A0A096NRM7_PAPAN Loading...

Dynein light chain Tctex-type 1

AlphaFold DB (P63172), UniProt , Accession A0A096NRM7, Species PAPAN (Papio anubis, Olive baboon), Gene DYNLT1, Length 113 aa.

						>A0A096NRM7_PAPAN|A0A096NRM7|DYNLT1
MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.7	Low	75.5	Confident	195 Å²	195	118.4 Å²	118.4	96%	0.961	61%	0.611	S	S	*	*				0	-47.3	0	-80.2	-177.6	175.9	0	0	109.7	D3 Y4 Q5	M1-D3 PolarHBondContact O-N 3.24Å; M1-Y4 PolarHBondContact O-N 3.15Å; M1-Q5 PolarHBondContact O-N 2.62Å
2	E	65.1	Low	77.2	Confident	162 Å²	162	110.7 Å²	110.7	76%	0.757	57%	0.569	S	S	*	*	H	α-helix	trans	-56.6	-45.7	175.2	-65.6	177.4	169.2	0	0	113.4	Y4 Q5 A6	E2-Y4 PolarHBondContact O-N 2.91Å; E2-Q5 PolarHBondContact O-N 3.13Å; E2-Q5 VanDerWaalsContact O-N 3.12Å; E2-A6 PolarHBondContact O-N 3.46Å; E2-A6 VanDerWaalsContact O-N 3.11Å
3	D	70.7	Confident	78.7	Confident	138 Å²	138	105.6 Å²	105.6	74%	0.738	55%	0.547	S	S	*	.	H	α-helix	trans	-58.9	-32.6	179.1	-62.2	-40.8	0	0	0	113.8	M1 A7	M1-D3 PolarHBondContact O-N 3.24Å; D3-A7 PolarHBondContact O-N 2.83Å
4	Y	69.1	Low	80	Confident	190 Å²	190	103.1 Å²	103.1	75%	0.745	54%	0.538	S	S	*	.	H	α-helix	trans	-73.5	-37.1	179.2	-74.8	-84.3	0	0	0	111.9	M1 E2 E8	M1-Y4 PolarHBondContact O-N 3.15Å; E2-Y4 PolarHBondContact O-N 2.91Å; Y4-E8 PolarHBondContact O-N 2.8Å
5	Q	68.7	Low	81.1	Confident	123 Å²	123	104.3 Å²	104.3	58%	0.575	55%	0.545	S	S	*	.	H	α-helix	trans	-68.7	-43.1	177.7	-73.7	174.5	-45.4	0	0	111.1	M1 E2 A7 E8 E9	M1-Q5 PolarHBondContact O-N 2.62Å; E2-Q5 PolarHBondContact O-N 3.13Å; E2-Q5 VanDerWaalsContact O-N 3.12Å; Q5-A7 VanDerWaalsContact C-N 3.3Å; Q5-A7 PolarHBondContact O-N 2.72Å; Q5-E8 PolarHBondContact O-N 3.12Å; Q5-E9 WeakPolarHBondContact O-CG 3.22Å; Q5-E9 PolarHBondContact O-N 2.86Å
6	A	74	Confident	82.2	Confident	52 Å²	52	102 Å²	102	43%	0.43	53%	0.531	S	S	.	.	H	α-helix	trans	-62.4	-36.3	177.3	0	0	0	0	0	112.9	E2 E9 T10	E2-A6 PolarHBondContact O-N 3.46Å; E2-A6 VanDerWaalsContact O-N 3.11Å; A6-E9 PolarHBondContact O-N 2.83Å; A6-T10 PolarHBondContact O-N 2.8Å; A6-T10 PolarHBondContact O-OG1 3.01Å
7	A	77.3	Confident	83.1	Confident	54 Å²	54	96.1 Å²	96.1	45%	0.446	50%	0.5	S	S	.	.	H	α-helix	trans	-66.3	-42	175.4	0	0	0	0	0	111.9	D3 Q5 E9 T10 A11	D3-A7 PolarHBondContact O-N 2.83Å; Q5-A7 VanDerWaalsContact C-N 3.3Å; Q5-A7 PolarHBondContact O-N 2.72Å; A7-E9 VanDerWaalsContact C-N 3.33Å; A7-E9 PolarHBondContact O-N 2.84Å; A7-T10 PolarHBondContact O-N 2.83Å; A7-T10 PolarHBondContact O-OG1 3.08Å; A7-A11 VanDerWaalsContact O-CB 3.27Å; A7-A11 WeakPolarHBondContact O-CB 3.47Å; A7-A11 PolarHBondContact O-N 2.91Å
8	E	77.3	Confident	84	Confident	133 Å²	133	91.8 Å²	91.8	62%	0.621	48%	0.48	S	S	*	.	H	α-helix	trans	-65.8	-35.5	177.7	-168.1	172.7	-165.9	0	0	112.4	Y4 Q5 T10 A11	Y4-E8 PolarHBondContact O-N 2.8Å; Q5-E8 PolarHBondContact O-N 3.12Å; E8-T10 VanDerWaalsContact C-N 3.26Å; E8-T10 PolarHBondContact O-N 3.27Å; E8-A11 PolarHBondContact O-N 3.18Å
9	E	82.6	Confident	84.7	Confident	140 Å²	140	91.3 Å²	91.3	65%	0.654	48%	0.477	S	S	*	.	H	α-helix	trans	-64.2	-29.2	175.7	-75.7	179	-176.8	0	0	112.9	Q5 A6 A7 K59	Q5-E9 WeakPolarHBondContact O-CG 3.22Å; Q5-E9 PolarHBondContact O-N 2.86Å; A6-E9 PolarHBondContact O-N 2.83Å; A7-E9 VanDerWaalsContact C-N 3.33Å; A7-E9 PolarHBondContact O-N 2.84Å; E9-K59 WeakPolarHBondContact O-CE 3.44Å; E9-K59 WeakPolarHBondContact O-CG 3.27Å
10	T	89	Confident	85.4	Confident	75 Å²	75	87.7 Å²	87.7	46%	0.46	46%	0.458	S	S	.	.	H	α-helix	trans	-100.7	-13.9	-179.2	54.2	0	0	0	0	113.7	A6 A7 E8 P60 F61	A6-T10 PolarHBondContact O-N 2.8Å; A6-T10 PolarHBondContact O-OG1 3.01Å; A7-T10 PolarHBondContact O-N 2.83Å; A7-T10 PolarHBondContact O-OG1 3.08Å; E8-T10 VanDerWaalsContact C-N 3.26Å; E8-T10 PolarHBondContact O-N 3.27Å; T10-P60 HydrophobicContact CG2-CG 4.27Å; T10-F61 VanDerWaalsContact O-CE2 3.24Å; T10-F61 WeakPolarHBondContact O-CE2 3.42Å; T10-F61 WeakPolarHBondContact O-CZ 3.2Å
11	A	93.9	Very high	86.1	Confident	40 Å²	40	83.5 Å²	83.5	33%	0.331	44%	0.437	S	S	.	.	S	Bend	trans	-74.5	147	-176.3	0	0	0	0	0	113.7	A7 E8 V13 K59	A7-A11 VanDerWaalsContact O-CB 3.27Å; A7-A11 WeakPolarHBondContact O-CB 3.47Å; A7-A11 PolarHBondContact O-N 2.91Å; E8-A11 PolarHBondContact O-N 3.18Å; A11-V13 HydrophobicContact CB-CG2 4.5Å; A11-V13 PolarHBondContact O-N 3.18Å; A11-V13 VanDerWaalsContact O-N 3.13Å; A11-K59 WeakPolarHBondContact O-CD 3.45Å; A11-K59 PolarHBondContact O-NZ 3.37Å
12	F	96.3	Very high	87.8	Confident	26 Å²	26	78.9 Å²	78.9	11%	0.114	41%	0.411	C	S	.	.			trans	-74.7	97.7	167.2	-173.9	-89.5	0	0	0	109.7	V14 V17 F61 C93	F12-V14 HydrophobicContact CD1-CG2 4.1Å; F12-V14 HydrophobicContact CE1-CG2 4.09Å; F12-V14 PolarHBondContact O-N 2.9Å; F12-V17 HydrophobicContact CD2-CG2 4.24Å; F12-V17 HydrophobicContact CE1-CB 4.47Å; F12-V17 HydrophobicContact CE1-CG2 4.16Å; F12-V17 HydrophobicContact CE2-CG1 4.38Å; F12-V17 HydrophobicContact CE2-CG2 3.73Å; F12-V17 HydrophobicContact CZ-CB 4.06Å; F12-V17 HydrophobicContact CZ-CG1 3.85Å; F12-V17 HydrophobicContact CZ-CG2 3.69Å; F12-F61 HydrophobicContact CB-CE1 4.42Å; F12-F61 HydrophobicContact CB-CE2 4.07Å; F12-F61 HydrophobicContact CB-CZ 3.79Å; F12-C93 HydrophobicContact CE1-CB 4.22Å; F12-C93 HydrophobicContact CZ-CB 4.22Å
13	V	96.3	Very high	89.3	Confident	45 Å²	45	77.3 Å²	77.3	27%	0.273	40%	0.404	S	S	.	.			trans	-87.4	105	-177.8	-179.1	0	0	0	0	109.5	A11 D15 E16 V17	A11-V13 HydrophobicContact CB-CG2 4.5Å; A11-V13 PolarHBondContact O-N 3.18Å; A11-V13 VanDerWaalsContact O-N 3.13Å; V13-D15 VanDerWaalsContact C-N 3.3Å; V13-D15 PolarHBondContact O-N 3.17Å; V13-E16 HydrophobicContact CB-CB 3.94Å; V13-E16 HydrophobicContact CG1-CB 3.88Å; V13-E16 WeakPolarHBondContact O-CB 3.42Å; V13-E16 PolarHBondContact O-N 3.48Å; V13-V17 WeakPolarHBondContact O-CG2 3.23Å; V13-V17 PolarHBondContact O-N 2.82Å
14	V	96.6	Very high	90.7	Very high	71 Å²	71	71 Å²	71	43%	0.43	37%	0.37	S	S	.	.	H	α-helix	trans	-57.6	-39.7	-173.6	176.7	0	0	0	0	112.6	F12 V17 S18 C93	F12-V14 HydrophobicContact CD1-CG2 4.1Å; F12-V14 HydrophobicContact CE1-CG2 4.09Å; F12-V14 PolarHBondContact O-N 2.9Å; V14-V17 PolarHBondContact O-N 3.19Å; V14-S18 WeakPolarHBondContact O-CB 3.43Å; V14-S18 PolarHBondContact O-N 3.39Å; V14-C93 HydrophobicContact CG1-CB 4.22Å
15	D	97.6	Very high	92.1	Very high	121 Å²	121	61.9 Å²	61.9	65%	0.647	34%	0.335	S	S	*	.	H	α-helix	trans	-69	-39.5	-179.5	-73.2	-25.1	0	0	0	112.3	V13 S18 N19	V13-D15 VanDerWaalsContact C-N 3.3Å; V13-D15 PolarHBondContact O-N 3.17Å; D15-S18 PolarHBondContact O-N 3.48Å; D15-N19 PolarHBondContact O-N 3.39Å; D15-N19 PolarHBondContact O-ND2 2.91Å
16	E	97.3	Very high	93.5	Very high	67 Å²	67	61 Å²	61	31%	0.313	33%	0.331	S	S	.	.	H	α-helix	trans	-61.6	-49.6	174.2	178.7	178.6	-137.8	0	0	110.5	V13 S18 N19 I20 L57 K59	V13-E16 HydrophobicContact CB-CB 3.94Å; V13-E16 HydrophobicContact CG1-CB 3.88Å; V13-E16 WeakPolarHBondContact O-CB 3.42Å; V13-E16 PolarHBondContact O-N 3.48Å; E16-S18 PolarHBondContact O-N 3.26Å; E16-N19 PolarHBondContact O-N 3.21Å; E16-I20 HydrophobicContact CG-CD1 4.44Å; E16-I20 WeakPolarHBondContact O-CG1 3.5Å; E16-I20 PolarHBondContact O-N 2.82Å; E16-I20 VanDerWaalsContact O-N 3.09Å; E16-L57 HydrophobicContact CG-CD1 4.19Å; E16-L57 HydrophobicContact CG-CD2 4.38Å; E16-L57 VanDerWaalsContact OE1-CD2 3.28Å; E16-L57 WeakPolarHBondContact OE1-CD2 3.17Å; E16-K59 IonicContact OE2-NZ 2.82Å; E16-K59 PolarHBondContact OE2-NZ 2.79Å
17	V	98.4	Very high	94.6	Very high	2 Å²	2	62.3 Å²	62.3	1%	0.012	34%	0.337	C	S	.	.	H	α-helix	trans	-63.2	-41.4	177.1	175.6	0	0	0	0	111.5	F12 V13 V14 N19 I20 V21 L54 C93 A108	F12-V17 HydrophobicContact CD2-CG2 4.24Å; F12-V17 HydrophobicContact CE1-CB 4.47Å; F12-V17 HydrophobicContact CE1-CG2 4.16Å; F12-V17 HydrophobicContact CE2-CG1 4.38Å; F12-V17 HydrophobicContact CE2-CG2 3.73Å; F12-V17 HydrophobicContact CZ-CB 4.06Å; F12-V17 HydrophobicContact CZ-CG1 3.85Å; F12-V17 HydrophobicContact CZ-CG2 3.69Å; V13-V17 WeakPolarHBondContact O-CG2 3.23Å; V13-V17 PolarHBondContact O-N 2.82Å; V14-V17 PolarHBondContact O-N 3.19Å; V17-N19 VanDerWaalsContact C-N 3.31Å; V17-N19 PolarHBondContact O-N 2.94Å; V17-I20 PolarHBondContact O-N 3.12Å; V17-V21 HydrophobicContact CG1-CG2 4.37Å; V17-V21 VanDerWaalsContact O-CG2 3.29Å; V17-V21 WeakPolarHBondContact O-CG2 3.44Å; V17-V21 PolarHBondContact O-N 3.35Å; V17-L54 HydrophobicContact CB-CD2 4.3Å; V17-L54 HydrophobicContact CG1-CD2 4.05Å; V17-L54 HydrophobicContact CG2-CD2 3.76Å; V17-C93 HydrophobicContact CB-CB 4.22Å; V17-C93 HydrophobicContact CG1-CB 3.71Å; V17-A108 HydrophobicContact CG1-CB 3.78Å
