A0A096NK84_PAPAN Loading...

Cysteine-rich protein 1

Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.

AlphaFold DB (P50238), UniProt , Accession A0A096NK84, Species PAPAN (Papio anubis, Olive baboon), Gene CRIP1, Length 77 aa.

						>A0A096NK84_PAPAN|A0A096NK84|CRIP1
MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.1	Confident	88.7	Confident	173 Å²	173	75.8 Å²	75.8	85%	0.852	38%	0.379	S	S	*	.				0	148.8	0	-70.3	78.1	171.4	0	0	109.6	E10	M1-E10 HydrophobicContact CB-CB 4.39Å; M1-E10 HydrophobicContact CB-CG 4.31Å
2	P	85.3	Confident	88.9	Confident	51 Å²	51	82.1 Å²	82.1	33%	0.331	40%	0.397	S	S	.	.			trans	-68.2	142.7	172.9	31.3	-35.4	0	0	0	110.6	V11 D23	P2-V11 HydrophobicContact CG-CB 4.33Å; P2-V11 PolarHBondContact O-N 3.38Å; P2-D23 HydrophobicContact CB-CB 3.69Å; P2-D23 WeakPolarHBondContact CB-OD2 3.16Å; P2-D23 HydrophobicContact CG-CB 3.78Å; P2-D23 VanDerWaalsContact CG-OD2 3.26Å; P2-D23 WeakPolarHBondContact CG-OD2 3.31Å
3	K	90.1	Very high	88.8	Confident	132 Å²	132	88.1 Å²	88.1	57%	0.574	42%	0.421	S	S	*	.	B	Isolated β-bridge	trans	-109	131.3	-178.8	-61.3	-179.9	77.7	-179.6	0	108.9	P5 N8 K9	K3-P5 WeakPolarHBondContact O-CD 3.47Å; K3-N8 WeakPolarHBondContact CE-O 3.08Å; K3-K9 CarbonylContact C-O 3.58Å; K3-K9 WeakPolarHBondContact CA-O 3.35Å
4	C	92.2	Very high	88.8	Confident	0 Å²	0	87.6 Å²	87.6	0%	0	44%	0.439	C	S	.	.			trans	-69.1	122.2	176.6	179	0	0	0	0	108.7	K6 C7 N8 K9 V11 H25 C28	C4-K6 PolarHBondContact O-N 3.38Å; C4-C7 VanDerWaalsContact CB-SG 3.59Å; C4-C7 PolarHBondContact O-N 3.27Å; C4-N8 WeakPolarHBondContact O-CA 3.08Å; C4-N8 PolarHBondContact O-N 2.79Å; C4-K9 PolarHBondContact N-O 2.96Å; C4-V11 HydrophobicContact CB-CG2 3.57Å; C4-H25 WeakPolarHBondContact CB-CE1 3.32Å; C4-H25 WeakPolarHBondContact CB-ND1 3.12Å; C4-C28 VanDerWaalsContact SG-CB 3.59Å
5	P	88.4	Confident	88.7	Confident	35 Å²	35	86.8 Å²	86.8	23%	0.227	43%	0.433	C	S	.	.	T	Hydrogen-bonded Turn	trans	-69.9	-17.5	-178.2	29	-35.8	0	0	0	113	K3 W24 E45 G48	K3-P5 WeakPolarHBondContact O-CD 3.47Å; P5-W24 HydrophobicContact CB-CH2 4.49Å; P5-W24 HydrophobicContact CG-CD2 4.24Å; P5-W24 HydrophobicContact CG-CE3 4.02Å; P5-W24 HydrophobicContact CG-CH2 3.39Å; P5-W24 HydrophobicContact CG-CZ2 3.61Å; P5-W24 HydrophobicContact CG-CZ3 3.58Å; P5-E45 WeakPolarHBondContact CG-OE2 3.47Å; P5-G48 CarbonylContact C-O 3.57Å; P5-G48 VanDerWaalsContact C-O 3.31Å
6	K	89.2	Confident	88.7	Confident	42 Å²	42	89.3 Å²	89.3	18%	0.183	44%	0.436	C	S	.	.	T	Hydrogen-bonded Turn	trans	-72.2	-48.7	174.8	-167.5	175.6	-179.7	92.1	0	113.3	C4 W24 C28 K30 E32 G48 P50	C4-K6 PolarHBondContact O-N 3.38Å; K6-W24 HydrophobicContact CB-CE3 4.31Å; K6-W24 HydrophobicContact CB-CZ3 3.97Å; K6-C28 HydrophobicContact CB-CB 4.22Å; K6-C28 HydrophobicContact CD-CB 3.88Å; K6-C28 WeakPolarHBondContact CD-O 3.44Å; K6-C28 WeakPolarHBondContact CE-O 3.37Å; K6-K30 PolarHBondContact NZ-O 2.82Å; K6-E32 IonicContact NZ-OE1 2.69Å; K6-E32 IonicContact NZ-OE2 3.15Å; K6-E32 PolarHBondContact NZ-OE2 3.26Å; K6-G48 PolarHBondContact N-O 3.15Å; K6-P50 HydrophobicContact CD-CG 4.22Å
7	C	91	Very high	88.7	Confident	45 Å²	45	84.6 Å²	84.6	30%	0.304	41%	0.414	S	S	.	.	T	Hydrogen-bonded Turn	trans	-111.9	-2.7	-172.7	67.3	0	0	0	0	113.4	C4 K9 H25 C28	C4-C7 VanDerWaalsContact CB-SG 3.59Å; C4-C7 PolarHBondContact O-N 3.27Å; C7-K9 PolarHBondContact O-N 3.44Å; C7-K9 VanDerWaalsContact O-N 3.09Å; C7-H25 PolarHBondContact SG-CE1 3.29Å; C7-H25 PolarHBondContact SG-ND1 2.92Å; C7-C28 VanDerWaalsContact SG-SG 3.66Å
8	N	89.2	Confident	88.6	Confident	112 Å²	112	84.8 Å²	84.8	60%	0.599	42%	0.421	S	S	*	.			trans	57.8	16.6	-177.9	-70.1	-85.9	0	0	0	115	K3 C4	K3-N8 WeakPolarHBondContact CE-O 3.08Å; C4-N8 WeakPolarHBondContact O-CA 3.08Å; C4-N8 PolarHBondContact O-N 2.79Å
9	K	91.5	Very high	88.4	Confident	146 Å²	146	80.7 Å²	80.7	64%	0.635	40%	0.401	S	S	*	.			trans	-97.2	157.1	177.4	-66.6	173.8	-178.7	175.6	0	111.6	K3 C4 C7	K3-K9 CarbonylContact C-O 3.58Å; K3-K9 WeakPolarHBondContact CA-O 3.35Å; C4-K9 PolarHBondContact N-O 2.96Å; C7-K9 PolarHBondContact O-N 3.44Å; C7-K9 VanDerWaalsContact O-N 3.09Å
10	E	92.6	Very high	88.2	Confident	90 Å²	90	82.4 Å²	82.4	42%	0.421	41%	0.411	S	S	.	.	B	Isolated β-bridge	trans	-63.9	136.8	175.5	-65.4	164.1	92.4	0	0	111.1	M1 H25	M1-E10 HydrophobicContact CB-CB 4.39Å; M1-E10 HydrophobicContact CB-CG 4.31Å; E10-H25 PolarHBondContact O-NE2 3.2Å
11	V	92.4	Very high	88.1	Confident	8 Å²	8	82 Å²	82	5%	0.048	43%	0.428	C	S	.	.			trans	-96.2	108.5	178.6	-171.9	0	0	0	0	108.6	P2 C4 R16 D23 W24	P2-V11 HydrophobicContact CG-CB 4.33Å; P2-V11 PolarHBondContact O-N 3.38Å; C4-V11 HydrophobicContact CB-CG2 3.57Å; V11-R16 HydrophobicContact CG1-CB 3.59Å; V11-D23 HydrophobicContact CB-CB 4.15Å; V11-D23 HydrophobicContact CG1-CB 4.14Å; V11-D23 HydrophobicContact CG2-CB 4.27Å; V11-W24 WeakPolarHBondContact CG1-O 3.48Å
