8 Å²	111.8	46%	0.455	53%	0.529	S	S	.	.	H	α-helix	trans	-62.7	-40.8	175.1	-162.3	97.7	0	0	0	112.2	Y63 R71	Y63-L67 VanDerWaalsContact O-CB 3.24Å; Y63-L67 WeakPolarHBondContact O-CB 3.38Å; Y63-L67 PolarHBondContact O-N 3.14Å; L67-R71 VanDerWaalsContact CD2-CZ 3.46Å; L67-R71 VanDerWaalsContact CD2-NH1 3.29Å; L67-R71 WeakPolarHBondContact O-CB 3.48Å; L67-R71 VanDerWaalsContact O-CG 3.32Å; L67-R71 WeakPolarHBondContact O-CG 3.47Å; L67-R71 PolarHBondContact O-N 2.97Å
68	K	89	Confident	90.2	Very high	145 Å²	145	111.5 Å²	111.5	63%	0.63	53%	0.527	S	S	*	.	H	α-helix	trans	-64.8	-42.8	175	-79.7	179.8	-178.6	174.5	0	111.3	E64 K65 E66 R71 Q72	E64-K68 WeakPolarHBondContact O-CB 3.5Å; E64-K68 WeakPolarHBondContact O-CG 3.32Å; E64-K68 PolarHBondContact O-N 3.46Å; K65-K68 PolarHBondContact O-N 2.98Å; E66-K68 PolarHBondContact O-N 3.4Å; K68-R71 PolarHBondContact O-N 3.22Å; K68-Q72 WeakPolarHBondContact O-CB 3.42Å; K68-Q72 PolarHBondContact O-N 3.34Å
69	F	89.1	Confident	90.2	Very high	112 Å²	112	114.7 Å²	114.7	49%	0.491	54%	0.539	S	S	.	.	H	α-helix	trans	-60.5	-51.5	176.7	-179.3	-97.7	0	0	0	111.3	K65 E66 R71 Q72 E73	K65-F69 WeakPolarHBondContact O-CB 3.33Å; K65-F69 PolarHBondContact O-N 3.35Å; E66-F69 WeakPolarHBondContact O-CB 3.32Å; E66-F69 PolarHBondContact O-N 3.42Å; F69-R71 VanDerWaalsContact C-N 3.33Å; F69-R71 PolarHBondContact O-N 3.1Å; F69-Q72 WeakPolarHBondContact O-CB 3.38Å; F69-Q72 PolarHBondContact O-N 2.87Å; F69-E73 HydrophobicContact CD1-CG 4.47Å; F69-E73 HydrophobicContact CE1-CG 4.02Å; F69-E73 WeakPolarHBondContact CE1-OE2 3.45Å; F69-E73 HydrophobicContact CZ-CG 4.08Å; F69-E73 PolarHBondContact O-N 2.84Å
70	L	86.5	Confident	90.1	Very high	96 Å²	96	114.5 Å²	114.5	50%	0.503	54%	0.543	S	S	.	.	H	α-helix	trans	-61	-39.4	178.1	-69.7	174.1	0	0	0	112.5	E66 Q72 E73 N74	E66-L70 HydrophobicContact CG-CD1 4.41Å; E66-L70 WeakPolarHBondContact O-CB 3.46Å; E66-L70 WeakPolarHBondContact O-CG 3.43Å; E66-L70 PolarHBondContact O-N 3.23Å; L70-Q72 VanDerWaalsContact C-N 3.31Å; L70-Q72 PolarHBondContact O-N 2.92Å; L70-E73 PolarHBondContact O-N 3.43Å; L70-N74 WeakPolarHBondContact O-CB 3.38Å; L70-N74 PolarHBondContact O-N 3.27Å
