A0A096NQR5_PAPAN Loading...

Single-pass membrane and coiled-coil domain-containing protein 4

AlphaFold DB (Q9NRQ5), UniProt , Accession A0A096NQR5, Species PAPAN (Papio anubis, Olive baboon), Gene SMCO4, Length 59 aa.

						>A0A096NQR5_PAPAN|A0A096NQR5|SMCO4
MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.8	Very low	56.3	Low	242 Å²	242	165.3 Å²	165.3	100%	1.192	79%	0.79	S	S	*	*				0	117.5	0	-78.3	177.2	173.1	0	0	109.1	Q3	M1-Q3 PolarHBondContact O-N 3Å; M1-Q3 VanDerWaalsContact O-N 3.16Å
2	R	59.7	Low	56.8	Low	226 Å²	226	157.4 Å²	157.4	85%	0.853	76%	0.761	S	S	*	*			trans	-67.5	110.9	177.7	-172.7	173.4	175	-179.8	-2.2	107.7	L4	R2-L4 VanDerWaalsContact C-N 3.31Å; R2-L4 PolarHBondContact O-N 2.72Å
3	Q	62	Low	57.1	Low	188 Å²	188	153.4 Å²	153.4	88%	0.879	76%	0.759	S	S	*	*			trans	-60.5	103.7	164.8	-66.5	-157.6	29.7	0	0	105.9	M1 K5	M1-Q3 PolarHBondContact O-N 3Å; M1-Q3 VanDerWaalsContact O-N 3.16Å; Q3-K5 PolarHBondContact O-N 3.34Å
4	L	60.5	Low	57.5	Low	117 Å²	117	153.4 Å²	153.4	61%	0.613	75%	0.752	S	S	*	*			trans	-57.2	115.4	176	-68.4	168.3	0	0	0	105.8	R2 G6 K7	R2-L4 VanDerWaalsContact C-N 3.31Å; R2-L4 PolarHBondContact O-N 2.72Å; L4-G6 PolarHBondContact O-N 3.47Å; L4-K7 PolarHBondContact O-N 3.17Å; L4-K7 VanDerWaalsContact O-N 3.07Å
5	K	59.2	Low	57.8	Low	225 Å²	225	147.9 Å²	147.9	98%	0.978	73%	0.727	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.3	18.9	-180	-159.9	177.6	177.1	-177.8	0	113.5	Q3	Q3-K5 PolarHBondContact O-N 3.34Å
6	G	55.6	Low	58.4	Low	60 Å²	60	146.8 Å²	146.8	62%	0.619	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-150.2	14.7	-177.6	0	0	0	0	0	113.5	L4 P8	L4-G6 PolarHBondContact O-N 3.47Å; G6-P8 WeakPolarHBondContact O-CD 3.12Å
7	K	53.2	Low	59	Low	170 Å²	170	145.8 Å²	145.8	74%	0.739	71%	0.708	S	S	*	*	S	Bend	trans	-61.7	111.2	159.2	-101.3	-173.3	-179.8	-176.9	0	105.1	L4 K9	L4-K7 PolarHBondContact O-N 3.17Å; L4-K7 VanDerWaalsContact O-N 3.07Å; K7-K9 PolarHBondContact O-N 2.82Å
8	P	55.8	Low	59.6	Low	105 Å²	105	144.1 Å²	144.1	68%	0.682	70%	0.699	S	S	*	*			trans	-55.5	117	-177.5	-15.5	27.3	0	0	0	104.9	G6 K10	G6-P8 WeakPolarHBondContact O-CD 3.12Å; P8-K10 VanDerWaalsContact C-N 3.28Å; P8-K10 WeakPolarHBondContact O-CA 3.06Å; P8-K10 PolarHBondContact O-N 3.33Å
9	K	56.5	Low	60	Low	194 Å²	194	145.2 Å²	145.2	84%	0.843	70%	0.695	S	S	*	*			trans	-48.3	105.8	173.9	-167.7	179.4	-172.4	-174.6	0	104.1	K7 E11	K7-K9 PolarHBondContact O-N 2.82Å; K9-E11 WeakPolarHBondContact O-CA 3.47Å; K9-E11 PolarHBondContact O-N 3.48Å
10	K	54.6	Low	60.5	Low	196 Å²	196	145.3 Å²	145.3	85%	0.852	69%	0.692	S	S	*	*			trans	-25.5	101.8	-168	-155.3	177.4	-166.7	179.8	0	107.3	P8 T12	P8-K10 VanDerWaalsContact C-N 3.28Å; P8-K10 WeakPolarHBondContact O-CA 3.06Å; P8-K10 PolarHBondContact O-N 3.33Å; K10-T12 WeakPolarHBondContact O-CA 3.2Å; K10-T12 PolarHBondContact O-N 2.8Å
11	E	55	Low	60.9	Low	95 Å²	95	142.3 Å²	142.3	44%	0.444	68%	0.677	S	S	.	*			trans	-41.6	115.5	-171	-73.9	-172.6	120.1	0	0	106.2	K9 S13 D15 R19	K9-E11 WeakPolarHBondContact O-CA 3.47Å; K9-E11 PolarHBondContact O-N 3.48Å; E11-S13 PolarHBondContact O-N 2.57Å; E11-D15 HydrophobicContact CB-CB 4.24Å; E11-R19 IonicContact OE1-NH1 3.77Å; E11-R19 IonicContact OE2-NH1 3.88Å