12	Y	90.6	Very high	88.8	Confident	151 Å²	151	78 Å²	78	59%	0.592	41%	0.405	S	S	*	.			trans	-75.8	153.8	175.7	-65.7	-81.5	0	0	0	111.2	A14 E15 R16	Y12-A14 PolarHBondContact O-N 2.67Å; Y12-E15 PolarHBondContact O-N 2.85Å; Y12-R16 WeakPolarHBondContact O-CB 3.2Å; Y12-R16 PolarHBondContact O-N 3.39Å
13	F	87.7	Confident	89	Confident	160 Å²	160	77 Å²	77	70%	0.702	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.7	-33.8	178.7	-173.8	-86.6	0	0	0	113.8	E15 R16	F13-E15 VanDerWaalsContact C-N 3.32Å; F13-E15 PolarHBondContact O-N 2.9Å; F13-R16 VanDerWaalsContact CD2-NE 3.31Å
14	A	89.2	Confident	89.1	Confident	82 Å²	82	70.8 Å²	70.8	68%	0.678	37%	0.37	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.8	-29.1	-179.9	0	0	0	0	0	114.3	Y12	Y12-A14 PolarHBondContact O-N 2.67Å
15	E	86.5	Confident	89.1	Confident	75 Å²	75	71.3 Å²	71.3	35%	0.35	37%	0.373	S	S	.	.	T	Hydrogen-bonded Turn	trans	-117.1	0.9	-178.4	-65.3	-156.5	99.3	0	0	113.4	Y12 F13 V17 H25 R26 P27	Y12-E15 PolarHBondContact O-N 2.85Å; F13-E15 VanDerWaalsContact C-N 3.32Å; F13-E15 PolarHBondContact O-N 2.9Å; E15-V17 PolarHBondContact O-N 3.49Å; E15-H25 HydrophobicContact CB-CB 4.36Å; E15-H25 CarbonylContact O-C 3.57Å; E15-H25 WeakPolarHBondContact O-CA 3.13Å; E15-H25 IonicContact OE2-CD2 3.84Å; E15-R26 PolarHBondContact O-N 2.98Å; E15-P27 WeakPolarHBondContact OE1-CD 3.41Å; E15-P27 WeakPolarHBondContact OE1-CG 2.94Å
16	R	88.7	Confident	89.1	Confident	127 Å²	127	77.6 Å²	77.6	48%	0.479	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.3	127.7	-176.5	78	179.5	177.3	161.4	10.4	111.1	V11 Y12 F13 W24	V11-R16 HydrophobicContact CG1-CB 3.59Å; Y12-R16 WeakPolarHBondContact O-CB 3.2Å; Y12-R16 PolarHBondContact O-N 3.39Å; F13-R16 VanDerWaalsContact CD2-NE 3.31Å; R16-W24 CarbonylContact C-O 3.58Å
17	V	90	Very high	89.1	Confident	10 Å²	10	79 Å²	79	6%	0.061	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	106.3	170.4	178.1	0	0	0	0	107.4	E15 S19 D23 W24 R26 L29 S40	E15-V17 PolarHBondContact O-N 3.49Å; V17-S19 PolarHBondContact O-N 3.09Å; V17-D23 CarbonylContact O-C 3.59Å; V17-D23 WeakPolarHBondContact O-CA 3.37Å; V17-W24 HydrophobicContact CB-CB 4.39Å; V17-W24 PolarHBondContact N-O 3.5Å; V17-W24 PolarHBondContact O-N 3.47Å; V17-R26 HydrophobicContact CG2-CB 4.47Å; V17-R26 HydrophobicContact CG2-CG 3.59Å; V17-L29 HydrophobicContact CB-CD2 4.48Å; V17-L29 HydrophobicContact CG1-CD2 3.75Å; V17-S40 VanDerWaalsContact CG1-CB 3.49Å; V17-S40 WeakPolarHBondContact CG1-OG 3.31Å
18	T	86.8	Confident	89.2	Confident	87 Å²	87	77.6 Å²	77.6	53%	0.534	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.5	120	175.6	-45.5	0	0	0	0	108.8	K22 D23	T18-K22 CarbonylContact C-O 3.59Å; T18-K22 WeakPolarHBondContact CA-O 3.43Å; T18-D23 PolarHBondContact OG1-OD1 2.9Å
19	S	84.9	Confident	89.3	Confident	7 Å²	7	72.4 Å²	72.4	5%	0.049	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.6	137.5	178.3	-167.7	0	0	0	0	110.5	V17 G21 K22 H43	V17-S19 PolarHBondContact O-N 3.09Å; S19-G21 PolarHBondContact O-N 3.19Å; S19-K22 PolarHBondContact N-O 2.91Å; S19-K22 PolarHBondContact O-N 3.49Å; S19-H43 WeakPolarHBondContact CB-CE1 3.4Å; S19-H43 VanDerWaalsContact CB-NE2 3.31Å; S19-H43 WeakPolarHBondContact CB-NE2 3.22Å; S19-H43 PolarHBondContact OG-CE1 3.49Å; S19-H43 PolarHBondContact OG-NE2 3.13Å
20	L	83.6	Confident	89.3	Confident	114 Å²	114	69.6 Å²	69.6	60%	0.597	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.4	29.9	-177.1	-58.1	170.2	0	0	0	113.5	E45	L20-E45 HydrophobicContact CD1-CB 3.72Å
21	G	86.4	Confident	89.4	Confident	74 Å²	74	65.3 Å²	65.3	76%	0.763	34%	0.336	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.9	11	-177.3	0	0	0	0	0	115.4	S19	S19-G21 PolarHBondContact O-N 3.19Å
22	K	87.6	Confident	89.3	Confident	89 Å²	89	69.2 Å²	69.2	39%	0.387	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	150.6	179.4	-67.8	173.4	175.5	-166.9	0	111.3	T18 S19 W24 E45	T18-K22 CarbonylContact C-O 3.59Å; T18-K22 WeakPolarHBondContact CA-O 3.43Å; S19-K22 PolarHBondContact N-O 2.91Å; S19-K22 PolarHBondContact O-N 3.49Å; K22-W24 VanDerWaalsContact O-CD1 3.29Å; K22-E45 WeakPolarHBondContact CD-OE1 3.4Å; K22-E45 WeakPolarHBondContact CD-OE2 2.96Å; K22-E45 WeakPolarHBondContact CE-OE1 2.92Å; K22-E45 VanDerWaalsContact NZ-CD 3.31Å; K22-E45 IonicContact NZ-OE1 3.67Å; K22-E45 PolarHBondContact NZ-OE1 2.87Å; K22-E45 IonicContact NZ-OE2 2.72Å; K22-E45 PolarHBondContact NZ-OE2 3.37Å; K22-E45 VanDerWaalsContact NZ-OE2 3.15Å