71	R	89.1	Confident	90.2	Very high	161 Å²	161	114.7 Å²	114.7	61%	0.608	54%	0.541	S	S	*	.	H	α-helix	trans	-64	-37.3	174.5	-80	179.7	175.2	153.3	0.8	112.3	L67 K68 F69 R75	L67-R71 VanDerWaalsContact CD2-CZ 3.46Å; L67-R71 VanDerWaalsContact CD2-NH1 3.29Å; L67-R71 WeakPolarHBondContact O-CB 3.48Å; L67-R71 VanDerWaalsContact O-CG 3.32Å; L67-R71 WeakPolarHBondContact O-CG 3.47Å; L67-R71 PolarHBondContact O-N 2.97Å; K68-R71 PolarHBondContact O-N 3.22Å; F69-R71 VanDerWaalsContact C-N 3.33Å; F69-R71 PolarHBondContact O-N 3.1Å; R71-R75 WeakPolarHBondContact O-CG 3.15Å; R71-R75 PolarHBondContact O-N 3.04Å; R71-R75 VanDerWaalsContact O-N 3.1Å
72	Q	88	Confident	90.3	Very high	113 Å²	113	115.8 Å²	115.8	53%	0.528	55%	0.546	S	S	.	.	H	α-helix	trans	-68.2	-42.9	177.1	-173.7	178.2	-3.5	0	0	111.2	K68 F69 L70 R75 K76	K68-Q72 WeakPolarHBondContact O-CB 3.42Å; K68-Q72 PolarHBondContact O-N 3.34Å; F69-Q72 WeakPolarHBondContact O-CB 3.38Å; F69-Q72 PolarHBondContact O-N 2.87Å; L70-Q72 VanDerWaalsContact C-N 3.31Å; L70-Q72 PolarHBondContact O-N 2.92Å; Q72-R75 PolarHBondContact O-N 3.42Å; Q72-K76 WeakPolarHBondContact O-CG 3.49Å; Q72-K76 PolarHBondContact O-N 3.25Å; Q72-K76 VanDerWaalsContact O-N 3.09Å
73	E	85.3	Confident	90.3	Very high	82 Å²	82	113.5 Å²	113.5	38%	0.383	54%	0.54	S	S	.	.	H	α-helix	trans	-64.2	-42.7	174.5	-72.5	-165.5	127.4	0	0	112.3	F69 L70 R75 K76 N77	F69-E73 HydrophobicContact CD1-CG 4.47Å; F69-E73 HydrophobicContact CE1-CG 4.02Å; F69-E73 WeakPolarHBondContact CE1-OE2 3.45Å; F69-E73 HydrophobicContact CZ-CG 4.08Å; F69-E73 PolarHBondContact O-N 2.84Å; L70-E73 PolarHBondContact O-N 3.43Å; E73-R75 VanDerWaalsContact C-N 3.29Å; E73-R75 PolarHBondContact O-N 2.94Å; E73-K76 WeakPolarHBondContact O-CA 3.39Å; E73-K76 WeakPolarHBondContact O-CB 3.18Å; E73-K76 PolarHBondContact O-N 3.05Å; E73-N77 PolarHBondContact O-N 2.99Å
74	N	86.4	Confident	90.5	Very high	113 Å²	113	110.7 Å²	110.7	60%	0.604	54%	0.535	S	S	*	.	H	α-helix	trans	-60.9	-39.7	177.3	-162.9	-15.5	0	0	0	111.6	L70 K76 N77 M78	L70-N74 WeakPolarHBondContact O-CB 3.38Å; L70-N74 PolarHBondContact O-N 3.27Å; N74-K76 PolarHBondContact O-N 3.23Å; N74-N77 PolarHBondContact O-N 2.94Å; N74-M78 WeakPolarHBondContact O-CB 3.39Å; N74-M78 PolarHBondContact O-N 2.97Å
75	R	86.8	Confident	90.7	Very high	189 Å²	189	111 Å²	111	71%	0.713	54%	0.535	S	S	*	.	H	α-helix	trans	-61.1	-42.7	171.5	-76.5	-179.1	-179.6	-173.9	0.1	112.5	R71 Q72 E73 M78 L79	R71-R75 WeakPolarHBondContact O-CG 3.15Å; R71-R75 PolarHBondContact O-N 3.04Å; R71-R75 VanDerWaalsContact O-N 3.1Å; Q72-R75 PolarHBondContact O-N 3.42Å; E73-R75 VanDerWaalsContact C-N 3.29Å; E73-R75 PolarHBondContact O-N 2.94Å; R75-M78 PolarHBondContact O-N 3.41Å; R75-L79 WeakPolarHBondContact O-CG 3.45Å; R75-L79 PolarHBondContact O-N 2.89Å