12	T	62.4	Low	62.2	Low	71 Å²	71	133.4 Å²	133.4	44%	0.436	64%	0.642	S	S	.	*			trans	-56.1	147.9	-161.9	-57.9	0	0	0	0	106.2	K10 K14 D15 K16	K10-T12 WeakPolarHBondContact O-CA 3.2Å; K10-T12 PolarHBondContact O-N 2.8Å; T12-K14 HydrophobicContact CG2-CB 3.91Å; T12-K14 HydrophobicContact CG2-CD 4.4Å; T12-K14 HydrophobicContact CG2-CG 3.96Å; T12-K14 CarbonylContact O-C 3.46Å; T12-K14 PolarHBondContact O-N 3.33Å; T12-D15 VanDerWaalsContact CB-OD2 3.3Å; T12-D15 WeakPolarHBondContact CB-OD2 3.48Å; T12-D15 PolarHBondContact N-OD2 2.81Å; T12-D15 PolarHBondContact O-N 2.81Å; T12-D15 PolarHBondContact OG1-OD2 2.88Å; T12-K16 PolarHBondContact O-N 3.45Å
13	S	60.6	Low	62.7	Low	105 Å²	105	128.3 Å²	128.3	73%	0.734	63%	0.63	S	S	*	*	H	α-helix	trans	-50.8	-22.2	174.3	-56.1	0	0	0	0	112.3	E11 K17	E11-S13 PolarHBondContact O-N 2.57Å; S13-K17 WeakPolarHBondContact O-CB 3.26Å; S13-K17 PolarHBondContact O-N 2.78Å
14	K	63.2	Low	63	Low	154 Å²	154	125.1 Å²	125.1	67%	0.67	62%	0.615	S	S	*	*	H	α-helix	trans	-62.4	-56.2	166.7	-64.1	-171.6	177.9	-170.5	0	113.3	T12 K16 K17 E18	T12-K14 HydrophobicContact CG2-CB 3.91Å; T12-K14 HydrophobicContact CG2-CD 4.4Å; T12-K14 HydrophobicContact CG2-CG 3.96Å; T12-K14 CarbonylContact O-C 3.46Å; T12-K14 PolarHBondContact O-N 3.33Å; K14-K16 VanDerWaalsContact C-N 3.28Å; K14-K16 PolarHBondContact O-N 3.49Å; K14-K17 CarbonylContact O-C 3.53Å; K14-K17 WeakPolarHBondContact O-CA 3.36Å; K14-K17 VanDerWaalsContact O-CB 3.32Å; K14-K17 WeakPolarHBondContact O-CB 3.31Å; K14-K17 PolarHBondContact O-N 3.45Å; K14-E18 PolarHBondContact O-N 2.82Å
15	D	62.6	Low	63.5	Low	71 Å²	71	124.7 Å²	124.7	38%	0.38	61%	0.61	S	S	.	*	H	α-helix	trans	-56.3	-41.3	178.2	-60	-63.1	0	0	0	112.1	E11 T12 K17 E18 R19	E11-D15 HydrophobicContact CB-CB 4.24Å; T12-D15 VanDerWaalsContact CB-OD2 3.3Å; T12-D15 WeakPolarHBondContact CB-OD2 3.48Å; T12-D15 PolarHBondContact N-OD2 2.81Å; T12-D15 PolarHBondContact O-N 2.81Å; T12-D15 PolarHBondContact OG1-OD2 2.88Å; D15-K17 VanDerWaalsContact C-N 3.3Å; D15-K17 PolarHBondContact O-N 3.21Å; D15-E18 PolarHBondContact O-N 3.3Å; D15-R19 PolarHBondContact O-N 3.45Å
16	K	66.9	Low	64.1	Low	130 Å²	130	116.1 Å²	116.1	57%	0.565	58%	0.581	S	S	*	*	H	α-helix	trans	-64.4	-34.9	174.4	-76.6	-172.5	179.7	-175.1	0	112.6	T12 K14 K20	T12-K16 PolarHBondContact O-N 3.45Å; K14-K16 VanDerWaalsContact C-N 3.28Å; K14-K16 PolarHBondContact O-N 3.49Å; K16-K20 WeakPolarHBondContact O-CG 3.39Å; K16-K20 PolarHBondContact O-N 3.47Å
17	K	68.6	Low	65	Low	130 Å²	130	121.7 Å²	121.7	57%	0.565	58%	0.583	S	S	*	*	H	α-helix	trans	-72	-43.2	176.7	-166.8	-178.9	177.2	-177.1	0	110.5	S13 K14 D15 R19 K20 Q21	S13-K17 WeakPolarHBondContact O-CB 3.26Å; S13-K17 PolarHBondContact O-N 2.78Å; K14-K17 CarbonylContact O-C 3.53Å; K14-K17 WeakPolarHBondContact O-CA 3.36Å; K14-K17 VanDerWaalsContact O-CB 3.32Å; K14-K17 WeakPolarHBondContact O-CB 3.31Å; K14-K17 PolarHBondContact O-N 3.45Å; D15-K17 VanDerWaalsContact C-N 3.3Å; D15-K17 PolarHBondContact O-N 3.21Å; K17-R19 PolarHBondContact O-N 3.25Å; K17-K20 PolarHBondContact O-N 3.49Å; K17-K20 VanDerWaalsContact O-N 3.14Å; K17-Q21 HydrophobicContact CG-CG 4.48Å; K17-Q21 WeakPolarHBondContact O-CB 3.38Å; K17-Q21 WeakPolarHBondContact O-CG 3.16Å; K17-Q21 PolarHBondContact O-N 2.92Å
18	E	70.3	Confident	66	Low	115 Å²	115	119.6 Å²	119.6	54%	0.537	58%	0.576	S	S	.	*	H	α-helix	trans	-61.1	-43.4	176.3	-73.3	176.6	94.5	0	0	111.5	K14 D15 K20 Q21 A22	K14-E18 PolarHBondContact O-N 2.82Å; D15-E18 PolarHBondContact O-N 3.3Å; E18-K20 VanDerWaalsContact C-N 3.35Å; E18-K20 PolarHBondContact O-N 2.81Å; E18-Q21 PolarHBondContact O-N 3.24Å; E18-A22 WeakPolarHBondContact O-CB 3.2Å; E18-A22 PolarHBondContact O-N 3.49Å