23	D	91	Very high	89.2	Confident	32 Å²	32	67.7 Å²	67.7	17%	0.171	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	136.8	176.2	-53.3	-84.5	0	0	0	111.9	P2 V11 V17 T18	P2-D23 HydrophobicContact CB-CB 3.69Å; P2-D23 WeakPolarHBondContact CB-OD2 3.16Å; P2-D23 HydrophobicContact CG-CB 3.78Å; P2-D23 VanDerWaalsContact CG-OD2 3.26Å; P2-D23 WeakPolarHBondContact CG-OD2 3.31Å; V11-D23 HydrophobicContact CB-CB 4.15Å; V11-D23 HydrophobicContact CG1-CB 4.14Å; V11-D23 HydrophobicContact CG2-CB 4.27Å; V17-D23 CarbonylContact O-C 3.59Å; V17-D23 WeakPolarHBondContact O-CA 3.37Å; T18-D23 PolarHBondContact OG1-OD1 2.9Å
24	W	92	Very high	89.4	Confident	0 Å²	0	63.4 Å²	63.4	0%	0	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	154.6	-178.4	-58.3	82	0	0	0	110	P5 K6 V11 R16 V17 K22 L29 E45 G48 P50	P5-W24 HydrophobicContact CB-CH2 4.49Å; P5-W24 HydrophobicContact CG-CD2 4.24Å; P5-W24 HydrophobicContact CG-CE3 4.02Å; P5-W24 HydrophobicContact CG-CH2 3.39Å; P5-W24 HydrophobicContact CG-CZ2 3.61Å; P5-W24 HydrophobicContact CG-CZ3 3.58Å; K6-W24 HydrophobicContact CB-CE3 4.31Å; K6-W24 HydrophobicContact CB-CZ3 3.97Å; V11-W24 WeakPolarHBondContact CG1-O 3.48Å; R16-W24 CarbonylContact C-O 3.58Å; V17-W24 HydrophobicContact CB-CB 4.39Å; V17-W24 PolarHBondContact N-O 3.5Å; V17-W24 PolarHBondContact O-N 3.47Å; K22-W24 VanDerWaalsContact O-CD1 3.29Å; W24-L29 HydrophobicContact CB-CD1 3.7Å; W24-L29 HydrophobicContact CD2-CD1 3.82Å; W24-L29 HydrophobicContact CE3-CD1 4.3Å; W24-L29 HydrophobicContact CG-CD1 3.54Å; W24-E45 HydrophobicContact CH2-CB 4.41Å; W24-E45 HydrophobicContact CH2-CG 3.81Å; W24-E45 HydrophobicContact CZ2-CB 3.92Å; W24-E45 HydrophobicContact CZ2-CG 3.62Å; W24-E45 WeakPolarHBondContact CZ2-OE2 3.48Å; W24-G48 WeakPolarHBondContact CH2-O 3.24Å; W24-P50 HydrophobicContact CE3-CG 4.1Å; W24-P50 HydrophobicContact CH2-CB 4.15Å; W24-P50 HydrophobicContact CH2-CG 4.15Å; W24-P50 HydrophobicContact CZ3-CB 4.07Å; W24-P50 HydrophobicContact CZ3-CG 3.63Å
25	H	92.6	Very high	89.4	Confident	12 Å²	12	61.7 Å²	61.7	6%	0.056	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.3	141.8	163.6	-49.3	92.4	0	0	0	109.8	C4 C7 E10 E15 P27 C28 L29	C4-H25 WeakPolarHBondContact CB-CE1 3.32Å; C4-H25 WeakPolarHBondContact CB-ND1 3.12Å; C7-H25 PolarHBondContact SG-CE1 3.29Å; C7-H25 PolarHBondContact SG-ND1 2.92Å; E10-H25 PolarHBondContact O-NE2 3.2Å; E15-H25 HydrophobicContact CB-CB 4.36Å; E15-H25 CarbonylContact O-C 3.57Å; E15-H25 WeakPolarHBondContact O-CA 3.13Å; E15-H25 IonicContact OE2-CD2 3.84Å; H25-P27 VanDerWaalsContact C-N 3.32Å; H25-P27 HydrophobicContact CB-CG 4.14Å; H25-C28 HydrophobicContact CB-CB 3.77Å; H25-C28 PolarHBondContact ND1-SG 2.82Å; H25-C28 VanDerWaalsContact ND1-SG 3.37Å; H25-C28 CarbonylContact O-C 3.31Å; H25-C28 WeakPolarHBondContact O-CA 3.31Å; H25-C28 WeakPolarHBondContact O-CB 3.19Å; H25-C28 PolarHBondContact O-N 2.93Å; H25-L29 PolarHBondContact O-N 2.88Å
26	R	88.6	Confident	89.6	Confident	166 Å²	166	64.8 Å²	64.8	63%	0.626	34%	0.342	S	S	*	.	T	Hydrogen-bonded Turn	trans	-42.4	-49.6	169.3	-72.8	164.6	70.9	-168.5	2.2	113.6	E15 V17 L29	E15-R26 PolarHBondContact O-N 2.98Å; V17-R26 HydrophobicContact CG2-CB 4.47Å; V17-R26 HydrophobicContact CG2-CG 3.59Å; R26-L29 PolarHBondContact O-N 2.89Å
27	P	89.2	Confident	89.7	Confident	71 Å²	71	64.2 Å²	64.2	46%	0.461	35%	0.353	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.1	-15.9	176.4	30.6	-38.2	0	0	0	114.7	E15 H25 K30	E15-P27 WeakPolarHBondContact OE1-CD 3.41Å; E15-P27 WeakPolarHBondContact OE1-CG 2.94Å; H25-P27 VanDerWaalsContact C-N 3.32Å; H25-P27 HydrophobicContact CB-CG 4.14Å; P27-K30 PolarHBondContact O-NZ 2.82Å
28	C	91.9	Very high	89.6	Confident	16 Å²	16	64.7 Å²	64.7	11%	0.108	36%	0.355	C	S	.	.	T	Hydrogen-bonded Turn	trans	-78.8	-28.4	173.1	-74.5	0	0	0	0	111.3	C4 K6 C7 H25 K30 P50	C4-C28 VanDerWaalsContact SG-CB 3.59Å; K6-C28 HydrophobicContact CB-CB 4.22Å; K6-C28 HydrophobicContact CD-CB 3.88Å; K6-C28 WeakPolarHBondContact CD-O 3.44Å; K6-C28 WeakPolarHBondContact CE-O 3.37Å; C7-C28 VanDerWaalsContact SG-SG 3.66Å; H25-C28 HydrophobicContact CB-CB 3.77Å; H25-C28 PolarHBondContact ND1-SG 2.82Å; H25-C28 VanDerWaalsContact ND1-SG 3.37Å; H25-C28 CarbonylContact O-C 3.31Å; H25-C28 WeakPolarHBondContact O-CA 3.31Å; H25-C28 WeakPolarHBondContact O-CB 3.19Å; H25-C28 PolarHBondContact O-N 2.93Å; C28-K30 PolarHBondContact O-N 3.07Å; C28-P50 WeakPolarHBondContact O-CG 3.43Å