76	K	89.6	Confident	90.9	Very high	116 Å²	116	108.9 Å²	108.9	50%	0.504	53%	0.529	S	S	.	.	H	α-helix	trans	-62.6	-43.7	175.6	-70	177.8	-179.8	178.4	0	111.2	Q72 E73 N74 M78 L79 L80	Q72-K76 WeakPolarHBondContact O-CG 3.49Å; Q72-K76 PolarHBondContact O-N 3.25Å; Q72-K76 VanDerWaalsContact O-N 3.09Å; E73-K76 WeakPolarHBondContact O-CA 3.39Å; E73-K76 WeakPolarHBondContact O-CB 3.18Å; E73-K76 PolarHBondContact O-N 3.05Å; N74-K76 PolarHBondContact O-N 3.23Å; K76-M78 PolarHBondContact O-N 3.03Å; K76-L79 PolarHBondContact O-N 3.47Å; K76-L80 WeakPolarHBondContact O-CG 3.37Å; K76-L80 PolarHBondContact O-N 3.09Å
77	N	88.5	Confident	91.1	Very high	101 Å²	101	108.4 Å²	108.4	54%	0.54	53%	0.53	S	S	.	.	H	α-helix	trans	-64	-39.9	178.4	-72.8	-0.7	0	0	0	112.1	E73 N74 L80 S81	E73-N77 PolarHBondContact O-N 2.99Å; N74-N77 PolarHBondContact O-N 2.94Å; N77-L80 PolarHBondContact O-N 3.46Å; N77-S81 WeakPolarHBondContact O-CB 3.48Å; N77-S81 PolarHBondContact O-N 3.25Å
78	M	90.6	Very high	91.4	Very high	127 Å²	127	109.4 Å²	109.4	63%	0.626	53%	0.534	S	S	*	.	H	α-helix	trans	-60.9	-47.3	173	-177.3	-175	175.6	0	0	111.3	N74 R75 K76 L80 S81 V82	N74-M78 WeakPolarHBondContact O-CB 3.39Å; N74-M78 PolarHBondContact O-N 2.97Å; R75-M78 PolarHBondContact O-N 3.41Å; K76-M78 PolarHBondContact O-N 3.03Å; M78-L80 VanDerWaalsContact C-N 3.34Å; M78-L80 PolarHBondContact O-N 3.24Å; M78-S81 WeakPolarHBondContact O-CB 3.48Å; M78-S81 PolarHBondContact O-N 3.24Å; M78-V82 WeakPolarHBondContact O-CG2 3.49Å; M78-V82 PolarHBondContact O-N 3.42Å
79	L	92.1	Very high	91.7	Very high	124 Å²	124	106.8 Å²	106.8	65%	0.649	53%	0.531	S	S	*	.	H	α-helix	trans	-61.9	-41.4	178.1	-71.8	172.9	0	0	0	112.1	R75 K76 V82 A83	R75-L79 WeakPolarHBondContact O-CG 3.45Å; R75-L79 PolarHBondContact O-N 2.89Å; K76-L79 PolarHBondContact O-N 3.47Å; L79-V82 PolarHBondContact O-N 3.29Å; L79-A83 WeakPolarHBondContact O-CB 3.31Å; L79-A83 PolarHBondContact O-N 3.48Å