19	R	67	Low	66.8	Low	165 Å²	165	120.9 Å²	120.9	62%	0.623	57%	0.573	S	S	*	*	H	α-helix	trans	-59.2	-43.3	172.5	-98.3	-178.4	166.2	171	-3.6	112.8	E11 D15 K17 M23	E11-R19 IonicContact OE1-NH1 3.77Å; E11-R19 IonicContact OE2-NH1 3.88Å; D15-R19 PolarHBondContact O-N 3.45Å; K17-R19 PolarHBondContact O-N 3.25Å; R19-M23 WeakPolarHBondContact O-CB 3.37Å; R19-M23 VanDerWaalsContact O-CG 3.25Å; R19-M23 WeakPolarHBondContact O-CG 3.48Å; R19-M23 PolarHBondContact O-N 2.96Å; R19-M23 VanDerWaalsContact O-N 3.09Å
20	K	68.9	Low	67.7	Low	147 Å²	147	116.7 Å²	116.7	64%	0.639	56%	0.559	S	S	*	*	H	α-helix	trans	-67.2	-39.7	177.7	-74.8	-176.7	178.7	-169.8	0	111.9	K16 K17 E18 M23 Q24	K16-K20 WeakPolarHBondContact O-CG 3.39Å; K16-K20 PolarHBondContact O-N 3.47Å; K17-K20 PolarHBondContact O-N 3.49Å; K17-K20 VanDerWaalsContact O-N 3.14Å; E18-K20 VanDerWaalsContact C-N 3.35Å; E18-K20 PolarHBondContact O-N 2.81Å; K20-M23 PolarHBondContact O-N 3.48Å; K20-Q24 WeakPolarHBondContact O-CG 3.31Å; K20-Q24 PolarHBondContact O-N 3.23Å
21	Q	70.6	Confident	68.8	Low	82 Å²	82	111.9 Å²	111.9	38%	0.383	55%	0.546	S	S	.	.	H	α-helix	trans	-65.9	-47.8	177.5	-73.4	177.1	-72.1	0	0	111	K17 E18 M23 Q24 E25	K17-Q21 HydrophobicContact CG-CG 4.48Å; K17-Q21 WeakPolarHBondContact O-CB 3.38Å; K17-Q21 WeakPolarHBondContact O-CG 3.16Å; K17-Q21 PolarHBondContact O-N 2.92Å; E18-Q21 PolarHBondContact O-N 3.24Å; Q21-M23 VanDerWaalsContact C-N 3.26Å; Q21-M23 PolarHBondContact O-N 2.86Å; Q21-Q24 CarbonylContact O-C 3.55Å; Q21-Q24 WeakPolarHBondContact O-CA 3.28Å; Q21-Q24 WeakPolarHBondContact O-CB 3.4Å; Q21-Q24 PolarHBondContact O-N 3.34Å; Q21-E25 WeakPolarHBondContact O-CG 3.41Å; Q21-E25 PolarHBondContact O-N 2.93Å
22	A	72.4	Confident	70.2	Confident	55 Å²	55	112 Å²	112	46%	0.455	55%	0.553	S	S	.	*	H	α-helix	trans	-58.5	-38.7	175.7	0	0	0	0	0	112.1	E18 Q24 A26	E18-A22 WeakPolarHBondContact O-CB 3.2Å; E18-A22 PolarHBondContact O-N 3.49Å; A22-Q24 VanDerWaalsContact C-N 3.35Å; A22-A26 VanDerWaalsContact O-CB 3.31Å; A22-A26 WeakPolarHBondContact O-CB 3.33Å; A22-A26 PolarHBondContact O-N 3.31Å
23	M	70.4	Confident	71.3	Confident	119 Å²	119	113 Å²	113	59%	0.586	56%	0.559	S	S	*	*	H	α-helix	trans	-67.2	-33.2	174	-72.7	-179.3	75.9	0	0	113.1	R19 K20 Q21 R27	R19-M23 WeakPolarHBondContact O-CB 3.37Å; R19-M23 VanDerWaalsContact O-CG 3.25Å; R19-M23 WeakPolarHBondContact O-CG 3.48Å; R19-M23 PolarHBondContact O-N 2.96Å; R19-M23 VanDerWaalsContact O-N 3.09Å; K20-M23 PolarHBondContact O-N 3.48Å; Q21-M23 VanDerWaalsContact C-N 3.26Å; Q21-M23 PolarHBondContact O-N 2.86Å; M23-R27 WeakPolarHBondContact O-CG 2.91Å; M23-R27 PolarHBondContact O-N 3.45Å
24	Q	69.5	Low	72.7	Confident	121 Å²	121	111.4 Å²	111.4	57%	0.565	55%	0.545	S	S	*	.	H	α-helix	trans	-74.8	-43.6	176	-76.4	176.9	-26.2	0	0	111.5	K20 Q21 A22 A26 R27 Q28	K20-Q24 WeakPolarHBondContact O-CG 3.31Å; K20-Q24 PolarHBondContact O-N 3.23Å; Q21-Q24 CarbonylContact O-C 3.55Å; Q21-Q24 WeakPolarHBondContact O-CA 3.28Å; Q21-Q24 WeakPolarHBondContact O-CB 3.4Å; Q21-Q24 PolarHBondContact O-N 3.34Å; A22-Q24 VanDerWaalsContact C-N 3.35Å; Q24-A26 VanDerWaalsContact C-N 3.34Å; Q24-A26 PolarHBondContact O-N 3.36Å; Q24-R27 WeakPolarHBondContact O-CB 3.34Å; Q24-R27 PolarHBondContact O-N 3.44Å; Q24-R27 VanDerWaalsContact O-N 3.15Å; Q24-Q28 WeakPolarHBondContact O-CG 3.31Å; Q24-Q28 PolarHBondContact O-N 3.05Å