29	L	91.4	Very high	89.5	Confident	3 Å²	3	65.2 Å²	65.2	2%	0.016	36%	0.358	C	S	.	.			trans	-74.3	59	178.2	-153.6	74.6	0	0	0	112.3	V17 W24 H25 R26 L38 H43 P50	V17-L29 HydrophobicContact CB-CD2 4.48Å; V17-L29 HydrophobicContact CG1-CD2 3.75Å; W24-L29 HydrophobicContact CB-CD1 3.7Å; W24-L29 HydrophobicContact CD2-CD1 3.82Å; W24-L29 HydrophobicContact CE3-CD1 4.3Å; W24-L29 HydrophobicContact CG-CD1 3.54Å; H25-L29 PolarHBondContact O-N 2.88Å; R26-L29 PolarHBondContact O-N 2.89Å; L29-L38 HydrophobicContact CD2-CB 4.48Å; L29-L38 HydrophobicContact CG-CB 4.19Å; L29-L38 VanDerWaalsContact O-CB 3.29Å; L29-L38 WeakPolarHBondContact O-CB 3.32Å; L29-L38 PolarHBondContact O-N 2.77Å; L29-H43 WeakPolarHBondContact CD1-CE1 3.08Å; L29-H43 WeakPolarHBondContact CD1-NE2 3.48Å; L29-H43 VanDerWaalsContact CD2-CE1 3.46Å; L29-H43 WeakPolarHBondContact CD2-CE1 3.45Å; L29-P50 HydrophobicContact CD1-CB 4.38Å
30	K	92.2	Very high	89.3	Confident	87 Å²	87	68.3 Å²	68.3	38%	0.378	38%	0.38	S	S	.	.	B	Isolated β-bridge	trans	-126.4	137.8	175.6	60	169.6	173.3	-87.3	0	110.1	K6 P27 C28 E32 K36 P50	K6-K30 PolarHBondContact NZ-O 2.82Å; P27-K30 PolarHBondContact O-NZ 2.82Å; C28-K30 PolarHBondContact O-N 3.07Å; K30-E32 PolarHBondContact O-N 2.93Å; K30-K36 CarbonylContact C-O 3.57Å; K30-K36 VanDerWaalsContact CA-O 3.32Å; K30-K36 WeakPolarHBondContact CA-O 3.18Å; K30-P50 WeakPolarHBondContact O-CG 3.44Å
31	C	93.2	Very high	89.3	Confident	1 Å²	1	65.6 Å²	65.6	1%	0.007	38%	0.38	C	S	.	.			trans	-56.8	123.5	-179.1	-176.8	0	0	0	0	110	K33 C34 G35 K36 L38 P50 C52	C31-K33 PolarHBondContact O-N 3.36Å; C31-K33 PolarHBondContact SG-N 3.47Å; C31-C34 WeakPolarHBondContact CB-SG 3.03Å; C31-C34 PolarHBondContact SG-SG 3.47Å; C31-G35 WeakPolarHBondContact O-CA 3.46Å; C31-G35 PolarHBondContact O-N 3.25Å; C31-K36 PolarHBondContact N-O 3.46Å; C31-L38 HydrophobicContact CB-CD1 4.02Å; C31-L38 HydrophobicContact CB-CD2 4.47Å; C31-L38 HydrophobicContact CB-CG 4.37Å; C31-L38 VanDerWaalsContact N-CD1 3.34Å; C31-P50 VanDerWaalsContact CA-O 3.31Å; C31-P50 WeakPolarHBondContact CA-O 3.14Å; C31-C52 WeakPolarHBondContact CB-SG 2.89Å; C31-C52 PolarHBondContact SG-N 2.69Å; C31-C52 VanDerWaalsContact SG-SG 3.6Å
32	E	90.3	Very high	89.2	Confident	90 Å²	90	63.5 Å²	63.5	42%	0.421	36%	0.358	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.3	-25.4	177.7	-158.2	86.5	96.7	0	0	112.1	K6 K30 K49 P50 Y51	K6-E32 IonicContact NZ-OE1 2.69Å; K6-E32 IonicContact NZ-OE2 3.15Å; K6-E32 PolarHBondContact NZ-OE2 3.26Å; K30-E32 PolarHBondContact O-N 2.93Å; E32-K49 HydrophobicContact CG-CD 4.39Å; E32-P50 PolarHBondContact N-O 3.48Å; E32-Y51 HydrophobicContact CB-CE1 4.36Å
33	K	89	Confident	89.3	Confident	118 Å²	118	59.5 Å²	59.5	51%	0.513	34%	0.341	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.6	-45.1	-175	-66.2	-73.1	-79.9	-173.2	0	113.5	C31 Y51 C56 M60	C31-K33 PolarHBondContact O-N 3.36Å; C31-K33 PolarHBondContact SG-N 3.47Å; K33-Y51 HydrophobicContact CB-CD1 4.48Å; K33-Y51 HydrophobicContact CD-CE1 4.16Å; K33-Y51 HydrophobicContact CG-CD1 3.59Å; K33-Y51 HydrophobicContact CG-CE1 3.46Å; K33-Y51 VanDerWaalsContact CG-CE1 3.46Å; K33-C56 HydrophobicContact CB-CB 4.18Å; K33-M60 HydrophobicContact CD-CE 4.24Å; K33-M60 HydrophobicContact CD-SD 4.34Å; K33-M60 WeakPolarHBondContact CE-SD 3.34Å; K33-M60 PolarHBondContact NZ-SD 2.9Å
34	C	93.1	Very high	89.2	Confident	71 Å²	71	58.4 Å²	58.4	48%	0.48	34%	0.336	S	S	.	.	T	Hydrogen-bonded Turn	trans	-110.9	-3.3	-177.3	65	0	0	0	0	113.7	C31 K36 C52	C31-C34 WeakPolarHBondContact CB-SG 3.03Å; C31-C34 PolarHBondContact SG-SG 3.47Å; C34-K36 PolarHBondContact O-N 3.44Å; C34-K36 VanDerWaalsContact O-N 3.07Å; C34-K36 WeakPolarHBondContact SG-CB 3.29Å; C34-C52 PolarHBondContact SG-SG 2.88Å
35	G	89.2	Confident	89	Confident	46 Å²	46	60.1 Å²	60.1	47%	0.474	34%	0.344	S	S	.	.			trans	69.2	0.2	-177.2	0	0	0	0	0	114.7	C31 T37	C31-G35 WeakPolarHBondContact O-CA 3.46Å; C31-G35 PolarHBondContact O-N 3.25Å; G35-T37 PolarHBondContact O-N 3.22Å
36	K	90.4	Very high	88.9	Confident	140 Å²	140	62.2 Å²	62.2	61%	0.609	35%	0.354	S	S	*	.	P	Polyproline II helix	trans	-63.9	133.6	-177.3	-176.5	168.8	-178.6	164.5	0	111.1	K30 C31 C34 L38	K30-K36 CarbonylContact C-O 3.57Å; K30-K36 VanDerWaalsContact CA-O 3.32Å; K30-K36 WeakPolarHBondContact CA-O 3.18Å; C31-K36 PolarHBondContact N-O 3.46Å; C34-K36 PolarHBondContact O-N 3.44Å; C34-K36 VanDerWaalsContact O-N 3.07Å; C34-K36 WeakPolarHBondContact SG-CB 3.29Å; K36-L38 PolarHBondContact O-N 3.02Å
37	T	89.3	Confident	88.8	Confident	115 Å²	115	61.9 Å²	61.9	71%	0.706	36%	0.359	S	S	*	.	B	Isolated β-bridge	trans	-63.1	123.2	170.2	-50.9	0	0	0	0	109.6	G35	G35-T37 PolarHBondContact O-N 3.22Å
38	L	88.9	Confident	88.7	Confident	20 Å²	20	59 Å²	59	11%	0.105	34%	0.343	C	S	.	.	P	Polyproline II helix	trans	-100.5	153.4	-179.3	-60.4	163	0	0	0	109.7	L29 C31 K36 H43 P50 C52	L29-L38 HydrophobicContact CD2-CB 4.48Å; L29-L38 HydrophobicContact CG-CB 4.19Å; L29-L38 VanDerWaalsContact O-CB 3.29Å; L29-L38 WeakPolarHBondContact O-CB 3.32Å; L29-L38 PolarHBondContact O-N 2.77Å; C31-L38 HydrophobicContact CB-CD1 4.02Å; C31-L38 HydrophobicContact CB-CD2 4.47Å; C31-L38 HydrophobicContact CB-CG 4.37Å; C31-L38 VanDerWaalsContact N-CD1 3.34Å; K36-L38 PolarHBondContact O-N 3.02Å; L38-H43 HydrophobicContact CB-CB 3.97Å; L38-H43 HydrophobicContact CD1-CB 3.65Å; L38-H43 HydrophobicContact CD2-CB 4.08Å; L38-H43 HydrophobicContact CG-CB 4.1Å; L38-P50 HydrophobicContact CD1-CB 4.09Å; L38-C52 HydrophobicContact CD2-CB 4.1Å; L38-C52 VanDerWaalsContact CD2-SG 3.56Å