80	L	93.4	Very high	92.1	Very high	108 Å²	108	106.7 Å²	106.7	57%	0.565	54%	0.535	S	S	*	.	H	α-helix	trans	-61.4	-44.8	175	-73.6	171.4	0	0	0	111.5	K76 N77 M78 V82 A83 I84	K76-L80 WeakPolarHBondContact O-CG 3.37Å; K76-L80 PolarHBondContact O-N 3.09Å; N77-L80 PolarHBondContact O-N 3.46Å; M78-L80 VanDerWaalsContact C-N 3.34Å; M78-L80 PolarHBondContact O-N 3.24Å; L80-V82 PolarHBondContact O-N 3.4Å; L80-A83 PolarHBondContact O-N 3Å; L80-I84 VanDerWaalsContact O-CG1 3.31Å; L80-I84 WeakPolarHBondContact O-CG1 3.43Å; L80-I84 PolarHBondContact O-N 2.98Å
81	S	92.8	Very high	92.5	Very high	55 Å²	55	106.6 Å²	106.6	39%	0.385	54%	0.538	S	S	.	.	H	α-helix	trans	-58	-48.7	175.7	179.9	0	0	0	0	111.5	N77 M78 A83 I84 F85	N77-S81 WeakPolarHBondContact O-CB 3.48Å; N77-S81 PolarHBondContact O-N 3.25Å; M78-S81 WeakPolarHBondContact O-CB 3.48Å; M78-S81 PolarHBondContact O-N 3.24Å; S81-A83 VanDerWaalsContact C-N 3.35Å; S81-A83 PolarHBondContact O-N 3.39Å; S81-I84 PolarHBondContact O-N 2.93Å; S81-F85 WeakPolarHBondContact O-CD2 3.36Å; S81-F85 PolarHBondContact O-N 3.45Å
82	V	94.8	Very high	92.8	Very high	69 Å²	69	106.9 Å²	106.9	42%	0.418	54%	0.541	S	S	.	.	H	α-helix	trans	-60.5	-43	177	173.1	0	0	0	0	111.6	M78 L79 L80 I84 F85 I86	M78-V82 WeakPolarHBondContact O-CG2 3.49Å; M78-V82 PolarHBondContact O-N 3.42Å; L79-V82 PolarHBondContact O-N 3.29Å; L80-V82 PolarHBondContact O-N 3.4Å; V82-I84 VanDerWaalsContact C-N 3.34Å; V82-I84 PolarHBondContact O-N 3.27Å; V82-F85 PolarHBondContact O-N 3.37Å; V82-I86 HydrophobicContact CG1-CD1 3.95Å; V82-I86 WeakPolarHBondContact O-CG1 3.29Å; V82-I86 PolarHBondContact O-N 3.48Å
83	A	96.1	Very high	93.2	Very high	46 Å²	46	103.7 Å²	103.7	38%	0.38	53%	0.533	S	S	.	.	H	α-helix	trans	-61.2	-42.3	177.6	0	0	0	0	0	112	L79 L80 S81 I86 L87	L79-A83 WeakPolarHBondContact O-CB 3.31Å; L79-A83 PolarHBondContact O-N 3.48Å; L80-A83 PolarHBondContact O-N 3Å; S81-A83 VanDerWaalsContact C-N 3.35Å; S81-A83 PolarHBondContact O-N 3.39Å; A83-I86 PolarHBondContact O-N 2.87Å; A83-L87 WeakPolarHBondContact O-CG 3.29Å; A83-L87 PolarHBondContact O-N 2.88Å
84	I	96.4	Very high	93.6	Very high	99 Å²	99	109 Å²	109	51%	0.508	55%	0.551	S	S	.	*	H	α-helix	trans	-62.3	-44.9	175.6	-67.3	164	0	0	0	110.6	L80 S81 V82 I86 L87 L88	L80-I84 VanDerWaalsContact O-CG1 3.31Å; L80-I84 WeakPolarHBondContact O-CG1 3.43Å; L80-I84 PolarHBondContact O-N 2.98Å; S81-I84 PolarHBondContact O-N 2.93Å; V82-I84 VanDerWaalsContact C-N 3.34Å; V82-I84 PolarHBondContact O-N 3.27Å; I84-I86 VanDerWaalsContact C-N 3.31Å; I84-I86 PolarHBondContact O-N 3.49Å; I84-L87 PolarHBondContact O-N 2.9Å; I84-L88 HydrophobicContact CG2-CD1 4Å; I84-L88 HydrophobicContact CG2-CG 4.34Å; I84-L88 WeakPolarHBondContact O-CG 3.4Å; I84-L88 PolarHBondContact O-N 2.92Å