25	E	70.4	Confident	73.9	Confident	109 Å²	109	110.2 Å²	110.2	51%	0.509	55%	0.545	S	S	.	.	H	α-helix	trans	-60.7	-43.4	175.8	-71.7	175.8	161	0	0	110.8	Q21 R27 Q28 Q29	Q21-E25 WeakPolarHBondContact O-CG 3.41Å; Q21-E25 PolarHBondContact O-N 2.93Å; E25-R27 VanDerWaalsContact C-N 3.32Å; E25-R27 PolarHBondContact O-N 2.96Å; E25-Q28 PolarHBondContact O-N 3.47Å; E25-Q29 WeakPolarHBondContact O-CB 3.32Å; E25-Q29 WeakPolarHBondContact O-CG 3.33Å; E25-Q29 PolarHBondContact O-N 3.29Å
26	A	72	Confident	75.4	Confident	45 Å²	45	110.2 Å²	110.2	37%	0.372	55%	0.549	S	S	.	.	H	α-helix	trans	-58.9	-41.9	174.3	0	0	0	0	0	112.1	A22 Q24 I30	A22-A26 VanDerWaalsContact O-CB 3.31Å; A22-A26 WeakPolarHBondContact O-CB 3.33Å; A22-A26 PolarHBondContact O-N 3.31Å; Q24-A26 VanDerWaalsContact C-N 3.34Å; Q24-A26 PolarHBondContact O-N 3.36Å; A26-I30 WeakPolarHBondContact O-CD1 3.43Å; A26-I30 WeakPolarHBondContact O-CG1 3.34Å; A26-I30 PolarHBondContact O-N 3.27Å; A26-I30 VanDerWaalsContact O-N 3.12Å
27	R	73.5	Confident	76.8	Confident	176 Å²	176	107.6 Å²	107.6	66%	0.664	54%	0.544	S	S	*	.	H	α-helix	trans	-67	-38.9	175.8	-73	174.6	-178	-124.6	0.1	112.5	M23 Q24 E25 T31	M23-R27 WeakPolarHBondContact O-CG 2.91Å; M23-R27 PolarHBondContact O-N 3.45Å; Q24-R27 WeakPolarHBondContact O-CB 3.34Å; Q24-R27 PolarHBondContact O-N 3.44Å; Q24-R27 VanDerWaalsContact O-N 3.15Å; E25-R27 VanDerWaalsContact C-N 3.32Å; E25-R27 PolarHBondContact O-N 2.96Å; R27-T31 PolarHBondContact O-N 3.43Å; R27-T31 VanDerWaalsContact O-N 3.09Å; R27-T31 PolarHBondContact O-OG1 3.23Å
28	Q	74	Confident	78.1	Confident	126 Å²	126	106.3 Å²	106.3	59%	0.589	54%	0.542	S	S	*	.	H	α-helix	trans	-66.4	-46.4	177.2	-74.8	178	-19.1	0	0	111.1	Q24 E25 I30 T31 T32	Q24-Q28 WeakPolarHBondContact O-CG 3.31Å; Q24-Q28 PolarHBondContact O-N 3.05Å; E25-Q28 PolarHBondContact O-N 3.47Å; Q28-I30 VanDerWaalsContact C-N 3.34Å; Q28-I30 PolarHBondContact O-N 3.2Å; Q28-T31 WeakPolarHBondContact O-CB 3.44Å; Q28-T31 PolarHBondContact O-N 3.29Å; Q28-T31 VanDerWaalsContact O-N 3.07Å; Q28-T32 WeakPolarHBondContact O-CG2 3.2Å; Q28-T32 PolarHBondContact O-N 2.93Å; Q28-T32 PolarHBondContact O-OG1 3.4Å
29	Q	73.5	Confident	79.3	Confident	132 Å²	132	103.7 Å²	103.7	62%	0.617	54%	0.541	S	S	*	.	H	α-helix	trans	-56.6	-46.6	175.9	-75.2	-179.9	-2.3	0	0	111.6	E25 T31 T32 V33	E25-Q29 WeakPolarHBondContact O-CB 3.32Å; E25-Q29 WeakPolarHBondContact O-CG 3.33Å; E25-Q29 PolarHBondContact O-N 3.29Å; Q29-T31 VanDerWaalsContact C-N 3.3Å; Q29-T31 PolarHBondContact O-N 2.99Å; Q29-T32 WeakPolarHBondContact CA-OG1 3.47Å; Q29-T32 PolarHBondContact O-N 3.39Å; Q29-T32 PolarHBondContact O-OG1 3.4Å; Q29-V33 WeakPolarHBondContact O-CG2 3.48Å; Q29-V33 PolarHBondContact O-N 2.96Å
30	I	75.4	Confident	80.8	Confident	107 Å²	107	99.9 Å²	99.9	55%	0.549	54%	0.536	S	S	.	.	H	α-helix	trans	-58	-45.3	175.6	-66	162.9	0	0	0	110.7	A26 Q28 T32 V33 V34	A26-I30 WeakPolarHBondContact O-CD1 3.43Å; A26-I30 WeakPolarHBondContact O-CG1 3.34Å; A26-I30 PolarHBondContact O-N 3.27Å; A26-I30 VanDerWaalsContact O-N 3.12Å; Q28-I30 VanDerWaalsContact C-N 3.34Å; Q28-I30 PolarHBondContact O-N 3.2Å; I30-T32 VanDerWaalsContact C-N 3.33Å; I30-T32 PolarHBondContact O-N 3.14Å; I30-V33 PolarHBondContact O-N 3.22Å; I30-V34 HydrophobicContact CG2-CG2 4.02Å; I30-V34 WeakPolarHBondContact O-CB 3.48Å; I30-V34 WeakPolarHBondContact O-CG2 3.41Å; I30-V34 PolarHBondContact O-N 3.21Å