39	T	84.7	Confident	88.6	Confident	97 Å²	97	62.6 Å²	62.6	60%	0.595	36%	0.357	S	S	*	.	P	Polyproline II helix	trans	-94	157.1	173.7	-167.3	0	0	0	0	111.2	G41 G42 H43	T39-G41 PolarHBondContact O-N 3.31Å; T39-G42 PolarHBondContact O-N 2.8Å; T39-G42 VanDerWaalsContact O-N 3.13Å; T39-H43 PolarHBondContact O-ND1 2.86Å
40	S	80.9	Confident	88.6	Confident	72 Å²	72	62.4 Å²	62.4	50%	0.503	36%	0.356	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54.3	116.2	170.6	-43.6	0	0	0	0	109.7	V17 G42	V17-S40 VanDerWaalsContact CG1-CB 3.49Å; V17-S40 WeakPolarHBondContact CG1-OG 3.31Å; S40-G42 PolarHBondContact O-N 3.2Å
41	G	82.4	Confident	88.6	Confident	58 Å²	58	59 Å²	59	60%	0.598	34%	0.341	S	S	*	.	T	Hydrogen-bonded Turn	trans	86.3	-12.2	-179.3	0	0	0	0	0	116.8	T39	T39-G41 PolarHBondContact O-N 3.31Å
42	G	85.3	Confident	88.5	Confident	30 Å²	30	59.4 Å²	59.4	31%	0.309	34%	0.343	S	S	.	.	S	Bend	trans	-95.3	23.1	-179.9	0	0	0	0	0	114.9	T39 S40 N53	T39-G42 PolarHBondContact O-N 2.8Å; T39-G42 VanDerWaalsContact O-N 3.13Å; S40-G42 PolarHBondContact O-N 3.2Å; G42-N53 VanDerWaalsContact C-ND2 3.3Å; G42-N53 PolarHBondContact O-ND2 2.76Å
43	H	88.9	Confident	88.4	Confident	4 Å²	4	58.1 Å²	58.1	2%	0.019	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.6	167.5	-174	65.5	-88.9	0	0	0	112.2	S19 L29 L38 T39 Y51 N53	S19-H43 WeakPolarHBondContact CB-CE1 3.4Å; S19-H43 VanDerWaalsContact CB-NE2 3.31Å; S19-H43 WeakPolarHBondContact CB-NE2 3.22Å; S19-H43 PolarHBondContact OG-CE1 3.49Å; S19-H43 PolarHBondContact OG-NE2 3.13Å; L29-H43 WeakPolarHBondContact CD1-CE1 3.08Å; L29-H43 WeakPolarHBondContact CD1-NE2 3.48Å; L29-H43 VanDerWaalsContact CD2-CE1 3.46Å; L29-H43 WeakPolarHBondContact CD2-CE1 3.45Å; L38-H43 HydrophobicContact CB-CB 3.97Å; L38-H43 HydrophobicContact CD1-CB 3.65Å; L38-H43 HydrophobicContact CD2-CB 4.08Å; L38-H43 HydrophobicContact CG-CB 4.1Å; T39-H43 PolarHBondContact O-ND1 2.86Å; H43-Y51 WeakPolarHBondContact CB-O 3.07Å; H43-N53 VanDerWaalsContact CA-OD1 3.32Å; H43-N53 WeakPolarHBondContact CA-OD1 3.42Å; H43-N53 PolarHBondContact O-OD1 2.72Å
44	A	90.3	Very high	88.2	Confident	9 Å²	9	59.6 Å²	59.6	7%	0.074	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	143.3	176.4	0	0	0	0	0	110.5	P50 Y51 N53 Y57	A44-P50 CarbonylContact O-C 3.54Å; A44-P50 WeakPolarHBondContact O-CA 3.26Å; A44-Y51 PolarHBondContact N-O 2.86Å; A44-Y51 PolarHBondContact O-N 2.92Å; A44-N53 PolarHBondContact N-OD1 3.41Å; A44-Y57 HydrophobicContact CB-CD1 3.8Å; A44-Y57 HydrophobicContact CB-CD2 3.17Å; A44-Y57 HydrophobicContact CB-CE1 4.11Å; A44-Y57 HydrophobicContact CB-CE2 3.52Å; A44-Y57 HydrophobicContact CB-CG 3.33Å
45	E	88.4	Confident	87.9	Confident	36 Å²	36	60.8 Å²	60.8	17%	0.168	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.2	138.8	168.9	-179.1	-167.6	77.2	0	0	109.3	P5 L20 K22 W24 K49	P5-E45 WeakPolarHBondContact CG-OE2 3.47Å; L20-E45 HydrophobicContact CD1-CB 3.72Å; K22-E45 WeakPolarHBondContact CD-OE1 3.4Å; K22-E45 WeakPolarHBondContact CD-OE2 2.96Å; K22-E45 WeakPolarHBondContact CE-OE1 2.92Å; K22-E45 VanDerWaalsContact NZ-CD 3.31Å; K22-E45 IonicContact NZ-OE1 3.67Å; K22-E45 PolarHBondContact NZ-OE1 2.87Å; K22-E45 IonicContact NZ-OE2 2.72Å; K22-E45 PolarHBondContact NZ-OE2 3.37Å; K22-E45 VanDerWaalsContact NZ-OE2 3.15Å; W24-E45 HydrophobicContact CH2-CB 4.41Å; W24-E45 HydrophobicContact CH2-CG 3.81Å; W24-E45 HydrophobicContact CZ2-CB 3.92Å; W24-E45 HydrophobicContact CZ2-CG 3.62Å; W24-E45 WeakPolarHBondContact CZ2-OE2 3.48Å; E45-K49 WeakPolarHBondContact CA-O 3.46Å
46	H	88.7	Confident	88	Confident	56 Å²	56	59.5 Å²	59.5	26%	0.259	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.5	128.8	163.1	-166.8	89.4	0	0	0	110.7	G48 K49 Y51 Y57 F61	H46-G48 PolarHBondContact O-N 2.82Å; H46-G48 VanDerWaalsContact O-N 3.11Å; H46-K49 PolarHBondContact N-O 3.11Å; H46-K49 WeakPolarHBondContact O-CB 3.26Å; H46-K49 PolarHBondContact O-N 3.07Å; H46-Y51 HydrophobicContact CB-CD2 3.92Å; H46-Y51 HydrophobicContact CB-CE2 3.66Å; H46-Y57 HydrophobicContact CB-CE2 4.16Å; H46-F61 HydrophobicContact CB-CD1 4.45Å; H46-F61 HydrophobicContact CB-CD2 3.96Å; H46-F61 HydrophobicContact CB-CE1 3.99Å; H46-F61 HydrophobicContact CB-CE2 3.4Å; H46-F61 VanDerWaalsContact CB-CE2 3.4Å; H46-F61 HydrophobicContact CB-CG 4.43Å; H46-F61 HydrophobicContact