18	S	98.4	Very high	95.6	Very high	18 Å²	18	60.2 Å²	60.2	13%	0.126	32%	0.32	C	S	.	.	H	α-helix	trans	-59.6	-42.2	177.7	-173.4	0	0	0	0	111.6	V14 D15 E16 V21 K22	V14-S18 WeakPolarHBondContact O-CB 3.43Å; V14-S18 PolarHBondContact O-N 3.39Å; D15-S18 PolarHBondContact O-N 3.48Å; E16-S18 PolarHBondContact O-N 3.26Å; S18-V21 PolarHBondContact O-N 2.95Å; S18-K22 VanDerWaalsContact O-CG 3.25Å; S18-K22 WeakPolarHBondContact O-CG 3.1Å; S18-K22 PolarHBondContact O-N 2.82Å; S18-K22 WeakPolarHBondContact OG-CE 3.41Å; S18-K22 PolarHBondContact OG-NZ 3Å
19	N	98.6	Very high	96.6	Very high	82 Å²	82	54 Å²	54	44%	0.439	29%	0.29	S	S	.	.	H	α-helix	trans	-67.1	-45.3	178	-69.3	-23.6	0	0	0	111.8	D15 E16 V17 V21 K22 E23	D15-N19 PolarHBondContact O-N 3.39Å; D15-N19 PolarHBondContact O-ND2 2.91Å; E16-N19 PolarHBondContact O-N 3.21Å; V17-N19 VanDerWaalsContact C-N 3.31Å; V17-N19 PolarHBondContact O-N 2.94Å; N19-V21 VanDerWaalsContact C-N 3.28Å; N19-V21 PolarHBondContact O-N 3.09Å; N19-K22 PolarHBondContact O-N 3.32Å; N19-E23 WeakPolarHBondContact O-CG 3.33Å; N19-E23 PolarHBondContact O-N 3.18Å
20	I	98.7	Very high	97	Very high	19 Å²	19	47.7 Å²	47.7	10%	0.097	26%	0.263	C	S	.	.	H	α-helix	trans	-53.8	-47	173.6	-73.3	168.8	0	0	0	111.1	E16 V17 E23 A24 T50 Q53 L54 L57	E16-I20 HydrophobicContact CG-CD1 4.44Å; E16-I20 WeakPolarHBondContact O-CG1 3.5Å; E16-I20 PolarHBondContact O-N 2.82Å; E16-I20 VanDerWaalsContact O-N 3.09Å; V17-I20 PolarHBondContact O-N 3.12Å; I20-E23 PolarHBondContact O-N 3.27Å; I20-A24 WeakPolarHBondContact O-CB 3.48Å; I20-A24 PolarHBondContact O-N 3.19Å; I20-T50 HydrophobicContact CG2-CG2 4.28Å; I20-Q53 HydrophobicContact CB-CB 4.44Å; I20-Q53 HydrophobicContact CD1-CB 4.17Å; I20-Q53 HydrophobicContact CG1-CB 4.12Å; I20-Q53 HydrophobicContact CG2-CB 3.52Å; I20-Q53 HydrophobicContact CG2-CG 4.29Å; I20-L54 HydrophobicContact CD1-CD2 4.02Å; I20-L54 HydrophobicContact CG2-CG 4.44Å; I20-L57 HydrophobicContact CD1-CD1 3.89Å; I20-L57 HydrophobicContact CD1-CD2 4.19Å; I20-L57 HydrophobicContact CD1-CG 4.23Å
21	V	98.8	Very high	97.3	Very high	0 Å²	0	47.9 Å²	47.9	0%	0	28%	0.28	C	S	.	.	H	α-helix	trans	-65.5	-43.7	-179.6	171.4	0	0	0	0	111.3	V17 S18 N19 E23 A24 I25 T50 V95 V106 A108	V17-V21 HydrophobicContact CG1-CG2 4.37Å; V17-V21 VanDerWaalsContact O-CG2 3.29Å; V17-V21 WeakPolarHBondContact O-CG2 3.44Å; V17-V21 PolarHBondContact O-N 3.35Å; S18-V21 PolarHBondContact O-N 2.95Å; N19-V21 VanDerWaalsContact C-N 3.28Å; N19-V21 PolarHBondContact O-N 3.09Å; V21-E23 PolarHBondContact O-N 2.95Å; V21-A24 PolarHBondContact O-N 3.32Å; V21-I25 HydrophobicContact CG1-CD1 3.85Å; V21-I25 HydrophobicContact CG1-CG1 4.46Å; V21-I25 VanDerWaalsContact O-CG1 3.26Å; V21-I25 WeakPolarHBondContact O-CG1 3.45Å; V21-I25 PolarHBondContact O-N 3.22Å; V21-T50 HydrophobicContact CG2-CG2 3.68Å; V21-V95 HydrophobicContact CB-CB 4.36Å; V21-V95 HydrophobicContact CB-CG2 3.85Å; V21-V95 HydrophobicContact CG1-CB 3.58Å; V21-V95 HydrophobicContact CG1-CG1 4.16Å; V21-V95 HydrophobicContact CG1-CG2 3.62Å; V21-V106 HydrophobicContact CG1-CB 3.56Å; V21-V106 HydrophobicContact CG1-CG1 3.59Å; V21-V106 HydrophobicContact CG1-CG2 4.2Å; V21-V106 HydrophobicContact CG2-CG1 4.32Å; V21-A108 HydrophobicContact CG2-CB 4.39Å
22	K	98.4	Very high	97.4	Very high	98 Å²	98	49.9 Å²	49.9	43%	0.426	29%	0.285	S	S	.	.	H	α-helix	trans	-61.1	-43.9	177.4	-73.1	167.9	-169.9	164.3	0	111.9	S18 N19 I25 E26 V95	S18-K22 VanDerWaalsContact O-CG 3.25Å; S18-K22 WeakPolarHBondContact O-CG 3.1Å; S18-K22 PolarHBondContact O-N 2.82Å; S18-K22 WeakPolarHBondContact OG-CE 3.41Å; S18-K22 PolarHBondContact OG-NZ 3Å; N19-K22 PolarHBondContact O-N 3.32Å; K22-I25 PolarHBondContact O-N 2.98Å; K22-E26 PolarHBondContact O-N 3.4Å; K22-V95 HydrophobicContact CG-CG1 3.83Å
23	E	98.4	Very high	97.5	Very high	130 Å²	130	51.2 Å²	51.2	61%	0.607	30%	0.302	S	S	*	.	H	α-helix	trans	-63.6	-42.7	177.3	-72.1	176.9	-172.7	0	0	111.7	N19 I20 V21 I25 E26 S27	N19-E23 WeakPolarHBondContact O-CG 3.33Å; N19-E23 PolarHBondContact O-N 3.18Å; I20-E23 PolarHBondContact O-N 3.27Å; V21-E23 PolarHBondContact O-N 2.95Å; E23-I25 VanDerWaalsContact C-N 3.34Å; E23-I25 PolarHBondContact O-N 3.3Å; E23-E26 PolarHBondContact O-N 2.96Å; E23-S27 WeakPolarHBondContact O-CB 3.32Å; E23-S27 PolarHBondContact O-N 3.01Å
24	A	98.7	Very high	97.6	Very high	4 Å²	4	51.3 Å²	51.3	3%	0.033	30%	0.297	C	S	.	.	H	α-helix	trans	-62	-40.3	175.7	0	0	0	0	0	112.3	I20 V21 A28 Q49 T50	I20-A24 WeakPolarHBondContact O-CB 3.48Å; I20-A24 PolarHBondContact O-N 3.19Å; V21-A24 PolarHBondContact O-N 3.32Å; A24-A28 VanDerWaalsContact O-CB 3.28Å; A24-A28 WeakPolarHBondContact O-CB 3.3Å; A24-A28 PolarHBondContact O-N 3.47Å; A24-Q49 HydrophobicContact CB-CB 3.87Å; A24-T50 WeakPolarHBondContact CB-OG1 3.49Å
25	I	98.6	Very high	97.7	Very high	0 Å²	0	52.2 Å²	52.2	0%	0	30%	0.297	C	S	.	.	H	α-helix	trans	-63.8	-48.8	175	-67.9	166	0	0	0	110.9	V21 K22 E23 S27 A28 I29 G30 V46 V95 W97 C104 V106	V21-I25 HydrophobicContact CG1-CD1 3.85Å; V21-I25 HydrophobicContact CG1-CG1 4.46Å; V21-I25 VanDerWaalsContact O-CG1 3.26Å; V21-I25 WeakPolarHBondContact O-CG1 3.45Å; V21-I25 PolarHBondContact O-N 3.22Å; K22-I25 PolarHBondContact O-N 2.98Å; E23-I25 VanDerWaalsContact C-N 3.34Å; E23-I25 PolarHBondContact O-N 3.3Å; I25-S27 VanDerWaalsContact C-N 3.34Å; I25-S27 PolarHBondContact O-N 3.49Å; I25-A28 PolarHBondContact O-N 2.96Å; I25-I29 HydrophobicContact CG2-CD1 4.27Å; I25-I29 WeakPolarHBondContact O-CB 3.39Å; I25-I29 PolarHBondContact O-N 3.42Å; I25-G30 PolarHBondContact O-N 3.33Å; I25-V46 HydrophobicContact CG1-CG1 4.08Å; I25-V46 HydrophobicContact CG1-CG2 4.39Å; I25-V95 HydrophobicContact CD1-CG1 4.01Å; I25-W97 HydrophobicContact CD1-CB 3.95Å; I25-W97 HydrophobicContact CG2-CB 3.88Å; I25-W97 HydrophobicContact CG2-CD2 3.55Å; I25-W97 HydrophobicContact CG2-CE3 4.01Å; I25-W97 HydrophobicContact CG2-CG 3.5Å; I25-W97 VanDerWaalsContact CG2-CG 3.5Å; I25-C104 HydrophobicContact CG2-CB 4.5Å; I25-V106 HydrophobicContact CD1-CB 4.33Å; I25-V106 HydrophobicContact CD1-CG2 3.69Å; I25-V106 HydrophobicContact CG1-CG2 3.89Å
26	E	97.7	Very high	97.7	Very high	104 Å²	104	53.4 Å²	53.4	49%	0.486	30%	0.298	S	S	.	.	H	α-helix	trans	-64.9	-39.9	-178.1	-166.3	60.5	-146	0	0	111.7	K22 E23 G30 W97	K22-E26 PolarHBondContact O-N 3.4Å; E23-E26 PolarHBondContact O-N 2.96Å; E26-G30 WeakPolarHBondContact O-CA 3.15Å; E26-G30 PolarHBondContact O-N 3.42Å; E26-G30 WeakPolarHBondContact OE1-CA 3.36Å; E26-W97 PolarHBondContact OE2-NE1 3.34Å
27	S	98	Very high	97.8	Very high	80 Å²	80	55 Å²	55	56%	0.559	32%	0.317	S	S	*	.	H	α-helix	trans	-63.7	-44.3	175.6	168.5	0	0	0	0	112.8	E23 I25 Q49	E23-S27 WeakPolarHBondContact O-CB 3.32Å; E23-S27 PolarHBondContact O-N 3.01Å; I25-S27 VanDerWaalsContact C-N 3.34Å; I25-S27 PolarHBondContact O-N 3.49Å; S27-Q49 VanDerWaalsContact CB-OE1 3.25Å; S27-Q49 PolarHBondContact OG-NE2 3.37Å; S27-Q49 PolarHBondContact OG-OE1 3.04Å
28	A	97.8	Very high	97.8	Very high	10 Å²	10	58.8 Å²	58.8	8%	0.083	33%	0.333	C	S	.	.	H	α-helix	trans	-80.4	-41	-176.8	0	0	0	0	0	113.4	A24 I25 W42 N45 V46	A24-A28 VanDerWaalsContact O-CB 3.28Å; A24-A28 WeakPolarHBondContact O-CB 3.3Å; A24-A28 PolarHBondContact O-N 3.47Å; I25-A28 PolarHBondContact O-N 2.96Å; A28-W42 PolarHBondContact O-NE1 2.85Å; A28-N45 HydrophobicContact CB-CB 3.77Å; A28-V46 HydrophobicContact CB-CG2 3.55Å