31	T	78.3	Confident	82.2	Confident	95 Å²	95	96.1 Å²	96.1	58%	0.583	53%	0.525	S	S	*	.	H	α-helix	trans	-62.8	-39.8	-179.3	-54	0	0	0	0	111.9	R27 Q28 Q29 V33 V34 L35	R27-T31 PolarHBondContact O-N 3.43Å; R27-T31 VanDerWaalsContact O-N 3.09Å; R27-T31 PolarHBondContact O-OG1 3.23Å; Q28-T31 WeakPolarHBondContact O-CB 3.44Å; Q28-T31 PolarHBondContact O-N 3.29Å; Q28-T31 VanDerWaalsContact O-N 3.07Å; Q29-T31 VanDerWaalsContact C-N 3.3Å; Q29-T31 PolarHBondContact O-N 2.99Å; T31-V33 VanDerWaalsContact C-N 3.3Å; T31-V33 PolarHBondContact O-N 3.44Å; T31-V34 PolarHBondContact O-N 2.93Å; T31-L35 PolarHBondContact O-N 2.73Å; T31-L35 VanDerWaalsContact O-N 3.14Å
32	T	84.1	Confident	83.5	Confident	98 Å²	98	96.4 Å²	96.4	60%	0.601	53%	0.532	S	S	*	.	H	α-helix	trans	-67.2	-27.2	178.5	58	0	0	0	0	113.8	Q28 Q29 I30 P36	Q28-T32 WeakPolarHBondContact O-CG2 3.2Å; Q28-T32 PolarHBondContact O-N 2.93Å; Q28-T32 PolarHBondContact O-OG1 3.4Å; Q29-T32 WeakPolarHBondContact CA-OG1 3.47Å; Q29-T32 PolarHBondContact O-N 3.39Å; Q29-T32 PolarHBondContact O-OG1 3.4Å; I30-T32 VanDerWaalsContact C-N 3.33Å; I30-T32 PolarHBondContact O-N 3.14Å; T32-P36 WeakPolarHBondContact O-CD 3.46Å; T32-P36 VanDerWaalsContact O-CG 3.32Å; T32-P36 WeakPolarHBondContact O-CG 3.37Å
33	V	84.9	Confident	84.7	Confident	92 Å²	92	99 Å²	99	56%	0.558	54%	0.538	S	S	*	.	H	α-helix	trans	-85.8	-35.8	176.5	178.6	0	0	0	0	111.1	Q29 I30 T31 P36 T37	Q29-V33 WeakPolarHBondContact O-CG2 3.48Å; Q29-V33 PolarHBondContact O-N 2.96Å; I30-V33 PolarHBondContact O-N 3.22Å; T31-V33 VanDerWaalsContact C-N 3.3Å; T31-V33 PolarHBondContact O-N 3.44Å; V33-P36 VanDerWaalsContact O-CD 3.31Å; V33-P36 WeakPolarHBondContact O-CD 3.38Å; V33-P36 WeakPolarHBondContact O-CG 3.38Å; V33-T37 WeakPolarHBondContact O-CB 3.46Å; V33-T37 PolarHBondContact O-N 3.07Å; V33-T37 PolarHBondContact O-OG1 3.12Å
34	V	89.6	Confident	85.9	Confident	71 Å²	71	98.5 Å²	98.5	43%	0.43	54%	0.537	S	S	.	.	H	α-helix	trans	-67.9	-39.3	-179.1	171.1	0	0	0	0	111.7	I30 T31 T37 L38	I30-V34 HydrophobicContact CG2-CG2 4.02Å; I30-V34 WeakPolarHBondContact O-CB 3.48Å; I30-V34 WeakPolarHBondContact O-CG2 3.41Å; I30-V34 PolarHBondContact O-N 3.21Å; T31-V34 PolarHBondContact O-N 2.93Å; V34-T37 PolarHBondContact O-N 3.09Å; V34-L38 HydrophobicContact CG1-CD1 3.82Å; V34-L38 HydrophobicContact CG1-CG 4.2Å; V34-L38 WeakPolarHBondContact O-CG 3.49Å; V34-L38 PolarHBondContact O-N 2.83Å
35	L	88.9	Confident	87.2	Confident	128 Å²	128	97.4 Å²	97.4	67%	0.67	53%	0.534	S	S	*	.	H	α-helix	trans	-58.1	-53.8	-179.7	-170.8	71.3	0	0	0	114	T31 T37 L38 A39	T31-L35 PolarHBondContact O-N 2.73Å; T31-L35 VanDerWaalsContact O-N 3.14Å; L35-T37 VanDerWaalsContact C-N 3.32Å; L35-T37 PolarHBondContact O-N 3.4Å; L35-L38 PolarHBondContact O-N 2.71Å; L35-A39 PolarHBondContact O-N 3.5Å
36	P	94.2	Very high	88.3	Confident	71 Å²	71	96.6 Å²	96.6	46%	0.461	54%	0.536	S	S	.	.	H	α-helix	trans	-66.2	-33.9	176.8	25.6	-33.9	0	0	0	112.1	T32 V33 A39 V40	T32-P36 WeakPolarHBondContact O-CD 3.46Å; T32-P36 VanDerWaalsContact O-CG 3.32Å; T32-P36 WeakPolarHBondContact O-CG 3.37Å; V33-P36 VanDerWaalsContact O-CD 3.31Å; V33-P36 WeakPolarHBondContact O-CD 3.38Å; V33-P36 WeakPolarHBondContact O-CG 3.38Å; P36-A39 PolarHBondContact O-N 3.36Å; P36-V40 WeakPolarHBondContact O-CG2 3.48Å; P36-V40 PolarHBondContact O-N 2.88Å
37	T	95.6	Very high	89.3	Confident	76 Å²	76	97.9 Å²	97.9	47%	0.466	54%	0.539	S	S	.	.	H	α-helix	trans	-62	-46.3	177.3	-55.1	0	0	0	0	111.2	V33 V34 L35 A39 V40 V41	V33-T37 WeakPolarHBondContact O-CB 3.46Å; V33-T37 PolarHBondContact O-N 3.07Å; V33-T37 PolarHBondContact O-OG1 3.12Å; V34-T37 PolarHBondContact O-N 3.09Å; L35-T37 VanDerWaalsContact C-N 3.32Å; L35-T37 PolarHBondContact O-N 3.4Å; T37-A39 VanDerWaalsContact C-N 3.33Å; T37-A39 PolarHBondContact O-N 3.18Å; T37-V40 PolarHBondContact O-N 2.81Å; T37-V41 WeakPolarHBondContact O-CG2 3.22Å; T37-V41 PolarHBondContact O-N 3.15Å