CB-CZ 3.42Å; H46-F61 VanDerWaalsContact CB-CZ 3.42Å; H46-F61 AromaticContact CD2-CD1 3.61Å; H46-F61 AromaticContact CD2-CE1 2.94Å; H46-F61 WeakPolarHBondContact CD2-CE1 3.14Å; H46-F61 AromaticContact CD2-CZ 3.19Å; H46-F61 WeakPolarHBondContact CD2-CZ 3.43Å; H46-F61 AromaticContact CE1-CD1 3.31Å; H46-F61 WeakPolarHBondContact CE1-CD1 3.32Å; H46-F61 AromaticContact CE1-CE1 3.51Å; H46-F61 AromaticContact CE1-CG 3.97Å; H46-F61 AromaticContact CG-CD1 3.61Å; H46-F61 AromaticContact CG-CD2 3.96Å; H46-F61 AromaticContact CG-CE1 3.26Å; H46-F61 AromaticContact CG-CE2 3.61Å; H46-F61 AromaticContact CG-CG 3.95Å; H46-F61 AromaticContact CG-CZ 3.24Å; H46-F61 AromaticContact ND1-CD1 3.44Å; H46-F61 WeakPolarHBondContact ND1-CD1 3.46Å; H46-F61 AromaticContact ND1-CE1 3.61Å; H46-F61 AromaticContact ND1-CG 3.69Å; H46-F61 AromaticContact ND1-CZ 3.96Å; H46-F61 AromaticContact NE2-CD1 3.41Å; H46-F61 WeakPolarHBondContact NE2-CD1 3.39Å; H46-F61 AromaticContact NE2-CE1 3.12Å; H46-F61 WeakPolarHBondContact NE2-CE1 3.48Å; H46-F61 AromaticContact NE2-CZ 3.89Å
47	E	86.6	Confident	88	Confident	159 Å²	159	56.8 Å²	56.8	74%	0.743	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	trans	49	37.7	-179.6	-68.2	177.1	93.6	0	0	113.9	K49	E47-K49 VanDerWaalsContact C-N 3.27Å; E47-K49 PolarHBondContact O-N 2.81Å
48	G	87.4	Confident	87.8	Confident	12 Å²	12	53.1 Å²	53.1	12%	0.124	31%	0.306	C	S	.	.	T	Hydrogen-bonded Turn	trans	76.3	8.2	-178.6	0	0	0	0	0	115.5	P5 K6 W24 H46	P5-G48 CarbonylContact C-O 3.57Å; P5-G48 VanDerWaalsContact C-O 3.31Å; K6-G48 PolarHBondContact N-O 3.15Å; W24-G48 WeakPolarHBondContact CH2-O 3.24Å; H46-G48 PolarHBondContact O-N 2.82Å; H46-G48 VanDerWaalsContact O-N 3.11Å
49	K	89.6	Confident	87.7	Confident	90 Å²	90	55.8 Å²	55.8	39%	0.391	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110	135.4	175.5	-63.6	170.7	-177.2	167.4	0	110.3	E32 E45 H46 E47 Y51	E32-K49 HydrophobicContact CG-CD 4.39Å; E45-K49 WeakPolarHBondContact CA-O 3.46Å; H46-K49 PolarHBondContact N-O 3.11Å; H46-K49 WeakPolarHBondContact O-CB 3.26Å; H46-K49 PolarHBondContact O-N 3.07Å; E47-K49 VanDerWaalsContact C-N 3.27Å; E47-K49 PolarHBondContact O-N 2.81Å; K49-Y51 HydrophobicContact CB-CD2 4.45Å; K49-Y51 HydrophobicContact CB-CE2 3.58Å; K49-Y51 WeakPolarHBondContact O-CD2 3.45Å; K49-Y51 VanDerWaalsContact O-CE2 3.26Å; K49-Y51 WeakPolarHBondContact O-CE2 3.41Å
50	P	91.8	Very high	87.6	Confident	0 Å²	0	55.4 Å²	55.4	0%	0	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.7	141	176.5	25.8	-17	0	0	0	111.1	K6 W24 C28 L29 K30 C31 E32 L38 A44	K6-P50 HydrophobicContact CD-CG 4.22Å; W24-P50 HydrophobicContact CE3-CG 4.1Å; W24-P50 HydrophobicContact CH2-CB 4.15Å; W24-P50 HydrophobicContact CH2-CG 4.15Å; W24-P50 HydrophobicContact CZ3-CB 4.07Å; W24-P50 HydrophobicContact CZ3-CG 3.63Å; C28-P50 WeakPolarHBondContact O-CG 3.43Å; L29-P50 HydrophobicContact CD1-CB 4.38Å; K30-P50 WeakPolarHBondContact O-CG 3.44Å; C31-P50 VanDerWaalsContact CA-O 3.31Å; C31-P50 WeakPolarHBondContact CA-O 3.14Å; E32-P50 PolarHBondContact N-O 3.48Å; L38-P50 HydrophobicContact CD1-CB 4.09Å; A44-P50 CarbonylContact O-C 3.54Å; A44-P50 WeakPolarHBondContact O-CA 3.26Å
51	Y	92.2	Very high	87.8	Confident	14 Å²	14	54.7 Å²	54.7	6%	0.055	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	148.5	-179.6	-63.1	-92.8	0	0	0	110.6	E32 K33 H43 A44 H46 K49 N53 F61	E32-Y51 HydrophobicContact CB-CE1 4.36Å; K33-Y51 HydrophobicContact CB-CD1 4.48Å; K33-Y51 HydrophobicContact CD-CE1 4.16Å; K33-Y51 HydrophobicContact CG-CD1 3.59Å; K33-Y51 HydrophobicContact CG-CE1 3.46Å; K33-Y51 VanDerWaalsContact CG-CE1 3.46Å; H43-Y51 WeakPolarHBondContact CB-O 3.07Å; A44-Y51 PolarHBondContact N-O 2.86Å; A44-Y51 PolarHBondContact O-N 2.92Å; H46-Y51 HydrophobicContact CB-CD2 3.92Å; H46-Y51 HydrophobicContact CB-CE2 3.66Å; K49-Y51 HydrophobicContact CB-CD2 4.45Å; K49-Y51 HydrophobicContact CB-CE2 3.58Å; K49-Y51 WeakPolarHBondContact O-CD2 3.45Å; K49-Y51 VanDerWaalsContact O-CE2 3.26Å; K49-Y51 WeakPolarHBondContact O-CE2 3.41Å; Y51-N53 PolarHBondContact O-N 3.2Å; Y51-F61 HydrophobicContact CD1-CE2 4.16Å; Y51-F61 AromaticContact CD2-CE2 3.76Å; Y51-F61 HydrophobicContact CD2-CE2 3.76Å; Y51-F61 HydrophobicContact CD2-CZ 4.34Å; Y51-F61 HydrophobicContact CE1-CE2 4.09Å; Y51-F61 HydrophobicContact CE1-CZ 4.21Å; Y51-F61 AromaticContact CE2-CE2 3.71Å; Y51-F61 HydrophobicContact CE2-CE2 3.71Å; Y51-F61 AromaticContact CE2-CZ 3.81Å; Y51-F61 HydrophobicContact CE2-CZ 3.81Å; Y51-F61 AromaticContact CG-CE2 4Å; Y51-F61 HydrophobicContact CG-CE2 4Å; Y51-F61 AromaticContact CZ-CE2 3.89Å; Y51-F61 AromaticContact CZ-CZ 3.74Å