29	I	97.7	Very high	97.8	Very high	1 Å²	1	58.7 Å²	58.7	1%	0.005	33%	0.332	C	S	.	.	T	Hydrogen-bonded Turn	trans	-108.3	-53.6	-170.6	-60.3	175.9	0	0	0	110.9	I25 G31 N32 W42 V46 I69 W97 M102 C104	I25-I29 HydrophobicContact CG2-CD1 4.27Å; I25-I29 WeakPolarHBondContact O-CB 3.39Å; I25-I29 PolarHBondContact O-N 3.42Å; I29-G31 PolarHBondContact O-N 2.98Å; I29-N32 WeakPolarHBondContact O-CB 3.47Å; I29-N32 PolarHBondContact O-N 3.38Å; I29-N32 VanDerWaalsContact O-N 3.17Å; I29-N32 PolarHBondContact O-ND2 3.02Å; I29-W42 HydrophobicContact CD1-CB 4.41Å; I29-W42 HydrophobicContact CG1-CB 3.9Å; I29-W42 HydrophobicContact CG1-CD2 4.29Å; I29-W42 HydrophobicContact CG1-CG 3.92Å; I29-V46 HydrophobicContact CD1-CG2 4.45Å; I29-I69 HydrophobicContact CD1-CD1 3.61Å; I29-I69 HydrophobicContact CD1-CG1 4.18Å; I29-I69 HydrophobicContact CG1-CD1 4.39Å; I29-W97 HydrophobicContact CB-CH2 4.44Å; I29-W97 HydrophobicContact CG2-CH2 3.69Å; I29-W97 HydrophobicContact CG2-CZ3 3.84Å; I29-M102 HydrophobicContact CG2-CE 3.2Å; I29-M102 HydrophobicContact CG2-SD 4.21Å; I29-C104 HydrophobicContact CD1-CB 4.04Å
30	G	92.4	Very high	97.8	Very high	8 Å²	8	60.8 Å²	60.8	8%	0.082	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	46	-134.6	-177.1	0	0	0	0	0	114	I25 E26 N32 W97	I25-G30 PolarHBondContact O-N 3.33Å; E26-G30 WeakPolarHBondContact O-CA 3.15Å; E26-G30 PolarHBondContact O-N 3.42Å; E26-G30 WeakPolarHBondContact OE1-CA 3.36Å; G30-N32 PolarHBondContact O-N 2.98Å; G30-W97 VanDerWaalsContact O-CH2 3.3Å; G30-W97 WeakPolarHBondContact O-CH2 3.35Å; G30-W97 WeakPolarHBondContact O-CZ2 3.32Å
31	G	94	Very high	97.8	Very high	80 Å²	80	64.3 Å²	64.3	83%	0.825	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.5	4	-179.1	0	0	0	0	0	116.3	I29	I29-G31 PolarHBondContact O-N 2.98Å
32	N	97.8	Very high	97.7	Very high	81 Å²	81	64.9 Å²	64.9	43%	0.433	36%	0.361	S	S	.	.	P	Polyproline II helix	trans	-65.7	140.4	-175.9	-73.1	-77.1	0	0	0	112.1	I29 G30 W42 N99 M102	I29-N32 WeakPolarHBondContact O-CB 3.47Å; I29-N32 PolarHBondContact O-N 3.38Å; I29-N32 VanDerWaalsContact O-N 3.17Å; I29-N32 PolarHBondContact O-ND2 3.02Å; G30-N32 PolarHBondContact O-N 2.98Å; N32-W42 HydrophobicContact CB-CH2 4.26Å; N32-W42 HydrophobicContact CB-CZ2 3.74Å; N32-N99 PolarHBondContact O-ND2 2.83Å; N32-M102 WeakPolarHBondContact O-CE 3.37Å
33	A	98.1	Very high	97.8	Very high	55 Å²	55	61.6 Å²	61.6	46%	0.455	35%	0.35	S	S	.	.	P	Polyproline II helix	trans	-74.4	150	167.1	0	0	0	0	0	110.3	Q35 W42 T101	A33-Q35 PolarHBondContact O-N 3.47Å; A33-W42 WeakPolarHBondContact O-CH2 3.43Å; A33-T101 WeakPolarHBondContact CA-OG1 3.27Å; A33-T101 HydrophobicContact CB-CG2 4.15Å
34	Y	98.4	Very high	97.8	Very high	46 Å²	46	58.5 Å²	58.5	18%	0.18	34%	0.339	C	S	.	.	P	Polyproline II helix	trans	-53.5	126.6	178.1	179	-92.4	0	0	0	111.7	H36 V39 I69 Q71 T101 M102	Y34-H36 HydrophobicContact CE1-CB 4.05Å; Y34-H36 PolarHBondContact OH-ND1 2.89Å; Y34-V39 HydrophobicContact CD2-CG2 4.29Å; Y34-V39 HydrophobicContact CE2-CG2 3.5Å; Y34-V39 VanDerWaalsContact CE2-CG2 3.5Å; Y34-I69 HydrophobicContact CD2-CG2 4.35Å; Y34-I69 HydrophobicContact CE2-CG2 4.33Å; Y34-Q71 HydrophobicContact CD1-CB 3.79Å; Y34-Q71 HydrophobicContact CD1-CG 3.56Å; Y34-Q71 HydrophobicContact CD2-CB 4.01Å; Y34-Q71 HydrophobicContact CD2-CG 4.44Å; Y34-Q71 HydrophobicContact CE1-CB 3.67Å; Y34-Q71 HydrophobicContact CE1-CG 3.84Å; Y34-Q71 HydrophobicContact CE2-CB 3.9Å; Y34-Q71 HydrophobicContact CG-CB 3.95Å; Y34-Q71 HydrophobicContact CG-CG 3.88Å; Y34-T101 PolarHBondContact N-OG1 3.24Å; Y34-M102 HydrophobicContact CD2-CB 3.93Å; Y34-M102 HydrophobicContact CD2-SD 4.06Å; Y34-M102 HydrophobicContact CG-CB 4.45Å
35	Q	98.1	Very high	97.8	Very high	91 Å²	91	60.6 Å²	60.6	43%	0.425	35%	0.35	S	S	.	.			trans	-134.9	115.9	170.8	-66.6	178.5	24.3	0	0	108.1	A33 S37 K38 V39 W42	A33-Q35 PolarHBondContact O-N 3.47Å; Q35-S37 PolarHBondContact O-N 3.46Å; Q35-K38 HydrophobicContact CB-CB 4.12Å; Q35-K38 HydrophobicContact CB-CG 3.95Å; Q35-K38 WeakPolarHBondContact O-CB 3.45Å; Q35-K38 PolarHBondContact O-N 3.34Å; Q35-V39 PolarHBondContact O-N 2.85Å; Q35-W42 HydrophobicContact CB-CH2 4.22Å
36	H	98	Very high	97.8	Very high	145 Å²	145	60.6 Å²	60.6	67%	0.671	35%	0.35	S	S	*	.	H	α-helix	trans	-56.4	-38.2	-175.5	-175.6	59.3	0	0	0	112.8	Y34 K38 V39	Y34-H36 HydrophobicContact CE1-CB 4.05Å; Y34-H36 PolarHBondContact OH-ND1 2.89Å; H36-K38 PolarHBondContact O-N 3.5Å; H36-V39 WeakPolarHBondContact O-CB 3.21Å; H36-V39 PolarHBondContact O-N 2.91Å
37	S	98.3	Very high	97.8	Very high	102 Å²	102	57.4 Å²	57.4	71%	0.713	34%	0.337	S	S	*	.	H	α-helix	trans	-63.8	-18.4	176.5	54.9	0	0	0	0	114.5	Q35	Q35-S37 PolarHBondContact O-N 3.46Å
38	K	98.3	Very high	97.9	Very high	80 Å²	80	59.3 Å²	59.3	35%	0.348	34%	0.338	S	S	.	.	H	α-helix	trans	-97	-14.4	178.6	-67.3	-68.7	-176.6	177.8	0	113.6	Q35 H36 N40 Q41 W42	Q35-K38 HydrophobicContact CB-CB 4.12Å; Q35-K38 HydrophobicContact CB-CG 3.95Å; Q35-K38 WeakPolarHBondContact O-CB 3.45Å; Q35-K38 PolarHBondContact O-N 3.34Å; H36-K38 PolarHBondContact O-N 3.5Å; K38-N40 PolarHBondContact O-N 2.81Å; K38-Q41 WeakPolarHBondContact O-CB 3.36Å; K38-Q41 PolarHBondContact O-N 3.37Å; K38-Q41 VanDerWaalsContact O-N 3.09Å; K38-W42 HydrophobicContact CB-CD2 3.88Å; K38-W42 HydrophobicContact CB-CE3 4.01Å; K38-W42 HydrophobicContact CB-CH2 3.67Å; K38-W42 HydrophobicContact CB-CZ2 3.54Å; K38-W42 HydrophobicContact CB-CZ3 3.91Å; K38-W42 HydrophobicContact CG-CH2 4.42Å; K38-W42 HydrophobicContact CG-CZ2 4.12Å; K38-W42 PolarHBondContact O-N 3.47Å
39	V	98.5	Very high	97.9	Very high	16 Å²	16	61.7 Å²	61.7	10%	0.097	35%	0.347	C	S	.	.	H	α-helix	trans	-55.4	-48.7	-174.8	171.3	0	0	0	0	111.8	Y34 Q35 H36 Q41 W42 T43 I69	Y34-V39 HydrophobicContact CD2-CG2 4.29Å; Y34-V39 HydrophobicContact CE2-CG2 3.5Å; Y34-V39 VanDerWaalsContact CE2-CG2 3.5Å; Q35-V39 PolarHBondContact O-N 2.85Å; H36-V39 WeakPolarHBondContact O-CB 3.21Å; H36-V39 PolarHBondContact O-N 2.91Å; V39-Q41 VanDerWaalsContact C-N 3.31Å; V39-Q41 PolarHBondContact O-N 2.86Å; V39-W42 HydrophobicContact CG2-CE3 4.44Å; V39-W42 PolarHBondContact O-N 2.96Å; V39-W42 VanDerWaalsContact O-N 3.16Å; V39-T43 HydrophobicContact CG1-CG2 4.25Å; V39-T43 WeakPolarHBondContact O-CG2 3.25Å; V39-T43 PolarHBondContact O-N 2.93Å; V39-T43 PolarHBondContact O-OG1 3.33Å; V39-T43 VanDerWaalsContact O-OG1 3.12Å; V39-I69 HydrophobicContact CG1-CB 4.12Å; V39-I69 HydrophobicContact CG2-CG2 4.34Å
40	N	98.4	Very high	98	Very high	126 Å²	126	61.7 Å²	61.7	67%	0.674	35%	0.347	S	S	*	.	H	α-helix	trans	-60	-41.4	179.5	-69.4	-17.7	0	0	0	112.3	K38 T43 T44	K38-N40 PolarHBondContact O-N 2.81Å; N40-T43 WeakPolarHBondContact CA-OG1 3.15Å; N40-T43 PolarHBondContact O-OG1 3.05Å; N40-T44 WeakPolarHBondContact O-CB 3.46Å; N40-T44 PolarHBondContact O-N 2.99Å; N40-T44 PolarHBondContact O-OG1 3.44Å
41	Q	98.5	Very high	98.3	Very high	94 Å²	94	64 Å²	64	44%	0.439	36%	0.357	S	S	.	.	H	α-helix	trans	-63.4	-45.7	176.8	-176.9	-176.6	3	0	0	110.7	K38 V39 N45	K38-Q41 WeakPolarHBondContact O-CB 3.36Å; K38-Q41 PolarHBondContact O-N 3.37Å; K38-Q41 VanDerWaalsContact O-N 3.09Å; V39-Q41 VanDerWaalsContact C-N 3.31Å; V39-Q41 PolarHBondContact O-N 2.86Å; Q41-N45 WeakPolarHBondContact O-CB 3.49Å; Q41-N45 PolarHBondContact O-N 3.16Å; Q41-N45 PolarHBondContact O-OD1 3.34Å
42	W	98.7	Very high	98.5	Very high	12 Å²	12	62.6 Å²	62.6	5%	0.045	34%	0.335	C	S	.	.	H	α-helix	trans	-64.4	-46.3	178.9	-67.1	-32.8	0	0	0	112.4	A28 I29 N32 A33 Q35 K38 V39 T44 N45 V46 I69 M102	A28-W42 PolarHBondContact O-NE1 2.85Å; I29-W42 HydrophobicContact CD1-CB 4.41Å; I29-W42 HydrophobicContact CG1-CB 3.9Å; I29-W42 HydrophobicContact CG1-CD2 4.29Å; I29-W42 HydrophobicContact CG1-CG 3.92Å; N32-W42 HydrophobicContact CB-CH2 4.26Å; N32-W42 HydrophobicContact CB-CZ2 3.74Å; A33-W42 WeakPolarHBondContact O-CH2 3.43Å; Q35-W42 HydrophobicContact CB-CH2 4.22Å; K38-W42 HydrophobicContact CB-CD2 3.88Å; K38-W42 HydrophobicContact CB-CE3 4.01Å; K38-W42 HydrophobicContact CB-CH2 3.67Å; K38-W42 HydrophobicContact CB-CZ2 3.54Å; K38-W42 HydrophobicContact CB-CZ3 3.91Å; K38-W42 HydrophobicContact CG-CH2 4.42Å; K38-W42 HydrophobicContact CG-CZ2 4.12Å; K38-W42 PolarHBondContact O-N 3.47Å; V39-W42 HydrophobicContact CG2-CE3 4.44Å; V39-W42 PolarHBondContact O-N 2.96Å; V39-W42 VanDerWaalsContact O-N 3.16Å; W42-T44 VanDerWaalsContact C-N 3.34Å; W42-T44 PolarHBondContact O-N 2.84Å; W42-N45 PolarHBondContact O-N 2.83Å; W42-V46 WeakPolarHBondContact O-CB 3.28Å; W42-V46 VanDerWaalsContact O-CG2 3.26Å; W42-V46 WeakPolarHBondContact O-CG2 3.17Å; W42-V46 PolarHBondContact O-N 3Å; W42-I69 HydrophobicContact CB-CD1 3.52Å; W42-I69 HydrophobicContact CE3-CD1 4.29Å; W42-I69 HydrophobicContact CG-CD1 4.5Å; W42-M102 HydrophobicContact CE3-SD 4.37Å; W42-M102 HydrophobicContact CH2-CE 4.21Å; W42-M102 HydrophobicContact CZ3-CE 4.03Å; W42-M102 HydrophobicContact CZ3-SD 3.96Å