38	L	96.5	Very high	90.2	Very high	102 Å²	102	96.5 Å²	96.5	53%	0.534	54%	0.538	S	S	.	.	H	α-helix	trans	-61.4	-40.6	176	-76.8	172.1	0	0	0	112	V34 L35 V40 V41 V42	V34-L38 HydrophobicContact CG1-CD1 3.82Å; V34-L38 HydrophobicContact CG1-CG 4.2Å; V34-L38 WeakPolarHBondContact O-CG 3.49Å; V34-L38 PolarHBondContact O-N 2.83Å; L35-L38 PolarHBondContact O-N 2.71Å; L38-V40 PolarHBondContact O-N 2.78Å; L38-V41 PolarHBondContact O-N 3Å; L38-V42 WeakPolarHBondContact O-CG2 3.31Å; L38-V42 PolarHBondContact O-N 3.34Å
39	A	96.6	Very high	91	Very high	61 Å²	61	94 Å²	94	50%	0.504	53%	0.531	S	S	.	.	H	α-helix	trans	-60.6	-44	177	0	0	0	0	0	112	L35 P36 T37 V42 L43	L35-A39 PolarHBondContact O-N 3.5Å; P36-A39 PolarHBondContact O-N 3.36Å; T37-A39 VanDerWaalsContact C-N 3.33Å; T37-A39 PolarHBondContact O-N 3.18Å; A39-V42 PolarHBondContact O-N 2.85Å; A39-L43 WeakPolarHBondContact O-CB 3.35Å; A39-L43 PolarHBondContact O-N 2.95Å
40	V	97.6	Very high	91.7	Very high	85 Å²	85	93.1 Å²	93.1	52%	0.515	52%	0.523	S	S	.	.	H	α-helix	trans	-63.9	-43.9	176.1	175.2	0	0	0	0	111.1	P36 T37 L38 V42 L43 L44	P36-V40 WeakPolarHBondContact O-CG2 3.48Å; P36-V40 PolarHBondContact O-N 2.88Å; T37-V40 PolarHBondContact O-N 2.81Å; L38-V40 PolarHBondContact O-N 2.78Å; V40-V42 PolarHBondContact O-N 2.95Å; V40-L43 PolarHBondContact O-N 3.48Å; V40-L44 HydrophobicContact CG1-CD1 4.12Å; V40-L44 HydrophobicContact CG1-CG 4.33Å; V40-L44 WeakPolarHBondContact O-CG 3.35Å; V40-L44 PolarHBondContact O-N 3.37Å
41	V	98	Very high	92.2	Very high	68 Å²	68	92.4 Å²	92.4	41%	0.412	52%	0.523	S	S	.	.	H	α-helix	trans	-60.8	-45.6	177.9	171.5	0	0	0	0	111.2	T37 L38 L43 L44 I45	T37-V41 WeakPolarHBondContact O-CG2 3.22Å; T37-V41 PolarHBondContact O-N 3.15Å; L38-V41 PolarHBondContact O-N 3Å; V41-L43 VanDerWaalsContact C-N 3.34Å; V41-L43 PolarHBondContact O-N 3.27Å; V41-L44 PolarHBondContact O-N 2.83Å; V41-I45 HydrophobicContact CG1-CD1 4Å; V41-I45 VanDerWaalsContact O-CG1 3.31Å; V41-I45 WeakPolarHBondContact O-CG1 3.39Å; V41-I45 PolarHBondContact O-N 3.42Å
42	V	97.6	Very high	92.4	Very high	87 Å²	87	91.1 Å²	91.1	53%	0.527	52%	0.522	S	S	.	.	H	α-helix	trans	-62	-43.4	176.3	172.2	0	0	0	0	111	L38 A39 V40 L44 I45 V46	L38-V42 WeakPolarHBondContact O-CG2 3.31Å; L38-V42 PolarHBondContact O-N 3.34Å; A39-V42 PolarHBondContact O-N 2.85Å; V40-V42 PolarHBondContact O-N 2.95Å; V42-L44 PolarHBondContact O-N 3.14Å; V42-I45 PolarHBondContact O-N 3.27Å; V42-V46 WeakPolarHBondContact O-CG2 3.45Å; V42-V46 PolarHBondContact O-N 2.83Å
43	L	97.4	Very high	92.2	Very high	111 Å²	111	91.3 Å²	91.3	58%	0.581	52%	0.524	S	S	*	.	H	α-helix	trans	-61.7	-44.4	177.7	-164.4	158	0	0	0	111.2	A39 V40 V41 I45 V46 V47	A39-L43 WeakPolarHBondContact O-CB 3.35Å; A39-L43 PolarHBondContact O-N 2.95Å; V40-L43 PolarHBondContact O-N 3.48Å; V41-L43 VanDerWaalsContact C-N 3.34Å; V41-L43 PolarHBondContact O-N 3.27Å; L43-I45 VanDerWaalsContact C-N 3.33Å; L43-I45 PolarHBondContact O-N 3.41Å; L43-V46 PolarHBondContact O-N 3.47Å; L43-V47 HydrophobicContact CD2-CG2 3.82Å; L43-V47 WeakPolarHBondContact O-CG2 3.45Å; L43-V47 PolarHBondContact O-N 3.39Å
