A0A096NS54_PAPAN Loading...

Basic leucine zipper transcriptional factor ATF-like

AlphaFold DB (Q16520), UniProt , Accession A0A096NS54, Species PAPAN (Papio anubis, Olive baboon), Gene BATF, Length 125 aa.

						>A0A096NS54_PAPAN|A0A096NS54|BATF
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.7	Very low	60.3	Low	216 Å²	216	128.3 Å²	128.3	100%	1.064	77%	0.773	S	S	*	*				0	104.7	0	-70.6	-61.2	159	0	0	107.8
2	P	61.9	Low	59.8	Low	131 Å²	131	132.4 Å²	132.4	85%	0.851	77%	0.773	S	S	*	*			trans	-83.4	120.4	176.9	31.9	-27	0	0	0	109.5
3	H	57.3	Low	59.7	Low	170 Å²	170	130.8 Å²	130.8	79%	0.787	77%	0.773	S	S	*	*			trans	-113.5	101.1	160.6	35	-99.1	0	0	0	107.3
4	S	55.1	Low	59.7	Low	114 Å²	114	137.6 Å²	137.6	80%	0.797	78%	0.779	S	S	*	*			trans	-78.8	111.6	169.4	38.6	0	0	0	0	109.2
5	S	70	Confident	59.5	Low	115 Å²	115	135.4 Å²	135.4	80%	0.804	78%	0.776	S	S	*	*			trans	-131	84.1	160.4	-69.3	0	0	0	0	107.6	S7	S5-S7 VanDerWaalsContact C-N 3.34Å; S5-S7 PolarHBondContact O-N 3.09Å
6	D	64.1	Low	59.5	Low	148 Å²	148	131.6 Å²	131.6	79%	0.791	76%	0.757	S	S	*	*			trans	-78.8	86.5	169.1	-163.1	-16.4	0	0	0	107.5	S8	D6-S8 VanDerWaalsContact C-N 3.32Å; D6-S8 PolarHBondContact O-N 3.31Å; D6-S8 VanDerWaalsContact O-N 3.09Å
7	S	66.2	Low	59.3	Low	113 Å²	113	129.3 Å²	129.3	79%	0.79	75%	0.748	S	S	*	*			trans	-76.3	91.3	169.1	-87.6	0	0	0	0	108.4	S5 D9	S5-S7 VanDerWaalsContact C-N 3.34Å; S5-S7 PolarHBondContact O-N 3.09Å; S7-D9 PolarHBondContact O-N 3.27Å
8	S	63.8	Low	59.2	Low	102 Å²	102	128.6 Å²	128.6	71%	0.713	75%	0.749	S	S	*	*			trans	-66	82.4	162	-68	0	0	0	0	109.7	D6 S10	D6-S8 VanDerWaalsContact C-N 3.32Å; D6-S8 PolarHBondContact O-N 3.31Å; D6-S8 VanDerWaalsContact O-N 3.09Å; S8-S10 VanDerWaalsContact C-N 3.34Å; S8-S10 PolarHBondContact O-N 3.21Å
9	D	59.7	Low	59	Low	129 Å²	129	125.1 Å²	125.1	69%	0.69	74%	0.743	S	S	*	*			trans	-80.4	90.2	161.2	-176	36.8	0	0	0	108.7	S7 S11	S7-D9 PolarHBondContact O-N 3.27Å; D9-S11 PolarHBondContact O-N 3.19Å; D9-S11 PolarHBondContact OD2-OG 3.13Å
10	S	56.8	Low	59	Low	79 Å²	79	128.4 Å²	128.4	55%	0.552	75%	0.748	S	S	*	*			trans	-68.3	73.9	162.4	58.8	0	0	0	0	108.9	S8 F12	S8-S10 VanDerWaalsContact C-N 3.34Å; S8-S10 PolarHBondContact O-N 3.21Å; S10-F12 WeakPolarHBondContact O-CD2 3.44Å; S10-F12 PolarHBondContact O-N 2.87Å
11	S	61	Low	59.1	Low	94 Å²	94	125.8 Å²	125.8	66%	0.657	73%	0.729	S	S	*	*			trans	-71.5	87.9	163.4	-88.1	0	0	0	0	107.5	D9 S13	D9-S11 PolarHBondContact O-N 3.19Å; D9-S11 PolarHBondContact OD2-OG 3.13Å; S11-S13 PolarHBondContact O-N 3.15Å; S11-S13 VanDerWaalsContact O-N 3.17Å