43	T	98.6	Very high	98.5	Very high	29 Å²	29	62.6 Å²	62.6	18%	0.178	33%	0.332	C	S	.	.	H	α-helix	trans	-61.3	-43.7	178.4	50.5	0	0	0	0	111.5	V39 N40 V46 V47 I69	V39-T43 HydrophobicContact CG1-CG2 4.25Å; V39-T43 WeakPolarHBondContact O-CG2 3.25Å; V39-T43 PolarHBondContact O-N 2.93Å; V39-T43 PolarHBondContact O-OG1 3.33Å; V39-T43 VanDerWaalsContact O-OG1 3.12Å; N40-T43 WeakPolarHBondContact CA-OG1 3.15Å; N40-T43 PolarHBondContact O-OG1 3.05Å; T43-V46 PolarHBondContact O-N 3.2Å; T43-V47 WeakPolarHBondContact O-CB 3.49Å; T43-V47 VanDerWaalsContact O-CG2 3.28Å; T43-V47 WeakPolarHBondContact O-CG2 3.39Å; T43-V47 PolarHBondContact O-N 3.34Å; T43-I69 HydrophobicContact CG2-CB 4.49Å; T43-I69 HydrophobicContact CG2-CD1 3.74Å; T43-I69 HydrophobicContact CG2-CG1 3.92Å
44	T	98.7	Very high	98.5	Very high	64 Å²	64	60 Å²	60	39%	0.393	31%	0.311	S	S	.	.	H	α-helix	trans	-60.6	-51	176.2	-64.1	0	0	0	0	110.9	N40 W42 V46 V47 E48	N40-T44 WeakPolarHBondContact O-CB 3.46Å; N40-T44 PolarHBondContact O-N 2.99Å; N40-T44 PolarHBondContact O-OG1 3.44Å; W42-T44 VanDerWaalsContact C-N 3.34Å; W42-T44 PolarHBondContact O-N 2.84Å; T44-V46 VanDerWaalsContact C-N 3.35Å; T44-V46 PolarHBondContact O-N 3.09Å; T44-V47 PolarHBondContact O-N 3.46Å; T44-E48 HydrophobicContact CG2-CG 4.19Å; T44-E48 WeakPolarHBondContact CG2-OE1 3.26Å; T44-E48 WeakPolarHBondContact O-CB 3.26Å; T44-E48 WeakPolarHBondContact O-CG 3.47Å; T44-E48 PolarHBondContact O-N 2.82Å
45	N	98.7	Very high	98.5	Very high	48 Å²	48	62 Å²	62	26%	0.257	33%	0.328	S	S	.	.	H	α-helix	trans	-59.9	-43.1	-179.4	-72.5	-0.5	0	0	0	112.3	A28 Q41 W42 Q49	A28-N45 HydrophobicContact CB-CB 3.77Å; Q41-N45 WeakPolarHBondContact O-CB 3.49Å; Q41-N45 PolarHBondContact O-N 3.16Å; Q41-N45 PolarHBondContact O-OD1 3.34Å; W42-N45 PolarHBondContact O-N 2.83Å; N45-Q49 VanDerWaalsContact O-CB 3.23Å; N45-Q49 WeakPolarHBondContact O-CB 3.35Å; N45-Q49 WeakPolarHBondContact O-CG 3.42Å; N45-Q49 PolarHBondContact O-N 3.32Å
46	V	98.8	Very high	98.4	Very high	0 Å²	0	64 Å²	64	0%	0	34%	0.335	C	S	.	.	H	α-helix	trans	-61.9	-47.4	177.8	170	0	0	0	0	111	I25 A28 I29 W42 T43 T44 T50 C67 V106	I25-V46 HydrophobicContact CG1-CG1 4.08Å; I25-V46 HydrophobicContact CG1-CG2 4.39Å; A28-V46 HydrophobicContact CB-CG2 3.55Å; I29-V46 HydrophobicContact CD1-CG2 4.45Å; W42-V46 WeakPolarHBondContact O-CB 3.28Å; W42-V46 VanDerWaalsContact O-CG2 3.26Å; W42-V46 WeakPolarHBondContact O-CG2 3.17Å; W42-V46 PolarHBondContact O-N 3Å; T43-V46 PolarHBondContact O-N 3.2Å; T44-V46 VanDerWaalsContact C-N 3.35Å; T44-V46 PolarHBondContact O-N 3.09Å; V46-T50 VanDerWaalsContact O-CB 3.26Å; V46-T50 WeakPolarHBondContact O-CB 3.18Å; V46-T50 PolarHBondContact O-N 3.13Å; V46-T50 PolarHBondContact O-OG1 3.39Å; V46-C67 HydrophobicContact CG1-CB 4.39Å; V46-V106 HydrophobicContact CG1-CG1 4.32Å; V46-V106 HydrophobicContact CG1-CG2 3.61Å
47	V	98.8	Very high	98.3	Very high	37 Å²	37	59.5 Å²	59.5	22%	0.224	32%	0.316	C	S	.	.	H	α-helix	trans	-64.9	-48.3	-178.8	170.2	0	0	0	0	110.9	T43 T44 T50 L51 V65 C67	T43-V47 WeakPolarHBondContact O-CB 3.49Å; T43-V47 VanDerWaalsContact O-CG2 3.28Å; T43-V47 WeakPolarHBondContact O-CG2 3.39Å; T43-V47 PolarHBondContact O-N 3.34Å; T44-V47 PolarHBondContact O-N 3.46Å; V47-T50 PolarHBondContact O-N 2.93Å; V47-L51 HydrophobicContact CG1-CD1 3.79Å; V47-L51 HydrophobicContact CG1-CG 4.47Å; V47-L51 WeakPolarHBondContact O-CB 3.29Å; V47-L51 WeakPolarHBondContact O-CG 3.28Å; V47-L51 PolarHBondContact O-N 3.4Å; V47-V65 HydrophobicContact CG1-CB 4.4Å; V47-V65 HydrophobicContact CG2-CG1 4.22Å; V47-C67 HydrophobicContact CG2-CB 3.7Å
48	E	98.6	Very high	98.2	Very high	120 Å²	120	57.8 Å²	57.8	56%	0.561	32%	0.315	S	S	*	.	H	α-helix	trans	-63.9	-43.8	-179.6	-72.4	-179.3	175.7	0	0	112.2	T44 S52	T44-E48 HydrophobicContact CG2-CG 4.19Å; T44-E48 WeakPolarHBondContact CG2-OE1 3.26Å; T44-E48 WeakPolarHBondContact O-CB 3.26Å; T44-E48 WeakPolarHBondContact O-CG 3.47Å; T44-E48 PolarHBondContact O-N 2.82Å; E48-S52 VanDerWaalsContact O-CB 3.23Å; E48-S52 WeakPolarHBondContact O-CB 3.48Å; E48-S52 PolarHBondContact O-N 2.95Å
49	Q	98.7	Very high	98.1	Very high	61 Å²	61	55.4 Å²	55.4	29%	0.285	30%	0.304	S	S	.	.	H	α-helix	trans	-65.3	-43.5	177.5	-71.9	179.4	25	0	0	111.3	A24 S27 N45 S52 Q53	A24-Q49 HydrophobicContact CB-CB 3.87Å; S27-Q49 VanDerWaalsContact CB-OE1 3.25Å; S27-Q49 PolarHBondContact OG-NE2 3.37Å; S27-Q49 PolarHBondContact OG-OE1 3.04Å; N45-Q49 VanDerWaalsContact O-CB 3.23Å; N45-Q49 WeakPolarHBondContact O-CB 3.35Å; N45-Q49 WeakPolarHBondContact O-CG 3.42Å; N45-Q49 PolarHBondContact O-N 3.32Å; Q49-S52 PolarHBondContact O-N 3.24Å; Q49-Q53 WeakPolarHBondContact O-CG 3.4Å; Q49-Q53 PolarHBondContact O-N 2.98Å
50	T	98.8	Very high	97.9	Very high	0 Å²	0	57.3 Å²	57.3	0%	0	32%	0.317	C	S	.	.	H	α-helix	trans	-59.5	-52.2	176.8	-58.5	0	0	0	0	110.7	I20 V21 A24 V46 V47 S52 Q53 L54 V65	I20-T50 HydrophobicContact CG2-CG2 4.28Å; V21-T50 HydrophobicContact CG2-CG2 3.68Å; A24-T50 WeakPolarHBondContact CB-OG1 3.49Å; V46-T50 VanDerWaalsContact O-CB 3.26Å; V46-T50 WeakPolarHBondContact O-CB 3.18Å; V46-T50 PolarHBondContact O-N 3.13Å; V46-T50 PolarHBondContact O-OG1 3.39Å; V47-T50 PolarHBondContact O-N 2.93Å; T50-S52 VanDerWaalsContact C-N 3.32Å; T50-S52 PolarHBondContact O-N 2.69Å; T50-Q53 PolarHBondContact O-N 2.9Å; T50-L54 HydrophobicContact CG2-CD1 3.76Å; T50-L54 HydrophobicContact CG2-CG 4.26Å; T50-L54 WeakPolarHBondContact O-CB 3.35Å; T50-L54 VanDerWaalsContact O-CG 3.27Å; T50-L54 WeakPolarHBondContact O-CG 3.42Å; T50-L54 PolarHBondContact O-N 3.25Å; T50-V65 HydrophobicContact CG2-CG1 4.03Å; T50-V65 HydrophobicContact CG2-CG2 3.79Å
51	L	98.7	Very high	97.9	Very high	57 Å²	57	52 Å²	52	30%	0.298	29%	0.288	S	S	.	.	H	α-helix	trans	-61.5	-39.8	178.8	-73.7	171.4	0	0	0	112.2	V47 Q53 L54 T55 V65	V47-L51 HydrophobicContact CG1-CD1 3.79Å; V47-L51 HydrophobicContact CG1-CG 4.47Å; V47-L51 WeakPolarHBondContact O-CB 3.29Å; V47-L51 WeakPolarHBondContact O-CG 3.28Å; V47-L51 PolarHBondContact O-N 3.4Å; L51-Q53 PolarHBondContact O-N 2.94Å; L51-L54 PolarHBondContact O-N 2.66Å; L51-T55 WeakPolarHBondContact O-CB 3.35Å; L51-T55 VanDerWaalsContact O-CG2 3.31Å; L51-T55 WeakPolarHBondContact O-CG2 3.34Å; L51-T55 PolarHBondContact O-N 3.07Å; L51-T55 PolarHBondContact O-OG1 2.97Å; L51-V65 HydrophobicContact CD2-CB 4.36Å; L51-V65 HydrophobicContact CD2-CG2 3.63Å; L51-V65 HydrophobicContact CG-CB 4.33Å; L51-V65 HydrophobicContact CG-CG2 3.9Å
52	S	98.5	Very high	97.9	Very high	51 Å²	51	54 Å²	54	36%	0.357	30%	0.295	S	S	.	.	H	α-helix	trans	-62.7	-41	177.6	-177.4	0	0	0	0	112	E48 Q49 T50 T55 K56	E48-S52 VanDerWaalsContact O-CB 3.23Å; E48-S52 WeakPolarHBondContact O-CB 3.48Å; E48-S52 PolarHBondContact O-N 2.95Å; Q49-S52 PolarHBondContact O-N 3.24Å; T50-S52 VanDerWaalsContact C-N 3.32Å; T50-S52 PolarHBondContact O-N 2.69Å; S52-T55 PolarHBondContact O-OG1 3.05Å; S52-K56 VanDerWaalsContact O-CG 3.27Å; S52-K56 WeakPolarHBondContact O-CG 3.45Å; S52-K56 PolarHBondContact O-N 2.88Å
53	Q	98.6	Very high	97.9	Very high	81 Å²	81	55.1 Å²	55.1	38%	0.379	30%	0.299	S	S	.	.	H	α-helix	trans	-75	-40.3	177.9	-64	-58.5	-20.7	0	0	112	I20 Q49 T50 L51 T55 K56 L57	I20-Q53 HydrophobicContact CB-CB 4.44Å; I20-Q53 HydrophobicContact CD1-CB 4.17Å; I20-Q53 HydrophobicContact CG1-CB 4.12Å; I20-Q53 HydrophobicContact CG2-CB 3.52Å; I20-Q53 HydrophobicContact CG2-CG 4.29Å; Q49-Q53 WeakPolarHBondContact O-CG 3.4Å; Q49-Q53 PolarHBondContact O-N 2.98Å; T50-Q53 PolarHBondContact O-N 2.9Å; L51-Q53 PolarHBondContact O-N 2.94Å; Q53-T55 VanDerWaalsContact C-N 3.31Å; Q53-T55 PolarHBondContact O-N 2.81Å; Q53-K56 WeakPolarHBondContact O-CB 3.48Å; Q53-K56 PolarHBondContact O-N 2.79Å; Q53-K56 VanDerWaalsContact O-N 3.15Å; Q53-L57 PolarHBondContact O-N 2.89Å