85	F	96.4	Very high	93.9	Very high	130 Å²	130	114.2 Å²	114.2	57%	0.57	56%	0.563	S	S	*	*	H	α-helix	trans	-59	-41.5	176.4	-83.7	-66.7	0	0	0	112.5	S81 V82 L88 T89	S81-F85 WeakPolarHBondContact O-CD2 3.36Å; S81-F85 PolarHBondContact O-N 3.45Å; V82-F85 PolarHBondContact O-N 3.37Å; F85-L88 PolarHBondContact O-N 3.2Å; F85-T89 WeakPolarHBondContact O-CB 3.37Å; F85-T89 PolarHBondContact O-N 3.49Å; F85-T89 PolarHBondContact O-OG1 3.02Å
86	I	96.4	Very high	93.9	Very high	94 Å²	94	109.1 Å²	109.1	48%	0.482	55%	0.553	S	S	.	*	H	α-helix	trans	-63.1	-46.8	177	-67.6	165.4	0	0	0	110.4	V82 A83 I84 L88 T89 L90	V82-I86 HydrophobicContact CG1-CD1 3.95Å; V82-I86 WeakPolarHBondContact O-CG1 3.29Å; V82-I86 PolarHBondContact O-N 3.48Å; A83-I86 PolarHBondContact O-N 2.87Å; I84-I86 VanDerWaalsContact C-N 3.31Å; I84-I86 PolarHBondContact O-N 3.49Å; I86-L88 PolarHBondContact O-N 2.91Å; I86-T89 PolarHBondContact O-N 3.46Å; I86-L90 HydrophobicContact CG2-CD1 4.07Å; I86-L90 HydrophobicContact CG2-CG 4.42Å; I86-L90 WeakPolarHBondContact O-CG 3.35Å; I86-L90 PolarHBondContact O-N 2.7Å
87	L	96.7	Very high	93.2	Very high	110 Å²	110	113.9 Å²	113.9	58%	0.576	58%	0.579	S	S	*	*	H	α-helix	trans	-59.5	-46	177.8	-70.9	174.1	0	0	0	111.7	A83 I84 T89 L90 V91	A83-L87 WeakPolarHBondContact O-CG 3.29Å; A83-L87 PolarHBondContact O-N 2.88Å; I84-L87 PolarHBondContact O-N 2.9Å; L87-T89 VanDerWaalsContact C-N 3.32Å; L87-T89 PolarHBondContact O-N 3.44Å; L87-L90 PolarHBondContact O-N 3.31Å; L87-V91 WeakPolarHBondContact O-CG2 3.32Å; L87-V91 PolarHBondContact O-N 2.89Å
88	L	95.9	Very high	93.5	Very high	107 Å²	107	114.6 Å²	114.6	56%	0.56	58%	0.581	S	S	*	*	H	α-helix	trans	-60.8	-42.1	176.2	-70.7	173.8	0	0	0	111.8	I84 F85 I86 L90 V91 Y92	I84-L88 HydrophobicContact CG2-CD1 4Å; I84-L88 HydrophobicContact CG2-CG 4.34Å; I84-L88 WeakPolarHBondContact O-CG 3.4Å; I84-L88 PolarHBondContact O-N 2.92Å; F85-L88 PolarHBondContact O-N 3.2Å; I86-L88 PolarHBondContact O-N 2.91Å; L88-L90 VanDerWaalsContact C-N 3.35Å; L88-L90 PolarHBondContact O-N 3.44Å; L88-V91 PolarHBondContact O-N 3.42Å; L88-Y92 VanDerWaalsContact O-CB 3.29Å; L88-Y92 WeakPolarHBondContact O-CB 3.35Å; L88-Y92 PolarHBondContact O-N 2.9Å