44	L	97.1	Very high	91.5	Very high	108 Å²	108	93.6 Å²	93.6	57%	0.565	52%	0.522	S	S	*	.	H	α-helix	trans	-61.2	-40.4	175.1	-72.5	175.7	0	0	0	112.1	V40 V41 V42 V47 F48	V40-L44 HydrophobicContact CG1-CD1 4.12Å; V40-L44 HydrophobicContact CG1-CG 4.33Å; V40-L44 WeakPolarHBondContact O-CG 3.35Å; V40-L44 PolarHBondContact O-N 3.37Å; V41-L44 PolarHBondContact O-N 2.83Å; V42-L44 PolarHBondContact O-N 3.14Å; L44-V47 PolarHBondContact O-N 2.83Å; L44-F48 WeakPolarHBondContact O-CB 3.5Å; L44-F48 PolarHBondContact O-N 3.26Å
45	I	96.3	Very high	90.1	Very high	97 Å²	97	95.3 Å²	95.3	50%	0.497	54%	0.535	S	S	.	.	H	α-helix	trans	-62.9	-45.7	174.8	-69	166	0	0	0	110.3	V41 V42 L43 V47 F48 V49	V41-I45 HydrophobicContact CG1-CD1 4Å; V41-I45 VanDerWaalsContact O-CG1 3.31Å; V41-I45 WeakPolarHBondContact O-CG1 3.39Å; V41-I45 PolarHBondContact O-N 3.42Å; V42-I45 PolarHBondContact O-N 3.27Å; L43-I45 VanDerWaalsContact C-N 3.33Å; L43-I45 PolarHBondContact O-N 3.41Å; I45-V47 PolarHBondContact O-N 3.44Å; I45-F48 PolarHBondContact O-N 3.09Å; I45-V49 HydrophobicContact CG2-CG2 4.26Å; I45-V49 WeakPolarHBondContact O-CB 3.35Å; I45-V49 VanDerWaalsContact O-CG2 3.28Å; I45-V49 WeakPolarHBondContact O-CG2 3.5Å; I45-V49 PolarHBondContact O-N 3.25Å
46	V	94	Very high	88.7	Confident	93 Å²	93	94.6 Å²	94.6	56%	0.564	54%	0.536	S	S	*	.	H	α-helix	trans	-61.3	-45.6	178.2	171	0	0	0	0	111	V42 L43 V49 Y50	V42-V46 WeakPolarHBondContact O-CG2 3.45Å; V42-V46 PolarHBondContact O-N 2.83Å; L43-V46 PolarHBondContact O-N 3.47Å; V46-V49 PolarHBondContact O-N 3.18Å; V46-Y50 WeakPolarHBondContact O-CB 3.32Å; V46-Y50 PolarHBondContact O-N 3.2Å
47	V	93.4	Very high	87.1	Confident	72 Å²	72	96.7 Å²	96.7	44%	0.436	54%	0.542	S	S	.	.	H	α-helix	trans	-63.1	-44.5	176.4	171.4	0	0	0	0	110.9	L43 L44 I45 Y50 V51	L43-V47 HydrophobicContact CD2-CG2 3.82Å; L43-V47 WeakPolarHBondContact O-CG2 3.45Å; L43-V47 PolarHBondContact O-N 3.39Å; L44-V47 PolarHBondContact O-N 2.83Å; I45-V47 PolarHBondContact O-N 3.44Å; V47-Y50 WeakPolarHBondContact O-CB 3.36Å; V47-Y50 PolarHBondContact O-N 2.88Å; V47-V51 HydrophobicContact CG1-CG2 4.32Å; V47-V51 WeakPolarHBondContact O-CB 3.41Å; V47-V51 VanDerWaalsContact O-CG2 3.31Å; V47-V51 WeakPolarHBondContact O-CG2 3.3Å; V47-V51 PolarHBondContact O-N 2.79Å
48	F	91.7	Very high	85.3	Confident	147 Å²	147	99 Å²	99	65%	0.645	56%	0.556	S	S	*	*	H	α-helix	trans	-61.9	-48.6	178.5	177.7	-96.5	0	0	0	111.4	L44 I45 Y50 V51 A52	L44-F48 WeakPolarHBondContact O-CB 3.5Å; L44-F48 PolarHBondContact O-N 3.26Å; I45-F48 PolarHBondContact O-N 3.09Å; F48-Y50 VanDerWaalsContact C-N 3.3Å; F48-Y50 PolarHBondContact O-N 2.94Å; F48-V51 PolarHBondContact O-N 3.46Å; F48-A52 HydrophobicContact CE1-CB 4.42Å; F48-A52 WeakPolarHBondContact O-CB 3.25Å; F48-A52 PolarHBondContact O-N 2.89Å
49	V	90.7	Very high	83.2	Confident	72 Å²	72	106.2 Å²	106.2	44%	0.436	59%	0.587	S	S	.	*	H	α-helix	trans	-60.6	-44.2	175.3	171	0	0	0	0	109.6	I45 V46 V51 A52 T53	I45-V49 HydrophobicContact CG2-CG2 4.26Å; I45-V49 WeakPolarHBondContact O-CB 3.35Å; I45-V49 VanDerWaalsContact O-CG2 3.28Å; I45-V49 WeakPolarHBondContact O-CG2 3.5Å; I45-V49 PolarHBondContact O-N 3.25Å; V46-V49 PolarHBondContact O-N 3.18Å; V49-V51 PolarHBondContact O-N 2.81Å; V49-A52 PolarHBondContact O-N 2.85Å; V49-T53 HydrophobicContact CG1-CG2 4.02Å; V49-T53 VanDerWaalsContact O-CB 3.26Å; V49-T53 WeakPolarHBondContact O-CB 3.37Å; V49-T53 WeakPolarHBondContact O-CG2 3.42Å; V49-T53 PolarHBondContact O-N 2.74Å; V49-T53 PolarHBondContact O-OG1 2.9Å