54	L	98.4	Very high	97.8	Very high	0 Å²	0	57.9 Å²	57.9	0%	0	31%	0.312	C	S	.	.	H	α-helix	trans	-60.4	-39.7	176.4	-72.9	175.8	0	0	0	112.7	V17 I20 T50 L51 K56 L57 Y63 V65 A108	V17-L54 HydrophobicContact CB-CD2 4.3Å; V17-L54 HydrophobicContact CG1-CD2 4.05Å; V17-L54 HydrophobicContact CG2-CD2 3.76Å; I20-L54 HydrophobicContact CD1-CD2 4.02Å; I20-L54 HydrophobicContact CG2-CG 4.44Å; T50-L54 HydrophobicContact CG2-CD1 3.76Å; T50-L54 HydrophobicContact CG2-CG 4.26Å; T50-L54 WeakPolarHBondContact O-CB 3.35Å; T50-L54 VanDerWaalsContact O-CG 3.27Å; T50-L54 WeakPolarHBondContact O-CG 3.42Å; T50-L54 PolarHBondContact O-N 3.25Å; L51-L54 PolarHBondContact O-N 2.66Å; L54-K56 VanDerWaalsContact C-N 3.34Å; L54-L57 HydrophobicContact CD2-CD1 4.15Å; L54-L57 WeakPolarHBondContact O-CB 3.49Å; L54-L57 PolarHBondContact O-N 3.08Å; L54-Y63 HydrophobicContact CB-CD1 4.15Å; L54-Y63 HydrophobicContact CB-CD2 3.9Å; L54-Y63 HydrophobicContact CB-CE1 4.07Å; L54-Y63 HydrophobicContact CB-CE2 3.81Å; L54-Y63 HydrophobicContact CB-CG 4.05Å; L54-Y63 HydrophobicContact CD1-CD1 3.84Å; L54-Y63 HydrophobicContact CD1-CE1 4.27Å; L54-Y63 HydrophobicContact CD1-CG 4.08Å; L54-Y63 HydrophobicContact CD2-CE1 4.14Å; L54-Y63 HydrophobicContact CG-CD1 4.41Å; L54-Y63 HydrophobicContact CG-CE1 4.4Å; L54-Y63 WeakPolarHBondContact O-CE2 3.49Å; L54-Y63 PolarHBondContact O-OH 2.88Å; L54-V65 HydrophobicContact CD1-CG2 4.1Å; L54-A108 HydrophobicContact CD1-CB 4.34Å
55	T	97	Very high	97.8	Very high	88 Å²	88	55.7 Å²	55.7	54%	0.54	30%	0.299	S	S	.	.	H	α-helix	trans	-69.5	-30.6	176.8	49.7	0	0	0	0	112.8	L51 S52 Q53 L57 G58 Y63	L51-T55 WeakPolarHBondContact O-CB 3.35Å; L51-T55 VanDerWaalsContact O-CG2 3.31Å; L51-T55 WeakPolarHBondContact O-CG2 3.34Å; L51-T55 PolarHBondContact O-N 3.07Å; L51-T55 PolarHBondContact O-OG1 2.97Å; S52-T55 PolarHBondContact O-OG1 3.05Å; Q53-T55 VanDerWaalsContact C-N 3.31Å; Q53-T55 PolarHBondContact O-N 2.81Å; T55-L57 PolarHBondContact O-N 2.83Å; T55-G58 PolarHBondContact O-N 3.2Å; T55-Y63 HydrophobicContact CG2-CD2 4.34Å
56	K	97.7	Very high	97.8	Very high	132 Å²	132	56.6 Å²	56.6	57%	0.574	31%	0.306	S	S	*	.	H	α-helix	trans	-68.4	-19.6	174.8	-72.9	169.4	-166.9	171.1	0	113.8	S52 Q53 L54 G58	S52-K56 VanDerWaalsContact O-CG 3.27Å; S52-K56 WeakPolarHBondContact O-CG 3.45Å; S52-K56 PolarHBondContact O-N 2.88Å; Q53-K56 WeakPolarHBondContact O-CB 3.48Å; Q53-K56 PolarHBondContact O-N 2.79Å; Q53-K56 VanDerWaalsContact O-N 3.15Å; L54-K56 VanDerWaalsContact C-N 3.34Å; K56-G58 PolarHBondContact O-N 3.48Å
57	L	96	Very high	97.8	Very high	51 Å²	51	57.7 Å²	57.7	27%	0.267	31%	0.313	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.4	-17.7	173.4	-58.1	-178.3	0	0	0	112.3	E16 I20 Q53 L54 T55 K59	E16-L57 HydrophobicContact CG-CD1 4.19Å; E16-L57 HydrophobicContact CG-CD2 4.38Å; E16-L57 VanDerWaalsContact OE1-CD2 3.28Å; E16-L57 WeakPolarHBondContact OE1-CD2 3.17Å; I20-L57 HydrophobicContact CD1-CD1 3.89Å; I20-L57 HydrophobicContact CD1-CD2 4.19Å; I20-L57 HydrophobicContact CD1-CG 4.23Å; Q53-L57 PolarHBondContact O-N 2.89Å; L54-L57 HydrophobicContact CD2-CD1 4.15Å; L54-L57 WeakPolarHBondContact O-CB 3.49Å; L54-L57 PolarHBondContact O-N 3.08Å; T55-L57 PolarHBondContact O-N 2.83Å; L57-K59 HydrophobicContact CB-CD 4.41Å; L57-K59 HydrophobicContact CB-CG 3.96Å; L57-K59 PolarHBondContact O-N 2.94Å; L57-K59 VanDerWaalsContact O-N 3.1Å
58	G	95.2	Very high	97.8	Very high	67 Å²	67	58.7 Å²	58.7	69%	0.691	32%	0.319	S	S	*	.			trans	67.3	10	178.6	0	0	0	0	0	114.3	T55 K56	T55-G58 PolarHBondContact O-N 3.2Å; K56-G58 PolarHBondContact O-N 3.48Å
59	K	95.7	Very high	97.8	Very high	29 Å²	29	53.9 Å²	53.9	13%	0.126	30%	0.297	C	S	.	.			trans	-75.7	146.9	-179.8	-59.4	-167.6	170.4	177	0	111.3	E9 A11 E16 L57 F61	E9-K59 WeakPolarHBondContact O-CE 3.44Å; E9-K59 WeakPolarHBondContact O-CG 3.27Å; A11-K59 WeakPolarHBondContact O-CD 3.45Å; A11-K59 PolarHBondContact O-NZ 3.37Å; E16-K59 IonicContact OE2-NZ 2.82Å; E16-K59 PolarHBondContact OE2-NZ 2.79Å; L57-K59 HydrophobicContact CB-CD 4.41Å; L57-K59 HydrophobicContact CB-CG 3.96Å; L57-K59 PolarHBondContact O-N 2.94Å; L57-K59 VanDerWaalsContact O-N 3.1Å; K59-F61 HydrophobicContact CB-CD2 3.57Å; K59-F61 HydrophobicContact CB-CE2 3.85Å; K59-F61 HydrophobicContact CD-CE2 4.17Å; K59-F61 PolarHBondContact O-N 2.73Å
60	P	95.6	Very high	97.7	Very high	56 Å²	56	52.6 Å²	52.6	36%	0.364	29%	0.292	S	S	.	.	S	Bend	trans	-78.6	58.8	-172.8	34.6	-37.8	0	0	0	112.8	T10 I113	T10-P60 HydrophobicContact CG2-CG 4.27Å; P60-I113 WeakPolarHBondContact O-CG1 3.49Å; P60-I113 PolarHBondContact O-N 3Å
61	F	97.6	Very high	97.7	Very high	16 Å²	16	56.6 Å²	56.6	7%	0.07	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	143.1	-176.9	-68.7	-60.1	0	0	0	113	T10 F12 K59 Y63 T89 L111	T10-F61 VanDerWaalsContact O-CE2 3.24Å; T10-F61 WeakPolarHBondContact O-CE2 3.42Å; T10-F61 WeakPolarHBondContact O-CZ 3.2Å; F12-F61 HydrophobicContact CB-CE1 4.42Å; F12-F61 HydrophobicContact CB-CE2 4.07Å; F12-F61 HydrophobicContact CB-CZ 3.79Å; K59-F61 HydrophobicContact CB-CD2 3.57Å; K59-F61 HydrophobicContact CB-CE2 3.85Å; K59-F61 HydrophobicContact CD-CE2 4.17Å; K59-F61 PolarHBondContact O-N 2.73Å; F61-Y63 HydrophobicContact CB-CD1 4.09Å; F61-Y63 HydrophobicContact CB-CD2 4.41Å; F61-Y63 HydrophobicContact CB-CE1 3.62Å; F61-Y63 HydrophobicContact CB-CE2 3.97Å; F61-Y63 HydrophobicContact CB-CG 4.48Å; F61-Y63 HydrophobicContact CD2-CE1 4.07Å; F61-Y63 HydrophobicContact CG-CE1 4.13Å; F61-T89 VanDerWaalsContact CE1-O 3.27Å; F61-T89 WeakPolarHBondContact CE1-O 3.42Å; F61-L111 CarbonylContact C-O 3.59Å; F61-L111 WeakPolarHBondContact CA-O 3.47Å
62	K	97.9	Very high	97.6	Very high	135 Å²	135	56.9 Å²	56.9	59%	0.587	31%	0.309	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.2	120.7	153.1	-72.6	168.5	-172.9	164.6	0	108.2	L111 I113	K62-L111 PolarHBondContact N-O 2.82Å; K62-L111 PolarHBondContact O-N 3.35Å; K62-I113 HydrophobicContact CG-CD1 4.3Å; K62-I113 HydrophobicContact CG-CG1 3.95Å
63	Y	98.4	Very high	97.5	Very high	35 Å²	35	59.6 Å²	59.6	14%	0.137	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	139.4	179.7	-62.7	-69.7	0	0	0	112.4	L54 T55 F61 F109	L54-Y63 HydrophobicContact CB-CD1 4.15Å; L54-Y63 HydrophobicContact CB-CD2 3.9Å; L54-Y63 HydrophobicContact CB-CE1 4.07Å; L54-Y63 HydrophobicContact CB-CE2 3.81Å; L54-Y63 HydrophobicContact CB-CG 4.05Å; L54-Y63 HydrophobicContact CD1-CD1 3.84Å; L54-Y63 HydrophobicContact CD1-CE1 4.27Å; L54-Y63 HydrophobicContact CD1-CG 4.08Å; L54-Y63 HydrophobicContact CD2-CE1 4.14Å; L54-Y63 HydrophobicContact CG-CD1 4.41Å; L54-Y63 HydrophobicContact CG-CE1 4.4Å; L54-Y63 WeakPolarHBondContact O-CE2 3.49Å; L54-Y63 PolarHBondContact O-OH 2.88Å; T55-Y63 HydrophobicContact CG2-CD2 4.34Å; F61-Y63 HydrophobicContact CB-CD1 4.09Å; F61-Y63 HydrophobicContact CB-CD2 4.41Å; F61-Y63 HydrophobicContact CB-CE1 3.62Å; F61-Y63 HydrophobicContact CB-CE2 3.97Å; F61-Y63 HydrophobicContact CB-CG 4.48Å; F61-Y63 HydrophobicContact CD2-CE1 4.07Å; F61-Y63 HydrophobicContact CG-CE1 4.13Å; Y63-F109 VanDerWaalsContact CA-O 3.3Å; Y63-F109 WeakPolarHBondContact CA-O 3.36Å
64	I	98.4	Very high	97.3	Very high	88 Å²	88	59.8 Å²	59.8	45%	0.451	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	130	169.3	-54.8	169.5	0	0	0	106.9	A108 F109 L111	I64-A108 CarbonylContact O-C 3.59Å; I64-A108 WeakPolarHBondContact O-CA 3.46Å; I64-F109 HydrophobicContact CB-CB 4.19Å; I64-F109 HydrophobicContact CB-CD2 4.2Å; I64-F109 HydrophobicContact CG2-CD2 4.31Å; I64-F109 PolarHBondContact N-O 3.19Å; I64-F109 PolarHBondContact O-N 3.1Å; I64-L111 HydrophobicContact CD1-CD1 3.87Å; I64-L111 HydrophobicContact CG1-CD1 4.36Å
65	V	98.6	Very high	97.1	Very high	18 Å²	18	62.2 Å²	62.2	11%	0.109	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	128.5	177.8	-178.3	0	0	0	0	109.2	V47 T50 L51 L54 V106 S107 A108	V47-V65 HydrophobicContact CG1-CB 4.4Å; V47-V65 HydrophobicContact CG2-CG1 4.22Å; T50-V65 HydrophobicContact CG2-CG1 4.03Å; T50-V65 HydrophobicContact CG2-CG2 3.79Å; L51-V65 HydrophobicContact CD2-CB 4.36Å; L51-V65 HydrophobicContact CD2-CG2 3.63Å; L51-V65 HydrophobicContact CG-CB 4.33Å; L51-V65 HydrophobicContact CG-CG2 3.9Å; L54-V65 HydrophobicContact CD1-CG2 4.1Å; V65-V106 HydrophobicContact CG1-CG1 3.82Å; V65-S107 CarbonylContact C-O 3.56Å; V65-S107 WeakPolarHBondContact CA-O 3.35Å; V65-A108 HydrophobicContact CG2-CB 4.18Å
66	T	98.3	Very high	96.9	Very high	67 Å²	67	61.6 Å²	61.6	41%	0.411	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	144.3	172.2	66.4	0	0	0	0	109.5	V106 S107	T66-V106 CarbonylContact O-C 3.56Å; T66-V106 WeakPolarHBondContact O-CA 3.23Å; T66-V106 WeakPolarHBondContact O-CG1 3.07Å; T66-S107 PolarHBondContact N-O 3.35Å; T66-S107 PolarHBondContact O-N 3.25Å