89	T	95.5	Very high	93.6	Very high	91 Å²	91	113.9 Å²	113.9	56%	0.558	58%	0.579	S	S	*	*	H	α-helix	trans	-63.2	-41.3	177.6	-53.4	0	0	0	0	111.4	F85 I86 L87 Y92 A93	F85-T89 WeakPolarHBondContact O-CB 3.37Å; F85-T89 PolarHBondContact O-N 3.49Å; F85-T89 PolarHBondContact O-OG1 3.02Å; I86-T89 PolarHBondContact O-N 3.46Å; L87-T89 VanDerWaalsContact C-N 3.32Å; L87-T89 PolarHBondContact O-N 3.44Å; T89-Y92 PolarHBondContact O-N 3.17Å; T89-A93 VanDerWaalsContact O-CB 3.29Å; T89-A93 WeakPolarHBondContact O-CB 3.35Å; T89-A93 PolarHBondContact O-N 2.9Å
90	L	95.8	Very high	93.7	Very high	110 Å²	110	113.3 Å²	113.3	58%	0.576	58%	0.575	S	S	*	*	H	α-helix	trans	-66.8	-44.3	177.2	-71.2	172.4	0	0	0	112.1	I86 L87 L88 Y92 A93 Y94	I86-L90 HydrophobicContact CG2-CD1 4.07Å; I86-L90 HydrophobicContact CG2-CG 4.42Å; I86-L90 WeakPolarHBondContact O-CG 3.35Å; I86-L90 PolarHBondContact O-N 2.7Å; L87-L90 PolarHBondContact O-N 3.31Å; L88-L90 VanDerWaalsContact C-N 3.35Å; L88-L90 PolarHBondContact O-N 3.44Å; L90-Y92 VanDerWaalsContact C-N 3.34Å; L90-A93 PolarHBondContact O-N 3.34Å; L90-Y94 VanDerWaalsContact O-CB 3.3Å; L90-Y94 WeakPolarHBondContact O-CB 3.3Å; L90-Y94 PolarHBondContact O-N 3Å
91	V	96.3	Very high	93.7	Very high	94 Å²	94	113.6 Å²	113.6	57%	0.57	58%	0.576	S	S	*	*	H	α-helix	trans	-61.8	-44.7	175.9	171.1	0	0	0	0	110.4	L87 L88 Y94 W95	L87-V91 WeakPolarHBondContact O-CG2 3.32Å; L87-V91 PolarHBondContact O-N 2.89Å; L88-V91 PolarHBondContact O-N 3.42Å; V91-Y94 PolarHBondContact O-N 3.44Å; V91-W95 WeakPolarHBondContact O-CB 3.33Å; V91-W95 PolarHBondContact O-N 2.99Å
92	Y	95.4	Very high	93.8	Very high	167 Å²	167	117.3 Å²	117.3	66%	0.655	59%	0.588	S	S	*	*	H	α-helix	trans	-60.6	-50.7	176.6	179.8	-98.8	0	0	0	111.1	L88 T89 L90 Y94 W95 T96	L88-Y92 VanDerWaalsContact O-CB 3.29Å; L88-Y92 WeakPolarHBondContact O-CB 3.35Å; L88-Y92 PolarHBondContact O-N 2.9Å; T89-Y92 PolarHBondContact O-N 3.17Å; L90-Y92 VanDerWaalsContact C-N 3.34Å; Y92-Y94 VanDerWaalsContact C-N 3.29Å; Y92-Y94 PolarHBondContact O-N 2.89Å; Y92-W95 PolarHBondContact O-N 3.4Å; Y92-T96 HydrophobicContact CD1-CG2 4.19Å; Y92-T96 HydrophobicContact CD2-CG2 4.31Å; Y92-T96 HydrophobicContact CE1-CG2 3.81Å; Y92-T96 HydrophobicContact CE2-CG2 3.94Å; Y92-T96 HydrophobicContact CG-CG2 4.43Å; Y92-T96 WeakPolarHBondContact O-CB 3.41Å; Y92-T96 WeakPolarHBondContact O-CG2 3.35Å; Y92-T96 PolarHBondContact O-N 2.9Å; Y92-T96 PolarHBondContact O-OG1 3.41Å