52	C	92.4	Very high	87.7	Confident	10 Å²	10	53 Å²	53	7%	0.068	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.1	138.1	169.5	-55.8	0	0	0	0	110.3	C31 C34 L38 H54 C56 Y57	C31-C52 WeakPolarHBondContact CB-SG 2.89Å; C31-C52 PolarHBondContact SG-N 2.69Å; C31-C52 VanDerWaalsContact SG-SG 3.6Å; C34-C52 PolarHBondContact SG-SG 2.88Å; L38-C52 HydrophobicContact CD2-CB 4.1Å; L38-C52 VanDerWaalsContact CD2-SG 3.56Å; C52-H54 PolarHBondContact O-N 2.91Å; C52-C56 HydrophobicContact CB-CB 4.16Å; C52-Y57 WeakPolarHBondContact O-CB 3.37Å; C52-Y57 PolarHBondContact O-N 3.3Å
53	N	88.2	Confident	87.1	Confident	63 Å²	63	58.1 Å²	58.1	34%	0.337	32%	0.322	S	S	.	.	I	π-helix	trans	-49.8	-48.3	172.4	-75.9	-17.5	0	0	0	111.5	G42 H43 A44 Y51	G42-N53 VanDerWaalsContact C-ND2 3.3Å; G42-N53 PolarHBondContact O-ND2 2.76Å; H43-N53 VanDerWaalsContact CA-OD1 3.32Å; H43-N53 WeakPolarHBondContact CA-OD1 3.42Å; H43-N53 PolarHBondContact O-OD1 2.72Å; A44-N53 PolarHBondContact N-OD1 3.41Å; Y51-N53 PolarHBondContact O-N 3.2Å
54	H	84.1	Confident	85.8	Confident	150 Å²	150	67 Å²	67	69%	0.694	36%	0.36	S	S	*	.	I	π-helix	trans	-136.7	145.9	173.6	-64.1	-84.1	0	0	0	112.2	C52	C52-H54 PolarHBondContact O-N 2.91Å
55	P	85.8	Confident	84.3	Confident	95 Å²	95	69.5 Å²	69.5	62%	0.617	39%	0.388	S	S	*	.	I	π-helix	cis	-85.7	-6.9	-11.6	33.7	-33.7	0	0	0	113.3	Y57 A58 A59	P55-Y57 PolarHBondContact O-N 3.07Å; P55-A58 PolarHBondContact O-N 3.02Å; P55-A59 WeakPolarHBondContact O-CB 3.21Å; P55-A59 PolarHBondContact O-N 3.37Å
56	C	91.6	Very high	82.6	Confident	19 Å²	19	78.3 Å²	78.3	13%	0.128	43%	0.426	C	S	.	.	I	π-helix	trans	-62.2	-50.5	-167.2	-60.7	0	0	0	0	114.5	K33 C52 M60	K33-C56 HydrophobicContact CB-CB 4.18Å; C52-C56 HydrophobicContact CB-CB 4.16Å; C56-M60 WeakPolarHBondContact O-CB 3.34Å; C56-M60 WeakPolarHBondContact O-CG 3.43Å; C56-M60 PolarHBondContact O-N 3.07Å
57	Y	90.2	Very high	81	Confident	83 Å²	83	78.5 Å²	78.5	33%	0.325	44%	0.443	S	S	.	.	I	π-helix	trans	-65.8	-49.2	179.2	-178.2	-96.4	0	0	0	110.9	A44 H46 C52 P55 A59 M60 F61	A44-Y57 HydrophobicContact CB-CD1 3.8Å; A44-Y57 HydrophobicContact CB-CD2 3.17Å; A44-Y57 HydrophobicContact CB-CE1 4.11Å; A44-Y57 HydrophobicContact CB-CE2 3.52Å; A44-Y57 HydrophobicContact CB-CG 3.33Å; H46-Y57 HydrophobicContact CB-CE2 4.16Å; C52-Y57 WeakPolarHBondContact O-CB 3.37Å; C52-Y57 PolarHBondContact O-N 3.3Å; P55-Y57 PolarHBondContact O-N 3.07Å; Y57-A59 PolarHBondContact O-N 3.37Å; Y57-M60 PolarHBondContact O-N 2.87Å; Y57-F61 AromaticContact CD2-CD2 3.3Å; Y57-F61 HydrophobicContact CD2-CD2 3.3Å; Y57-F61 AromaticContact CD2-CE2 3.87Å; Y57-F61 HydrophobicContact CD2-CE2 3.87Å; Y57-F61 HydrophobicContact CD2-CG 4.28Å; Y57-F61 HydrophobicContact CE2-CB 4.31Å; Y57-F61 AromaticContact CE2-CD2 3.6Å; Y57-F61 HydrophobicContact CE2-CD2 3.6Å; Y57-F61 HydrophobicContact CE2-CE2 4.29Å; Y57-F61 HydrophobicContact CE2-CG 4.21Å; Y57-F61 AromaticContact CG-CD2 3.93Å; Y57-F61 HydrophobicContact CG-CD2 3.93Å; Y57-F61 WeakPolarHBondContact O-CD2 3.37Å; Y57-F61 PolarHBondContact O-N 2.82Å
58	A	86.7	Confident	79.3	Confident	39 Å²	39	81.5 Å²	81.5	32%	0.322	45%	0.448	S	S	.	.	H	α-helix	trans	-61.3	-37	178	0	0	0	0	0	113.9	P55 G62	P55-A58 PolarHBondContact O-N 3.02Å; A58-G62 WeakPolarHBondContact O-CA 3.36Å; A58-G62 PolarHBondContact O-N 3.24Å
59	A	85.6	Confident	77.5	Confident	75 Å²	75	84.8 Å²	84.8	62%	0.62	48%	0.482	S	S	*	.	H	α-helix	trans	-74.7	-27.6	179.8	0	0	0	0	0	113.2	P55 Y57	P55-A59 WeakPolarHBondContact O-CB 3.21Å; P55-A59 PolarHBondContact O-N 3.37Å; Y57-A59 PolarHBondContact O-N 3.37Å
60	M	83.4	Confident	75.7	Confident	89 Å²	89	83.1 Å²	83.1	44%	0.438	49%	0.49	S	S	.	.	H	α-helix	trans	-92.1	-43.6	-178.8	-69	-72	-68.2	0	0	112.5	K33 C56 Y57	K33-M60 HydrophobicContact CD-CE 4.24Å; K33-M60 HydrophobicContact CD-SD 4.34Å; K33-M60 WeakPolarHBondContact CE-SD 3.34Å; K33-M60 PolarHBondContact NZ-SD 2.9Å; C56-M60 WeakPolarHBondContact O-CB 3.34Å; C56-M60 WeakPolarHBondContact O-CG 3.43Å; C56-M60 PolarHBondContact O-N 3.07Å; Y57-M60 PolarHBondContact O-N 2.87Å
61	F	84.8	Confident	73.9	Confident	57 Å²	57	88.5 Å²	88.5	25%	0.25	53%	0.534	C	S	.	.	