50	Y	88.5	Confident	82.5	Confident	114 Å²	114	108.5 Å²	108.5	45%	0.447	59%	0.591	S	S	.	*	H	α-helix	trans	-59.4	-47.8	177.9	-176.3	-97.1	0	0	0	111.7	V46 V47 F48 R54 I57	V46-Y50 WeakPolarHBondContact O-CB 3.32Å; V46-Y50 PolarHBondContact O-N 3.2Å; V47-Y50 WeakPolarHBondContact O-CB 3.36Å; V47-Y50 PolarHBondContact O-N 2.88Å; F48-Y50 VanDerWaalsContact C-N 3.3Å; F48-Y50 PolarHBondContact O-N 2.94Å; Y50-R54 HydrophobicContact CD1-CG 4.14Å; Y50-R54 HydrophobicContact CD2-CG 3.82Å; Y50-R54 HydrophobicContact CE1-CG 3.93Å; Y50-R54 HydrophobicContact CE2-CG 3.6Å; Y50-R54 HydrophobicContact CG-CG 4.08Å; Y50-R54 WeakPolarHBondContact O-CA 3.44Å; Y50-R54 WeakPolarHBondContact O-CB 3.47Å; Y50-R54 WeakPolarHBondContact O-CG 3.12Å; Y50-R54 PolarHBondContact O-N 2.71Å; Y50-R54 PolarHBondContact OH-NE 3.47Å; Y50-I57 HydrophobicContact CE1-CD1 4.31Å
51	V	86.3	Confident	81.7	Confident	92 Å²	92	109.7 Å²	109.7	56%	0.558	60%	0.595	S	S	*	*	H	α-helix	trans	-67.4	-38.8	177.9	172.4	0	0	0	0	111.9	V47 F48 V49	V47-V51 HydrophobicContact CG1-CG2 4.32Å; V47-V51 WeakPolarHBondContact O-CB 3.41Å; V47-V51 VanDerWaalsContact O-CG2 3.31Å; V47-V51 WeakPolarHBondContact O-CG2 3.3Å; V47-V51 PolarHBondContact O-N 2.79Å; F48-V51 PolarHBondContact O-N 3.46Å; V49-V51 PolarHBondContact O-N 2.81Å
52	A	82	Confident	80.8	Confident	68 Å²	68	112 Å²	112	56%	0.562	61%	0.606	S	S	*	*	H	α-helix	trans	-77.2	-27.9	-178.7	0	0	0	0	0	113.4	F48 V49	F48-A52 HydrophobicContact CE1-CB 4.42Å; F48-A52 WeakPolarHBondContact O-CB 3.25Å; F48-A52 PolarHBondContact O-N 2.89Å; V49-A52 PolarHBondContact O-N 2.85Å
53	T	80	Confident	79.8	Confident	103 Å²	103	113.5 Å²	113.5	63%	0.632	61%	0.61	S	S	*	*	H	α-helix	trans	-102.3	-17.6	-179.5	61.2	0	0	0	0	113.7	V49	V49-T53 HydrophobicContact CG1-CG2 4.02Å; V49-T53 VanDerWaalsContact O-CB 3.26Å; V49-T53 WeakPolarHBondContact O-CB 3.37Å; V49-T53 WeakPolarHBondContact O-CG2 3.42Å; V49-T53 PolarHBondContact O-N 2.74Å; V49-T53 PolarHBondContact O-OG1 2.9Å
54	R	68.7	Low	78.7	Confident	139 Å²	139	113.6 Å²	113.6	53%	0.525	61%	0.612	S	S	.	*	S	Bend	trans	-81	127.1	165.8	-70.8	-70.1	-160.8	-147.4	0.9	108.5	Y50 T56	Y50-R54 HydrophobicContact CD1-CG 4.14Å; Y50-R54 HydrophobicContact CD2-CG 3.82Å; Y50-R54 HydrophobicContact CE1-CG 3.93Å; Y50-R54 HydrophobicContact CE2-CG 3.6Å; Y50-R54 HydrophobicContact CG-CG 4.08Å; Y50-R54 WeakPolarHBondContact O-CA 3.44Å; Y50-R54 WeakPolarHBondContact O-CB 3.47Å; Y50-R54 WeakPolarHBondContact O-CG 3.12Å; Y50-R54 PolarHBondContact O-N 2.71Å; Y50-R54 PolarHBondContact OH-NE 3.47Å; R54-T56 PolarHBondContact O-N 3.07Å
55	P	60.4	Low	77.5	Confident	107 Å²	107	114 Å²	114	70%	0.695	62%	0.615	S	S	*	*			trans	-64.2	122.6	172.6	29.4	-30.3	0	0	0	106.3	I57	P55-I57 PolarHBondContact O-N 3Å
56	T	61	Low	76.1	Confident	113 Å²	113	115.2 Å²	115.2	69%	0.693	62%	0.624	S	S	*	*			trans	31.7	88.8	157.5	55.4	0	0	0	0	112.9	R54 T58	R54-T56 PolarHBondContact O-N 3.07Å; T56-T58 PolarHBondContact O-N 3.16Å
57	I	60.7	Low	74.7	Confident	116 Å²	116	116.9 Å²	116.9	60%	0.595	63%	0.628	S	S	*	*			trans	-58	98.4	155.5	-63.9	168.5	0	0	0	104	Y50 P55 E59	Y50-I57 HydrophobicContact CE1-CD1 4.31Å; P55-I57 PolarHBondContact O-N 3Å; I57-E59 VanDerWaalsContact C-N 3.26Å; I57-E59 PolarHBondContact O-N 2.88Å
58	T	56.2	Low	73.2	Confident	124 Å²	124	120.7 Å²	120.7	76%	0.761	64%	0.644	S	S	*	*			trans	-63.7	89.4	171.5	44.1	0	0	0	0	106.5	T56	T56-T58 PolarHBondContact O-N 3.16Å
59	E	52.2	Low	71.5	Confident	253 Å²	253	118.3 Å²	118.3	100%	1.182	64%	0.644	S	S	*	*			trans	-133.1	0	149.7	-79.3	-167.3	99.4	0	0	108.5	I57	I57-E59 VanDerWaalsContact C-N 3.26Å; I57-E59 PolarHBondContact O-N 2.88Å

Retrieved 59 of 59 residues in 421.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).