12	F	54.5	Low	59.9	Low	178 Å²	178	119.9 Å²	119.9	78%	0.781	70%	0.701	S	S	*	*			trans	-39.6	121.2	172.8	-73.7	-88.9	0	0	0	109.4	S10 R14	S10-F12 WeakPolarHBondContact O-CD2 3.44Å; S10-F12 PolarHBondContact O-N 2.87Å; F12-R14 PolarHBondContact O-N 3.09Å
13	S	58.7	Low	60.6	Low	111 Å²	111	117.7 Å²	117.7	78%	0.776	69%	0.689	S	S	*	*			trans	-38.8	103.6	169.2	-59.1	0	0	0	0	109	S11 S15	S11-S13 PolarHBondContact O-N 3.15Å; S11-S13 VanDerWaalsContact O-N 3.17Å; S13-S15 PolarHBondContact O-N 3.2Å
14	R	58.5	Low	62	Low	227 Å²	227	112.1 Å²	112.1	86%	0.857	67%	0.669	S	S	*	*			trans	-70.1	84.3	172.2	-161.2	172.3	-166.8	-98.1	2.9	105.3	F12 P16	F12-R14 PolarHBondContact O-N 3.09Å; R14-P16 WeakPolarHBondContact O-CD 3.49Å
15	S	56.7	Low	63.6	Low	104 Å²	104	109.2 Å²	109.2	73%	0.727	65%	0.645	S	S	*	*			trans	-51	109.8	171.2	-65.8	0	0	0	0	106.4	S13	S13-S15 PolarHBondContact O-N 3.2Å
16	P	60	Low	64.7	Low	74 Å²	74	107.3 Å²	107.3	48%	0.481	63%	0.626	S	S	.	*			trans	-73.2	148.3	-171.1	34.2	-36.2	0	0	0	108.4	R14	R14-P16 WeakPolarHBondContact O-CD 3.49Å
17	P	55.5	Low	66.1	Low	93 Å²	93	104.3 Å²	104.3	60%	0.604	61%	0.612	S	S	*	*			trans	-64.2	129	-164.5	21.7	-31.9	0	0	0	112.5	G19 Q21	P17-G19 PolarHBondContact O-N 3.2Å; P17-Q21 PolarHBondContact O-OE1 3.23Å
18	P	58.9	Low	67.5	Low	116 Å²	116	105.3 Å²	105.3	75%	0.753	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.2	32.8	-165.4	33.2	-38.6	0	0	0	115.4
19	G	55.5	Low	69	Low	63 Å²	63	105.8 Å²	105.8	65%	0.649	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-126.9	-25.2	-170.6	0	0	0	0	0	117	P17	P17-G19 PolarHBondContact O-N 3.2Å
20	K	57.4	Low	70.7	Confident	190 Å²	190	104.2 Å²	104.2	83%	0.826	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-119.4	-12.7	-177.6	-66.2	-174.9	-179.7	-177.4	0	113.6
21	Q	61.2	Low	72.6	Confident	75 Å²	75	105.4 Å²	105.4	35%	0.35	58%	0.576	S	S	.	*	H	α-helix	trans	-79.3	-32	177.5	-72.1	176.9	-83.1	0	0	112.3	P17 S23 S24 D25	P17-Q21 PolarHBondContact O-OE1 3.23Å; Q21-S23 VanDerWaalsContact C-N 3.31Å; Q21-S23 PolarHBondContact O-N 3.36Å; Q21-S24 PolarHBondContact O-N 3.25Å; Q21-D25 WeakPolarHBondContact O-CB 3.31Å; Q21-D25 PolarHBondContact O-N 3.31Å
22	D	66.3	Low	74.3	Confident	92 Å²	92	108.7 Å²	108.7	49%	0.492	57%	0.574	S	S	.	*	H	α-helix	trans	-53.6	-43.9	-175.9	-67	-17.1	0	0	0	113	S24 D25 D26	D22-S24 PolarHBondContact O-N 2.86Å; D22-D25 PolarHBondContact O-N 2.95Å; D22-D26 WeakPolarHBondContact O-CB 3.37Å; D22-D26 VanDerWaalsContact O-CG 3.28Å; D22-D26 PolarHBondContact O-N 3.04Å