H	α-helix	trans	-118.1	-6.5	-171.7	-47.6	-65.4	0	0	0	113.6	H46 Y51 Y57	H46-F61 HydrophobicContact CB-CD1 4.45Å; H46-F61 HydrophobicContact CB-CD2 3.96Å; H46-F61 HydrophobicContact CB-CE1 3.99Å; H46-F61 HydrophobicContact CB-CE2 3.4Å; H46-F61 VanDerWaalsContact CB-CE2 3.4Å; H46-F61 HydrophobicContact CB-CG 4.43Å; H46-F61 HydrophobicContact CB-CZ 3.42Å; H46-F61 VanDerWaalsContact CB-CZ 3.42Å; H46-F61 AromaticContact CD2-CD1 3.61Å; H46-F61 AromaticContact CD2-CE1 2.94Å; H46-F61 WeakPolarHBondContact CD2-CE1 3.14Å; H46-F61 AromaticContact CD2-CZ 3.19Å; H46-F61 WeakPolarHBondContact CD2-CZ 3.43Å; H46-F61 AromaticContact CE1-CD1 3.31Å; H46-F61 WeakPolarHBondContact CE1-CD1 3.32Å; H46-F61 AromaticContact CE1-CE1 3.51Å; H46-F61 AromaticContact CE1-CG 3.97Å; H46-F61 AromaticContact CG-CD1 3.61Å; H46-F61 AromaticContact CG-CD2 3.96Å; H46-F61 AromaticContact CG-CE1 3.26Å; H46-F61 AromaticContact CG-CE2 3.61Å; H46-F61 AromaticContact CG-CG 3.95Å; H46-F61 AromaticContact CG-CZ 3.24Å; H46-F61 AromaticContact ND1-CD1 3.44Å; H46-F61 WeakPolarHBondContact ND1-CD1 3.46Å; H46-F61 AromaticContact ND1-CE1 3.61Å; H46-F61 AromaticContact ND1-CG 3.69Å; H46-F61 AromaticContact ND1-CZ 3.96Å; H46-F61 AromaticContact NE2-CD1 3.41Å; H46-F61 WeakPolarHBondContact NE2-CD1 3.39Å; H46-F61 AromaticContact NE2-CE1 3.12Å; H46-F61 WeakPolarHBondContact NE2-CE1 3.48Å; H46-F61 AromaticContact NE2-CZ 3.89Å; Y51-F61 HydrophobicContact CD1-CE2 4.16Å; Y51-F61 AromaticContact CD2-CE2 3.76Å; Y51-F61 HydrophobicContact CD2-CE2 3.76Å; Y51-F61 HydrophobicContact CD2-CZ 4.34Å; Y51-F61 HydrophobicContact CE1-CE2 4.09Å; Y51-F61 HydrophobicContact CE1-CZ 4.21Å; Y51-F61 AromaticContact CE2-CE2 3.71Å; Y51-F61 HydrophobicContact CE2-CE2 3.71Å; Y51-F61 AromaticContact CE2-CZ 3.81Å; Y51-F61 HydrophobicContact CE2-CZ 3.81Å; Y51-F61 AromaticContact CG-CE2 4Å; Y51-F61 HydrophobicContact CG-CE2 4Å; Y51-F61 AromaticContact CZ-CE2 3.89Å; Y51-F61 AromaticContact CZ-CZ 3.74Å; Y57-F61 AromaticContact CD2-CD2 3.3Å; Y57-F61 HydrophobicContact CD2-CD2 3.3Å; Y57-F61 AromaticContact CD2-CE2 3.87Å; Y57-F61 HydrophobicContact CD2-CE2 3.87Å; Y57-F61 HydrophobicContact CD2-CG 4.28Å; Y57-F61 HydrophobicContact CE2-CB 4.31Å; Y57-F61 AromaticContact CE2-CD2 3.6Å; Y57-F61 HydrophobicContact CE2-CD2 3.6Å; Y57-F61 HydrophobicContact CE2-CE2 4.29Å; Y57-F61 HydrophobicContact CE2-CG 4.21Å; Y57-F61 AromaticContact CG-CD2 3.93Å; Y57-F61 HydrophobicContact CG-CD2 3.93Å; Y57-F61 WeakPolarHBondContact O-CD2 3.37Å; Y57-F61 PolarHBondContact O-N 2.82Å
62	G	79.9	Confident	71.9	Confident	23 Å²	23	95.3 Å²	95.3	24%	0.237	57%	0.566	C	S	.	*	S	Bend	trans	-61	164.6	166.1	0	0	0	0	0	110.2	A58 K64	A58-G62 WeakPolarHBondContact O-CA 3.36Å; A58-G62 PolarHBondContact O-N 3.24Å; G62-K64 PolarHBondContact O-N 3.45Å
63	P	73	Confident	70.1	Confident	138 Å²	138	99.6 Å²	99.6	90%	0.896	60%	0.597	S	S	*	*			trans	-64.4	83.2	-179.2	28.6	-35.5	0	0	0	110	G65	P63-G65 PolarHBondContact O-N 2.75Å
64	K	61.9	Low	68.3	Low	189 Å²	189	104.8 Å²	104.8	82%	0.822	62%	0.619	S	S	*	*			trans	-75.7	88.8	161.6	-169.5	162.4	-177.6	175.1	0	104.6	G62 F66	G62-K64 PolarHBondContact O-N 3.45Å; K64-F66 PolarHBondContact O-N 2.87Å
65	G	57.7	Low	66.6	Low	63 Å²	63	103.9 Å²	103.9	65%	0.649	62%	0.624	S	S	*	*			trans	-34.1	112.8	-179.6	0	0	0	0	0	110.2	P63 G67	P63-G65 PolarHBondContact O-N 2.75Å; G65-G67 VanDerWaalsContact C-N 3.25Å; G65-G67 PolarHBondContact O-N 3.29Å
66	F	53.9	Low	65.1	Low	221 Å²	221	108.2 Å²	108.2	97%	0.969	63%	0.633	S	S	*	*	S	Bend	trans	-51.4	93.8	164.8	178.8	-96.2	0	0	0	107.7	K64	K64-F66 PolarHBondContact O-N 2.87Å
67	G	54.7	Low	63.9	Low	60 Å²	60	119.6 Å²	119.6	62%	0.619	68%	0.681	S	S	*	*			trans	177.4	106.1	-176.1	0	0	0	0	0	108.9	G65	G65-G67 VanDerWaalsContact C-N 3.25Å; G65-G67 PolarHBondContact O-N 3.29Å
68	R	50.3	Low	62.6	Low	222 Å²	222	121.5 Å²	121.5	84%	0.838	70%	0.698	S	S	*	*			trans	94.6	90.2	175.3	-46.7	-69.1	-79.2	-82.7	-5.2	115.4
69	G	49.9	Very low	61.4	Low	81 Å²	81	125.8 Å²	125.8	84%	0.835	72%	0.718	S	S	*	*				-52.9	138.3	126.5	0	0	0	0	0	109.4
70	G	52.5	Low	60	Low	55 Å²	55	128.6 Å²	128.6	57%	0.567	72%	0.724	S	S	*	*			trans	153.7	77.5	-176.1	0	0	0	0	0	110	E72	G70-E72 VanDerWaalsContact C-N 3.32Å; G70-E72 PolarHBondContact O-N 3.09Å; G70-E72 VanDerWaalsContact O-N 3.09Å
71	A	54.4	Low	58.6	Low	113 Å²	113	130.9 Å²	130.9	93%	0.934	74%	0.741	S	S	*	*			trans	-67.2	96.6	158.8	0	0	0	0	0	107.6
72	E	48.5	Very low	57	Low	156 Å²	156	135.6 Å²	135.6	73%	0.729	77%	0.771	S	S	*	*			trans	-150.1	82.7	161.1	58	-166.4	113.4	0	0	109.4	G70	G70-E72 VanDerWaalsContact C-N 3.32Å; G70-E72 PolarHBondContact O-N 3.09Å; G70-E72 VanDerWaalsContact O-N 3.09Å
73	S	54.8	Low	55.5	Low	101 Å²	101	143.1 Å²	143.1	71%	0.706	81%	0.807	S	S	*	*			trans	-47.5	141.2	137.5	-50.5	0	0	0	0	108.6
74	H	50.3	Low	54.2	Low	171 Å²	171	143.4 Å²	143.4	79%	0.792	80%	0.8	S	S	*	*			trans	50.7	129	160.5	78.2	-57.7	0	0	0	117.9
75	T	48.6	Very low	53.6	Low	131 Å²	131	139.9 Å²	139.9	80%	0.804	80%	0.799	S	S	*	*				-170.5	156.8	52.9	174.9	0	0	0	0	110.3
76	F	55.3	Low	53.3	Low	187 Å²	187	146.3 Å²	146.3	82%	0.82	81%	0.811	S	S	*	*			trans	-48.2	154.2	-178.5	-174.3	-101.2	0	0	0	116.2
77	K	66.5	Low	53.2	Low	258 Å²	258	139.5 Å²	139.5	100%	1.122	80%	0.797	S	S	*	*			trans	-48.8	0	-176.9	-61.6	166.6	168.9	179.6	0	115.4

Retrieved 77 of 77 residues in 156.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).