93	A	95.1	Very high	93.7	Very high	46 Å²	46	120.5 Å²	120.5	38%	0.38	60%	0.599	S	S	.	*	H	α-helix	trans	-58.4	-41.3	178.7	0	0	0	0	0	112.3	T89 L90 T96 M97	T89-A93 VanDerWaalsContact O-CB 3.29Å; T89-A93 WeakPolarHBondContact O-CB 3.35Å; T89-A93 PolarHBondContact O-N 2.9Å; L90-A93 PolarHBondContact O-N 3.34Å; A93-T96 VanDerWaalsContact CA-OG1 3.32Å; A93-T96 WeakPolarHBondContact CA-OG1 3.5Å; A93-T96 PolarHBondContact O-N 2.94Å; A93-T96 PolarHBondContact O-OG1 3.27Å; A93-M97 WeakPolarHBondContact O-CG 3.45Å; A93-M97 PolarHBondContact O-N 3.19Å
94	Y	94.7	Very high	93.6	Very high	193 Å²	193	125.9 Å²	125.9	76%	0.757	62%	0.615	S	S	*	*	H	α-helix	trans	-68.2	-39	176.9	-178.4	-100.5	0	0	0	112.7	L90 V91 Y92 T96	L90-Y94 VanDerWaalsContact O-CB 3.3Å; L90-Y94 WeakPolarHBondContact O-CB 3.3Å; L90-Y94 PolarHBondContact O-N 3Å; V91-Y94 PolarHBondContact O-N 3.44Å; Y92-Y94 VanDerWaalsContact C-N 3.29Å; Y92-Y94 PolarHBondContact O-N 2.89Å; Y94-T96 VanDerWaalsContact C-N 3.32Å
95	W	93	Very high	93.3	Very high	222 Å²	222	127.9 Å²	127.9	84%	0.841	62%	0.623	S	S	*	*	H	α-helix	trans	-70.4	-30.4	176.5	-170.6	-75.7	0	0	0	112.3	V91 Y92	V91-W95 WeakPolarHBondContact O-CB 3.33Å; V91-W95 PolarHBondContact O-N 2.99Å; Y92-W95 PolarHBondContact O-N 3.4Å
96	T	87.3	Confident	93.1	Very high	83 Å²	83	127.8 Å²	127.8	51%	0.509	63%	0.627	S	S	.	*	H	α-helix	trans	-81.7	-15.8	178.7	53.5	0	0	0	0	114.6	Y92 A93 Y94	Y92-T96 HydrophobicContact CD1-CG2 4.19Å; Y92-T96 HydrophobicContact CD2-CG2 4.31Å; Y92-T96 HydrophobicContact CE1-CG2 3.81Å; Y92-T96 HydrophobicContact CE2-CG2 3.94Å; Y92-T96 HydrophobicContact CG-CG2 4.43Å; Y92-T96 WeakPolarHBondContact O-CB 3.41Å; Y92-T96 WeakPolarHBondContact O-CG2 3.35Å; Y92-T96 PolarHBondContact O-N 2.9Å; Y92-T96 PolarHBondContact O-OG1 3.41Å; A93-T96 VanDerWaalsContact CA-OG1 3.32Å; A93-T96 WeakPolarHBondContact CA-OG1 3.5Å; A93-T96 PolarHBondContact O-N 2.94Å; A93-T96 PolarHBondContact O-OG1 3.27Å; Y94-T96 VanDerWaalsContact C-N 3.32Å
97	M	74.9	Confident	92.8	Very high	216 Å²	216	130.8 Å²	130.8	100%	1.064	64%	0.641	S	S	*	*			trans	-92.8	0	175.9	-81	-79.6	-89.2	0	0	110.7	A93	A93-M97 WeakPolarHBondContact O-CG 3.45Å; A93-M97 PolarHBondContact O-N 3.19Å

Retrieved 97 of 97 residues in 51 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).