67	C	98.6	Very high	96.7	Very high	22 Å²	22	58.7 Å²	58.7	15%	0.149	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	128.5	178.9	179.6	0	0	0	0	109.7	V46 V47 I105 V106	V46-C67 HydrophobicContact CG1-CB 4.39Å; V47-C67 HydrophobicContact CG2-CB 3.7Å; C67-I105 CarbonylContact C-O 3.59Å; C67-I105 WeakPolarHBondContact CA-O 3.31Å; C67-V106 HydrophobicContact CB-CG2 4.17Å
68	V	98.2	Very high	96.7	Very high	58 Å²	58	64.3 Å²	64.3	35%	0.352	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.9	123.6	177.8	178.4	0	0	0	0	108.6	L77 C104 I105	V68-L77 HydrophobicContact CG1-CD2 4.12Å; V68-C104 CarbonylContact O-C 3.5Å; V68-C104 WeakPolarHBondContact O-CA 3.27Å; V68-I105 PolarHBondContact N-O 3.11Å; V68-I105 PolarHBondContact O-N 3.12Å
69	I	98	Very high	96.6	Very high	19 Å²	19	64.2 Å²	64.2	10%	0.097	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	127.5	172	-59.8	173.9	0	0	0	108.5	I29 Y34 V39 W42 T43 M102 Y103 C104	I29-I69 HydrophobicContact CD1-CD1 3.61Å; I29-I69 HydrophobicContact CD1-CG1 4.18Å; I29-I69 HydrophobicContact CG1-CD1 4.39Å; Y34-I69 HydrophobicContact CD2-CG2 4.35Å; Y34-I69 HydrophobicContact CE2-CG2 4.33Å; V39-I69 HydrophobicContact CG1-CB 4.12Å; V39-I69 HydrophobicContact CG2-CG2 4.34Å; W42-I69 HydrophobicContact CB-CD1 3.52Å; W42-I69 HydrophobicContact CE3-CD1 4.29Å; W42-I69 HydrophobicContact CG-CD1 4.5Å; T43-I69 HydrophobicContact CG2-CB 4.49Å; T43-I69 HydrophobicContact CG2-CD1 3.74Å; T43-I69 HydrophobicContact CG2-CG1 3.92Å; I69-M102 HydrophobicContact CG2-CB 4.41Å; I69-M102 HydrophobicContact CG2-SD 3.75Å; I69-Y103 CarbonylContact C-O 3.53Å; I69-Y103 WeakPolarHBondContact CA-O 3.35Å; I69-C104 HydrophobicContact CG1-CB 4.38Å
70	M	97.7	Very high	96.6	Very high	34 Å²	34	67.1 Å²	67.1	17%	0.167	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	134	179.8	-171.5	-177.2	74.4	0	0	111.4	L77 M102 Y103	M70-L77 HydrophobicContact CB-CD2 4.15Å; M70-L77 HydrophobicContact CE-CB 3.54Å; M70-L77 HydrophobicContact CE-CD2 4.36Å; M70-L77 HydrophobicContact SD-CB 3.72Å; M70-L77 HydrophobicContact SD-CD1 4.35Å; M70-L77 HydrophobicContact SD-CD2 4.24Å; M70-L77 HydrophobicContact SD-CG 4.34Å; M70-M102 CarbonylContact O-C 3.51Å; M70-M102 WeakPolarHBondContact O-CA 3.35Å; M70-M102 VanDerWaalsContact O-CB 3.23Å; M70-M102 WeakPolarHBondContact O-CB 3.4Å; M70-Y103 HydrophobicContact CE-CD2 3.64Å; M70-Y103 HydrophobicContact CE-CE2 4.01Å; M70-Y103 PolarHBondContact N-O 3.21Å; M70-Y103 PolarHBondContact O-N 2.82Å
71	Q	98.2	Very high	96.5	Very high	84 Å²	84	67.8 Å²	67.8	39%	0.393	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.3	139.7	172.4	-169.1	177	14	0	0	111.7	Y34 N73	Y34-Q71 HydrophobicContact CD1-CB 3.79Å; Y34-Q71 HydrophobicContact CD1-CG 3.56Å; Y34-Q71 HydrophobicContact CD2-CB 4.01Å; Y34-Q71 HydrophobicContact CD2-CG 4.44Å; Y34-Q71 HydrophobicContact CE1-CB 3.67Å; Y34-Q71 HydrophobicContact CE1-CG 3.84Å; Y34-Q71 HydrophobicContact CE2-CB 3.9Å; Y34-Q71 HydrophobicContact CG-CB 3.95Å; Y34-Q71 HydrophobicContact CG-CG 3.88Å; Q71-N73 HydrophobicContact CG-CB 4.48Å; Q71-N73 PolarHBondContact O-N 3.21Å
72	K	97.1	Very high	96.5	Very high	64 Å²	64	73 Å²	73	28%	0.278	45%	0.45	S	S	.	.			trans	-80.4	96.5	167.6	-73.2	-179.1	175.6	-170	0	110.2	E98 N99 T101 M102 Y103	K72-E98 WeakPolarHBondContact CE-OE2 3.28Å; K72-E98 IonicContact NZ-OE2 2.62Å; K72-E98 PolarHBondContact NZ-OE2 3.37Å; K72-N99 WeakPolarHBondContact CD-O 3.43Å; K72-N99 WeakPolarHBondContact CE-O 3.2Å; K72-N99 PolarHBondContact NZ-O 3.35Å; K72-T101 PolarHBondContact N-O 2.81Å; K72-M102 WeakPolarHBondContact CE-O 3.27Å; K72-Y103 HydrophobicContact CD-CE2 4.25Å; K72-Y103 VanDerWaalsContact CE-CZ 3.44Å; K72-Y103 HydrophobicContact CG-CD2 3.78Å; K72-Y103 HydrophobicContact CG-CE2 3.5Å; K72-Y103 HydrophobicContact CG-CG 4.47Å
73	N	96.3	Very high	96.3	Very high	107 Å²	107	69.1 Å²	69.1	57%	0.572	44%	0.439	S	S	*	.	S	Bend	trans	-131.9	19.6	178.1	63.6	4.1	0	0	0	112.6	Q71 A75	Q71-N73 HydrophobicContact CG-CB 4.48Å; Q71-N73 PolarHBondContact O-N 3.21Å; N73-A75 VanDerWaalsContact C-N 3.35Å; N73-A75 WeakPolarHBondContact OD1-CB 3.43Å; N73-A75 PolarHBondContact OD1-N 2.93Å; N73-A75 VanDerWaalsContact OD1-N 3.15Å
74	G	95	Very high	96.2	Very high	85 Å²	85	77.8 Å²	77.8	88%	0.876	48%	0.478	S	S	*	.	S	Bend	trans	90.1	-9.3	-176	0	0	0	0	0	114.5
75	A	94.4	Very high	96.1	Very high	51 Å²	51	77.3 Å²	77.3	42%	0.421	47%	0.47	S	S	.	.			trans	-68.6	145	171.4	0	0	0	0	0	111.9	N73	N73-A75 VanDerWaalsContact C-N 3.35Å; N73-A75 WeakPolarHBondContact OD1-CB 3.43Å; N73-A75 PolarHBondContact OD1-N 2.93Å; N73-A75 VanDerWaalsContact OD1-N 3.15Å
76	G	92.6	Very high	95.9	Very high	75 Å²	75	80 Å²	80	77%	0.773	48%	0.484	S	S	*	.			trans	-86.3	154	170	0	0	0	0	0	112
77	L	93.6	Very high	95.6	Very high	71 Å²	71	82 Å²	82	37%	0.372	50%	0.501	S	S	.	.			trans	-129.8	129.6	172	179.1	59	0	0	0	109.2	V68 M70 T79 I105	V68-L77 HydrophobicContact CG1-CD2 4.12Å; M70-L77 HydrophobicContact CB-CD2 4.15Å; M70-L77 HydrophobicContact CE-CB 3.54Å; M70-L77 HydrophobicContact CE-CD2 4.36Å; M70-L77 HydrophobicContact SD-CB 3.72Å; M70-L77 HydrophobicContact SD-CD1 4.35Å; M70-L77 HydrophobicContact SD-CD2 4.24Å; M70-L77 HydrophobicContact SD-CG 4.34Å; L77-T79 HydrophobicContact CD1-CG2 4.23Å; L77-T79 HydrophobicContact CD2-CG2 4.46Å; L77-T79 HydrophobicContact CG-CG2 4.14Å; L77-I105 HydrophobicContact CD2-CD1 3.48Å; L77-I105 VanDerWaalsContact CD2-CD1 3.48Å; L77-I105 HydrophobicContact CD2-CG1 4.28Å; L77-I105 HydrophobicContact CG-CD1 4.1Å
78	H	94.7	Very high	95.3	Very high	169 Å²	169	85.7 Å²	85.7	78%	0.782	53%	0.527	S	S	*	.			trans	-120.9	122.7	172.4	-172.7	-89.4	0	0	0	109.1
79	T	94.5	Very high	95.1	Very high	65 Å²	65	85.5 Å²	85.5	40%	0.399	53%	0.526	S	S	.	.			trans	-121.8	130.2	175.7	56.3	0	0	0	0	108.6	L77 I105	L77-T79 HydrophobicContact CD1-CG2 4.23Å; L77-T79 HydrophobicContact CD2-CG2 4.46Å; L77-T79 HydrophobicContact CG-CG2 4.14Å; T79-I105 HydrophobicContact CG2-CD1 3.83Å; T79-I105 HydrophobicContact CG2-CG2 4.43Å
80	A	95.2	Very high	95	Very high	91 Å²	91	85.9 Å²	85.9	75%	0.752	53%	0.528	S	S	*	.			trans	-135.4	146.6	173.9	0	0	0	0	0	109.2
81	S	94.1	Very high	95	Very high	70 Å²	70	84.8 Å²	84.8	49%	0.49	53%	0.526	S	S	.	.			trans	-120.5	146.8	170.7	51.5	0	0	0	0	109
82	S	95.9	Very high	95	Very high	125 Å²	125	82.8 Å²	82.8	87%	0.874	52%	0.521	S	S	*	.			trans	-132.6	134.7	171.4	-176.9	0	0	0	0	107.5
83	C	94	Very high	95	Very high	53 Å²	53	80.1 Å²	80.1	36%	0.358	51%	0.51	S	S	.	.			trans	-131.8	140.6	-173.8	-56.9	0	0	0	0	109.7	W85	C83-W85 HydrophobicContact CB-CD2 3.49Å; C83-W85 VanDerWaalsContact CB-CD2 3.49Å; C83-W85 VanDerWaalsContact CB-CE2 3.47Å; C83-W85 HydrophobicContact CB-CE3 3.69Å; C83-W85 HydrophobicContact CB-CG 4.11Å; C83-W85 HydrophobicContact CB-CH2 3.9Å; C83-W85 HydrophobicContact CB-CZ2 3.68Å; C83-W85 HydrophobicContact CB-CZ3 3.9Å; C83-W85 WeakPolarHBondContact SG-CH2 3.26Å
84	F	96.4	Very high	95.1	Very high	217 Å²	217	78.5 Å²	78.5	95%	0.952	50%	0.504	S	S	*	.			trans	-123.8	102.3	170	179.7	-112.7	0	0	0	107.7
85	W	96.2	Very high	95.2	Very high	78 Å²	78	74.8 Å²	74.8	30%	0.295	46%	0.464	S	S	.	.	S	Bend	trans	-162.8	-179	-165.4	65.4	20.4	0	0	0	111.4	C83 S87 D90 F109 L111	C83-W85 HydrophobicContact CB-CD2 3.49Å; C83-W85 VanDerWaalsContact CB-CD2 3.49Å; C83-W85 VanDerWaalsContact CB-CE2 3.47Å; C83-W85 HydrophobicContact CB-CE3 3.69Å; C83-W85 HydrophobicContact CB-CG 4.11Å; C83-W85 HydrophobicContact CB-CH2 3.9Å; C83-W85 HydrophobicContact CB-CZ2 3.68Å; C83-W85 HydrophobicContact CB-CZ3 3.9Å; C83-W85 WeakPolarHBondContact SG-CH2 3.26Å; W85-S87 PolarHBondContact O-N 2.97Å; W85-D90 HydrophobicContact CB-CB 4.13Å; W85-D90 VanDerWaalsContact CB-OD2 3.28Å; W85-D90 WeakPolarHBondContact CB-OD2 3.38Å; W85-D90 HydrophobicContact CD2-CB 3.72Å; W85-D90 HydrophobicContact CE3-CB 4.05Å; W85-D90 HydrophobicContact CG-CB 3.76Å; W85-F109 AromaticContact CH2-CD1 3.69Å; W85-F109 HydrophobicContact CH2-CD1 3.69Å; W85-F109 HydrophobicContact CH2-CE1 4.47Å; W85-F109 HydrophobicContact CZ3-CB 4.24Å; W85-F109 AromaticContact CZ3-CD1 3.77Å; W85-F109 HydrophobicContact CZ3-CD1 3.77Å; W85-F109 HydrophobicContact CZ3-CG 4.49Å; W85-L111 HydrophobicContact CE3-CD2 4.48Å; W85-L111 HydrophobicContact CE3-CG 4.24Å; W85-L111 HydrophobicContact CZ3-CD1 4.46Å; W85-L111 HydrophobicContact CZ3-CG 4.49Å
86	D	95.4	Very high	95.3	Very high	74 Å²	74	80 Å²	80	40%	0.396	47%	0.473	S	S	.	.			trans	-85.1	108.2	177.1	178.3	1.8	0	0	0	111.2	S88 T89 D90	D86-S88 PolarHBondContact O-N 3.36Å; D86-S88 WeakPolarHBondContact OD1-CB 3.23Å; D86-S88 PolarHBondContact OD1-N 3.26Å; D86-S88 PolarHBondContact OD1-OG 3.47Å; D86-S88 PolarHBondContact OD2-OG 3.21Å; D86-S88 VanDerWaalsContact OD2-OG 3.08Å; D86-T89 WeakPolarHBondContact CB-OG1 3.17Å; D86-T89 VanDerWaalsContact CG-OG1 3.26Å; D86-T89 PolarHBondContact O-N 3.38Å; D86-T89 PolarHBondContact OD2-OG1 3.46Å; D86-D90 PolarHBondContact N-OD2 3.23Å; D86-D90 VanDerWaalsContact O-CB 3.28Å; D86-D90 WeakPolarHBondContact O-CB 3.3Å; D86-D90 PolarHBondContact O-N 2.98Å
87	S	92.5	Very high	95.6	Very high	111 Å²	111	78.4 Å²	78.4	78%	0.776	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.2	-8.6	-179.5	58.2	0	0	0	0	115	W85	W85-S87 PolarHBondContact O-N 2.97Å
88	S	91.8	Very high	95.7	Very high	98 Å²	98	79 Å²	79	69%	0.685	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.2	-24.7	176.5	71.7	0	0	0	0	113.3	D86	D86-S88 PolarHBondContact O-N 3.36Å; D86-S88 WeakPolarHBondContact OD1-CB 3.23Å; D86-S88 PolarHBondContact OD1-N 3.26Å; D86-S88 PolarHBondContact OD1-OG 3.47Å; D86-S88 PolarHBondContact OD2-OG 3.21Å; D86-S88 VanDerWaalsContact OD2-OG 3.08Å
89	T	93.4	Very high	95.8	Very high	54 Å²	54	72.5 Å²	72.5	33%	0.331	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-121.9	-32.7	-173.7	54.2	0	0	0	0	112.7	F61 D86	F61-T89 VanDerWaalsContact CE1-O 3.27Å; F61-T89 WeakPolarHBondContact CE1-O 3.42Å; D86-T89 WeakPolarHBondContact CB-OG1 3.17Å; D86-T89 VanDerWaalsContact CG-OG1 3.26Å; D86-T89 PolarHBondContact O-N 3.38Å; D86-T89 PolarHBondContact OD2-OG1 3.46Å
90	D	96.6	Very high	95.8	Very high	28 Å²	28	79 Å²	79	15%	0.15	44%	0.439	C	S	.	.			trans	-92.1	150.4	-177.7	-54	-46.9	0	0	0	112.2	W85 D86 G110 L111 S112	W85-D90 HydrophobicContact CB-CB 4.13Å; W85-D90 VanDerWaalsContact CB-OD2 3.28Å; W85-D90 WeakPolarHBondContact CB-OD2 3.38Å; W85-D90 HydrophobicContact CD2-CB 3.72Å; W85-D90 HydrophobicContact CE3-CB 4.05Å; W85-D90 HydrophobicContact CG-CB 3.76Å; D86-D90 PolarHBondContact N-OD2 3.23Å; D86-D90 VanDerWaalsContact O-CB 3.28Å; D86-D90 WeakPolarHBondContact O-CB 3.3Å; D86-D90 PolarHBondContact O-N 2.98Å; D90-G110 WeakPolarHBondContact CA-O 3.37Å; D90-L111 WeakPolarHBondContact OD1-CA 3.37Å; D90-S112 PolarHBondContact OD1-N 3.32Å
91	G	96.8	Very high	96	Very high	11 Å²	11	76.8 Å²	76.8	11%	0.113	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.4	161.7	-177.5	0	0	0	0	0	114.4	F109 G110	G91-F109 CarbonylContact O-C 3.53Å; G91-F109 WeakPolarHBondContact O-CA 3.42Å; G91-G110 PolarHBondContact N-O 3.39Å; G91-G110 PolarHBondContact O-N 3.21Å
92	S	97.8	Very high	96.1	Very high	42 Å²	42	73.5 Å²	73.5	29%	0.294	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.4	156.2	169.8	53.4	0	0	0	0	112.3	A108	S92-A108 CarbonylContact C-O 3.56Å; S92-A108 WeakPolarHBondContact CA-O 3.35Å; S92-A108 WeakPolarHBondContact CB-O 3.36Å
93	C	97.3	Very high	96.2	Very high	8 Å²	8	70.5 Å²	70.5	5%	0.054	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	123.6	173.1	-178.4	0	0	0	0	108.5	F12 V14 V17 S107 A108	F12-C93 HydrophobicContact CE1-CB 4.22Å; F12-C93 HydrophobicContact CZ-CB 4.22Å; V14-C93 HydrophobicContact CG1-CB 4.22Å; V17-C93 HydrophobicContact CB-CB 4.22Å; V17-C93 HydrophobicContact CG1-CB 3.71Å; C93-S107 CarbonylContact O-C 3.56Å; C93-S107 WeakPolarHBondContact O-CA 3.24Å; C93-A108 PolarHBondContact N-O 3.15Å; C93-A108 PolarHBondContact O-N 3.16Å
94	T	98.1	Very high	96.4	Very high	72 Å²	72	68 Å²	68	44%	0.442	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.9	118.8	171.6	-62.4	0	0	0	0	109.5	I105 V106 S107	T94-I105 HydrophobicContact CG2-CG2 3.87Å; T94-V106 CarbonylContact C-O 3.51Å; T94-V106 WeakPolarHBondContact CA-O 3.27Å; T94-S107 WeakPolarHBondContact CG2-OG 3.42Å; T94-S107 PolarHBondContact OG1-OG 3.5Å
95	V	98.2	Very high	96.5	Very high	7 Å²	7	58.5 Å²	58.5	4%	0.042	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	125.6	173.7	176.9	0	0	0	0	109	V21 K22 I25 I105 V106	V21-V95 HydrophobicContact CB-CB 4.36Å; V21-V95 HydrophobicContact CB-CG2 3.85Å; V21-V95 HydrophobicContact CG1-CB 3.58Å; V21-V95 HydrophobicContact CG1-CG1 4.16Å; V21-V95 HydrophobicContact CG1-CG2 3.62Å; K22-V95 HydrophobicContact CG-CG1 3.83Å; I25-V95 HydrophobicContact CD1-CG1 4.01Å; V95-I105 WeakPolarHBondContact O-CA 3.45Å; V95-V106 PolarHBondContact N-O 3.46Å; V95-V106 PolarHBondContact O-N 3.18Å
96	R	97	Very high	96.6	Very high	161 Å²	161	54.8 Å²	54.8	61%	0.608	29%	0.29	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.3	118.7	167.9	177.5	179.8	161.8	177.8	-5.9	108.6	E98	R96-E98 IonicContact CZ-OE1 3.6Å; R96-E98 IonicContact NE-OE1 3.46Å; R96-E98 PolarHBondContact NE-OE1 3.01Å; R96-E98 IonicContact NH2-OE1 2.91Å; R96-E98 PolarHBondContact NH2-OE1 2.99Å
97	W	97.4	Very high	96.7	Very high	42 Å²	42	51.8 Å²	51.8	16%	0.159	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	149.6	173.1	-178.7	102.9	0	0	0	109.6	I25 E26 I29 G30 N99 M102 C104	I25-W97 HydrophobicContact CD1-CB 3.95Å; I25-W97 HydrophobicContact CG2-CB 3.88Å; I25-W97 HydrophobicContact CG2-CD2 3.55Å; I25-W97 HydrophobicContact CG2-CE3 4.01Å; I25-W97 HydrophobicContact CG2-CG 3.5Å; I25-W97 VanDerWaalsContact CG2-CG 3.5Å; E26-W97 PolarHBondContact OE2-NE1 3.34Å; I29-W97 HydrophobicContact CB-CH2 4.44Å; I29-W97 HydrophobicContact CG2-CH2 3.69Å; I29-W97 HydrophobicContact CG2-CZ3 3.84Å; G30-W97 VanDerWaalsContact O-CH2 3.3Å; G30-W97 WeakPolarHBondContact O-CH2 3.35Å; G30-W97 WeakPolarHBondContact O-CZ2 3.32Å; W97-N99 HydrophobicContact CH2-CB 3.59Å; W97-N99 WeakPolarHBondContact CH2-ND2 3.28Å; W97-N99 HydrophobicContact CZ2-CB 4.23Å; W97-N99 HydrophobicContact CZ3-CB 3.96Å; W97-M102 HydrophobicContact CZ3-CG 4.49Å; W97-C104 HydrophobicContact CB-CB 4.37Å; W97-C104 HydrophobicContact CE3-CB 3.88Å; W97-C104 PolarHBondContact N-O 3.03Å; W97-C104 PolarHBondContact O-N 3.47Å; W97-C104 VanDerWaalsContact O-O 3.07Å
98	E	96.4	Very high	97	Very high	83 Å²	83	46.5 Å²	46.5	39%	0.388	24%	0.239	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-151.8	150.7	176.2	62.7	-176	106.4	0	0	111.9	K72 R96 M102 Y103	K72-E98 WeakPolarHBondContact CE-OE2 3.28Å; K72-E98 IonicContact NZ-OE2 2.62Å; K72-E98 PolarHBondContact NZ-OE2 3.37Å; R96-E98 IonicContact CZ-OE1 3.6Å; R96-E98 IonicContact NE-OE1 3.46Å; R96-E98 PolarHBondContact NE-OE1 3.01Å; R96-E98 IonicContact NH2-OE1 2.91Å; R96-E98 PolarHBondContact NH2-OE1 2.99Å; E98-M102 WeakPolarHBondContact CA-O 3.28Å; E98-Y103 HydrophobicContact CB-CD1 3.77Å; E98-Y103 HydrophobicContact CB-CE1 4.24Å; E98-Y103 VanDerWaalsContact OE2-CE1 3.27Å; E98-Y103 WeakPolarHBondContact OE2-CE1 3.43Å
99	N	96.1	Very high	97.4	Very high	33 Å²	33	43 Å²	43	18%	0.176	21%	0.211	C	C	.	.			trans	-124.3	-166.4	166.3	74.7	19.1	0	0	0	110.3	N32 K72 W97 T101 M102	N32-N99 PolarHBondContact O-ND2 2.83Å; K72-N99 WeakPolarHBondContact CD-O 3.43Å; K72-N99 WeakPolarHBondContact CE-O 3.2Å; K72-N99 PolarHBondContact NZ-O 3.35Å; W97-N99 HydrophobicContact CH2-CB 3.59Å; W97-N99 WeakPolarHBondContact CH2-ND2 3.28Å; W97-N99 HydrophobicContact CZ2-CB 4.23Å; W97-N99 HydrophobicContact CZ3-CB 3.96Å; N99-T101 PolarHBondContact O-N 2.88Å; N99-T101 VanDerWaalsContact O-N 3.12Å; N99-T101 PolarHBondContact OD1-N 2.99Å; N99-T101 PolarHBondContact OD1-OG1 3.46Å; N99-M102 PolarHBondContact N-O 3.37Å; N99-M102 VanDerWaalsContact N-O 3.08Å; N99-M102 WeakPolarHBondContact ND2-CE 3.38Å; N99-M102 WeakPolarHBondContact OD1-CG 3.36Å; N99-M102 PolarHBondContact OD1-N 3.41Å; N99-M102 VanDerWaalsContact OD1-N 3.13Å
100	K	96.3	Very high	97.6	Very high	202 Å²	202	40.4 Å²	40.4	88%	0.878	20%	0.195	S	C	*	.	S	Bend	trans	-60.7	-22.2	-178.3	-66.7	-178	179.8	177.3	0	114.4
101	T	97.6	Very high	97.6	Very high	44 Å²	44	41.6 Å²	41.6	27%	0.27	20%	0.201	S	C	.	.	S	Bend	trans	-124.6	-12.6	-166.1	62.8	0	0	0	0	115.2	A33 Y34 K72 N99	A33-T101 WeakPolarHBondContact CA-OG1 3.27Å; A33-T101 HydrophobicContact CB-CG2 4.15Å; Y34-T101 PolarHBondContact N-OG1 3.24Å; K72-T101 PolarHBondContact N-O 2.81Å; N99-T101 PolarHBondContact O-N 2.88Å; N99-T101 VanDerWaalsContact O-N 3.12Å; N99-T101 PolarHBondContact OD1-N 2.99Å; N99-T101 PolarHBondContact OD1-OG1 3.46Å
102	M	97.7	Very high	97.6	Very high	0 Å²	0	43.3 Å²	43.3	0%	0	21%	0.212	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-154.2	161	-179.2	54.7	-176.6	156.6	0	0	113.4	I29 N32 Y34 W42 I69 M70 K72 W97 E98 N99	I29-M102 HydrophobicContact CG2-CE 3.2Å; I29-M102 HydrophobicContact CG2-SD 4.21Å; N32-M102 WeakPolarHBondContact O-CE 3.37Å; Y34-M102 HydrophobicContact CD2-CB 3.93Å; Y34-M102 HydrophobicContact CD2-SD 4.06Å; Y34-M102 HydrophobicContact CG-CB 4.45Å; W42-M102 HydrophobicContact CE3-SD 4.37Å; W42-M102 HydrophobicContact CH2-CE 4.21Å; W42-M102 HydrophobicContact CZ3-CE 4.03Å; W42-M102 HydrophobicContact CZ3-SD 3.96Å; I69-M102 HydrophobicContact CG2-CB 4.41Å; I69-M102 HydrophobicContact CG2-SD 3.75Å; M70-M102 CarbonylContact O-C 3.51Å; M70-M102 WeakPolarHBondContact O-CA 3.35Å; M70-M102 VanDerWaalsContact O-CB 3.23Å; M70-M102 WeakPolarHBondContact O-CB 3.4Å; K72-M102 WeakPolarHBondContact CE-O 3.27Å; W97-M102 HydrophobicContact CZ3-CG 4.49Å; E98-M102 WeakPolarHBondContact CA-O 3.28Å; N99-M102 PolarHBondContact N-O 3.37Å; N99-M102 VanDerWaalsContact N-O 3.08Å; N99-M102 WeakPolarHBondContact ND2-CE 3.38Å; N99-M102 WeakPolarHBondContact OD1-CG 3.36Å; N99-M102 PolarHBondContact OD1-N 3.41Å; N99-M102 VanDerWaalsContact OD1-N 3.13Å
103	Y	97.1	Very high	97.3	Very high	62 Å²	62	48.5 Å²	48.5	24%	0.243	24%	0.235	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-102.7	144.5	163.7	-59.4	-76.3	0	0	0	109.4	I69 M70 K72 E98	I69-Y103 CarbonylContact C-O 3.53Å; I69-Y103 WeakPolarHBondContact CA-O 3.35Å; M70-Y103 HydrophobicContact CE-CD2 3.64Å; M70-Y103 HydrophobicContact CE-CE2 4.01Å; M70-Y103 PolarHBondContact N-O 3.21Å; M70-Y103 PolarHBondContact O-N 2.82Å; K72-Y103 HydrophobicContact CD-CE2 4.25Å; K72-Y103 VanDerWaalsContact CE-CZ 3.44Å; K72-Y103 HydrophobicContact CG-CD2 3.78Å; K72-Y103 HydrophobicContact CG-CE2 3.5Å; K72-Y103 HydrophobicContact CG-CG 4.47Å; E98-Y103 HydrophobicContact CB-CD1 3.77Å; E98-Y103 HydrophobicContact CB-CE1 4.24Å; E98-Y103 VanDerWaalsContact OE2-CE1 3.27Å; E98-Y103 WeakPolarHBondContact OE2-CE1 3.43Å
104	C	98.1	Very high	97.3	Very high	0 Å²	0	50.6 Å²	50.6	0%	0	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	120.8	168.4	-175.3	0	0	0	0	108.1	I25 I29 V68 I69 W97	I25-C104 HydrophobicContact CG2-CB 4.5Å; I29-C104 HydrophobicContact CD1-CB 4.04Å; V68-C104 CarbonylContact O-C 3.5Å; V68-C104 WeakPolarHBondContact O-CA 3.27Å; I69-C104 HydrophobicContact CG1-CB 4.38Å; W97-C104 HydrophobicContact CB-CB 4.37Å; W97-C104 HydrophobicContact CE3-CB 3.88Å; W97-C104 PolarHBondContact N-O 3.03Å; W97-C104 PolarHBondContact O-N 3.47Å; W97-C104 VanDerWaalsContact O-O 3.07Å
105	I	98.2	Very high	97.3	Very high	18 Å²	18	49.4 Å²	49.4	9%	0.092	23%	0.233	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	119.3	177.6	-55.7	-179.8	0	0	0	107.6	C67 V68 L77 T79 T94 V95	C67-I105 CarbonylContact C-O 3.59Å; C67-I105 WeakPolarHBondContact CA-O 3.31Å; V68-I105 PolarHBondContact N-O 3.11Å; V68-I105 PolarHBondContact O-N 3.12Å; L77-I105 HydrophobicContact CD2-CD1 3.48Å; L77-I105 VanDerWaalsContact CD2-CD1 3.48Å; L77-I105 HydrophobicContact CD2-CG1 4.28Å; L77-I105 HydrophobicContact CG-CD1 4.1Å; T79-I105 HydrophobicContact CG2-CD1 3.83Å; T79-I105 HydrophobicContact CG2-CG2 4.43Å; T94-I105 HydrophobicContact CG2-CG2 3.87Å; V95-I105 WeakPolarHBondContact O-CA 3.45Å
106	V	98.6	Very high	97.2	Very high	0 Å²	0	51.8 Å²	51.8	0%	0	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	127.8	178.6	-177.5	0	0	0	0	108.4	V21 I25 V46 V65 T66 C67 T94 V95	V21-V106 HydrophobicContact CG1-CB 3.56Å; V21-V106 HydrophobicContact CG1-CG1 3.59Å; V21-V106 HydrophobicContact CG1-CG2 4.2Å; V21-V106 HydrophobicContact CG2-CG1 4.32Å; I25-V106 HydrophobicContact CD1-CB 4.33Å; I25-V106 HydrophobicContact CD1-CG2 3.69Å; I25-V106 HydrophobicContact CG1-CG2 3.89Å; V46-V106 HydrophobicContact CG1-CG1 4.32Å; V46-V106 HydrophobicContact CG1-CG2 3.61Å; V65-V106 HydrophobicContact CG1-CG1 3.82Å; T66-V106 CarbonylContact O-C 3.56Å; T66-V106 WeakPolarHBondContact O-CA 3.23Å; T66-V106 WeakPolarHBondContact O-CG1 3.07Å; C67-V106 HydrophobicContact CB-CG2 4.17Å; T94-V106 CarbonylContact C-O 3.51Å; T94-V106 WeakPolarHBondContact CA-O 3.27Å; V95-V106 PolarHBondContact N-O 3.46Å; V95-V106 PolarHBondContact O-N 3.18Å
107	S	98.5	Very high	97.2	Very high	12 Å²	12	45.4 Å²	45.4	8%	0.084	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118	123.3	173.2	-55.6	0	0	0	0	109.9	V65 T66 C93 T94	V65-S107 CarbonylContact C-O 3.56Å; V65-S107 WeakPolarHBondContact CA-O 3.35Å; T66-S107 PolarHBondContact N-O 3.35Å; T66-S107 PolarHBondContact O-N 3.25Å; C93-S107 CarbonylContact O-C 3.56Å; C93-S107 WeakPolarHBondContact O-CA 3.24Å; T94-S107 WeakPolarHBondContact CG2-OG 3.42Å; T94-S107 PolarHBondContact OG1-OG 3.5Å
108	A	98.7	Very high	97.2	Very high	0 Å²	0	45.6 Å²	45.6	0%	0	23%	0.226	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	139.5	173	0	0	0	0	0	109.5	V17 V21 L54 I64 V65 S92 C93	V17-A108 HydrophobicContact CG1-CB 3.78Å; V21-A108 HydrophobicContact CG2-CB 4.39Å; L54-A108 HydrophobicContact CD1-CB 4.34Å; I64-A108 CarbonylContact O-C 3.59Å; I64-A108 WeakPolarHBondContact O-CA 3.46Å; V65-A108 HydrophobicContact CG2-CB 4.18Å; S92-A108 CarbonylContact C-O 3.56Å; S92-A108 WeakPolarHBondContact CA-O 3.35Å; S92-A108 WeakPolarHBondContact CB-O 3.36Å; C93-A108 PolarHBondContact N-O 3.15Å; C93-A108 PolarHBondContact O-N 3.16Å
109	F	98.5	Very high	97.3	Very high	23 Å²	23	43.1 Å²	43.1	10%	0.101	22%	0.215	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-126	133.5	176.3	-52.4	-100.9	0	0	0	107.7	Y63 I64 W85 G91 L111	Y63-F109 VanDerWaalsContact CA-O 3.3Å; Y63-F109 WeakPolarHBondContact CA-O 3.36Å; I64-F109 HydrophobicContact CB-CB 4.19Å; I64-F109 HydrophobicContact CB-CD2 4.2Å; I64-F109 HydrophobicContact CG2-CD2 4.31Å; I64-F109 PolarHBondContact N-O 3.19Å; I64-F109 PolarHBondContact O-N 3.1Å; W85-F109 AromaticContact CH2-CD1 3.69Å; W85-F109 HydrophobicContact CH2-CD1 3.69Å; W85-F109 HydrophobicContact CH2-CE1 4.47Å; W85-F109 HydrophobicContact CZ3-CB 4.24Å; W85-F109 AromaticContact CZ3-CD1 3.77Å; W85-F109 HydrophobicContact CZ3-CD1 3.77Å; W85-F109 HydrophobicContact CZ3-CG 4.49Å; G91-F109 CarbonylContact O-C 3.53Å; G91-F109 WeakPolarHBondContact O-CA 3.42Å; F109-L111 HydrophobicContact CB-CD1 4.09Å
110	G	98.2	Very high	97.4	Very high	0 Å²	0	43.8 Å²	43.8	0%	0	22%	0.218	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	119.8	170.3	0	0	0	0	0	109	D90 G91	D90-G110 WeakPolarHBondContact CA-O 3.37Å; G91-G110 PolarHBondContact N-O 3.39Å; G91-G110 PolarHBondContact O-N 3.21Å
111	L	97.8	Very high	97.5	Very high	53 Å²	53	31.6 Å²	31.6	28%	0.277	17%	0.168	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	123.4	176.8	-66.8	85	0	0	0	109.1	F61 K62 I64 W85 D90 F109	F61-L111 CarbonylContact C-O 3.59Å; F61-L111 WeakPolarHBondContact CA-O 3.47Å; K62-L111 PolarHBondContact N-O 2.82Å; K62-L111 PolarHBondContact O-N 3.35Å; I64-L111 HydrophobicContact CD1-CD1 3.87Å; I64-L111 HydrophobicContact CG1-CD1 4.36Å; W85-L111 HydrophobicContact CE3-CD2 4.48Å; W85-L111 HydrophobicContact CE3-CG 4.24Å; W85-L111 HydrophobicContact CZ3-CD1 4.46Å; W85-L111 HydrophobicContact CZ3-CG 4.49Å; D90-L111 WeakPolarHBondContact OD1-CA 3.37Å; F109-L111 HydrophobicContact CB-CD1 4.09Å
112	S	95.6	Very high	97.5	Very high	48 Å²	48	30.6 Å²	30.6	34%	0.336	16%	0.159	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-59.3	142.3	-178.4	-171.6	0	0	0	0	110.4	D90	D90-S112 PolarHBondContact OD1-N 3.32Å
113	I	92.5	Very high	97.4	Very high	151 Å²	151	33.4 Å²	33.4	77%	0.774	17%	0.173	S	C	*	.			trans	-84.1	0	178.8	-66.5	172.7	0	0	0	111.1	P60 K62	P60-I113 WeakPolarHBondContact O-CG1 3.49Å; P60-I113 PolarHBondContact O-N 3Å; K62-I113 HydrophobicContact CG-CD1 4.3Å; K62-I113 HydrophobicContact CG-CG1 3.95Å

Retrieved 113 of 113 residues in 125.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).