23	S	76.7	Confident	76.4	Confident	85 Å²	85	107.8 Å²	107.8	59%	0.594	57%	0.566	S	S	*	*	H	α-helix	trans	-66.5	-40.9	179.4	69	0	0	0	0	112.9	Q21 V27	Q21-S23 VanDerWaalsContact C-N 3.31Å; Q21-S23 PolarHBondContact O-N 3.36Å; S23-V27 WeakPolarHBondContact O-CG2 3.45Å; S23-V27 PolarHBondContact O-N 3.39Å; S23-V27 VanDerWaalsContact O-N 3.16Å
24	S	85.2	Confident	78.2	Confident	52 Å²	52	106.5 Å²	106.5	36%	0.364	55%	0.548	S	S	.	.	H	α-helix	trans	-67.9	-39.9	176.3	-170.4	0	0	0	0	111.2	Q21 D22 V27 R28	Q21-S24 PolarHBondContact O-N 3.25Å; D22-S24 PolarHBondContact O-N 2.86Å; S24-V27 PolarHBondContact O-N 2.9Å; S24-R28 VanDerWaalsContact O-CG 3.31Å; S24-R28 WeakPolarHBondContact O-CG 3.45Å; S24-R28 PolarHBondContact O-N 3.1Å
25	D	90.1	Very high	80.1	Confident	54 Å²	54	102.7 Å²	102.7	29%	0.289	54%	0.537	S	S	.	.	H	α-helix	trans	-70.8	-32.5	179.8	-70.4	-27.3	0	0	0	112.1	Q21 D22 R28 R29	Q21-D25 WeakPolarHBondContact O-CB 3.31Å; Q21-D25 PolarHBondContact O-N 3.31Å; D22-D25 PolarHBondContact O-N 2.95Å; D25-R28 PolarHBondContact O-N 3.15Å; D25-R28 IonicContact OD1-CZ 3.98Å; D25-R28 IonicContact OD1-NH1 3.75Å; D25-R28 PolarHBondContact OD1-NH1 3.18Å; D25-R29 VanDerWaalsContact O-CB 3.24Å; D25-R29 WeakPolarHBondContact O-CB 3.43Å; D25-R29 PolarHBondContact O-N 3.48Å
26	D	92.5	Very high	82.1	Confident	75 Å²	75	103.1 Å²	103.1	40%	0.401	53%	0.531	S	S	.	.	H	α-helix	trans	-65.7	-45.7	171	-79.5	-28	0	0	0	112.1	D22 R28 R29 V30	D22-D26 WeakPolarHBondContact O-CB 3.37Å; D22-D26 VanDerWaalsContact O-CG 3.28Å; D22-D26 PolarHBondContact O-N 3.04Å; D26-R28 VanDerWaalsContact C-N 3.33Å; D26-R28 PolarHBondContact O-N 3.07Å; D26-R29 WeakPolarHBondContact O-CB 3.47Å; D26-R29 PolarHBondContact O-N 2.92Å; D26-R29 VanDerWaalsContact O-N 3.14Å; D26-R29 IonicContact OD1-CZ 3.08Å; D26-R29 IonicContact OD1-NH1 3.23Å; D26-R29 PolarHBondContact OD1-NH1 3.24Å; D26-V30 WeakPolarHBondContact O-CG2 3.41Å; D26-V30 PolarHBondContact O-N 2.95Å
27	V	94.1	Very high	83.9	Confident	84 Å²	84	106.6 Å²	106.6	51%	0.509	54%	0.535	S	S	.	.	H	α-helix	trans	-59.1	-46	174.4	173.7	0	0	0	0	110.6	S23 S24 R29 V30 Q31	S23-V27 WeakPolarHBondContact O-CG2 3.45Å; S23-V27 PolarHBondContact O-N 3.39Å; S23-V27 VanDerWaalsContact O-N 3.16Å; S24-V27 PolarHBondContact O-N 2.9Å; V27-R29 VanDerWaalsContact C-N 3.32Å; V27-R29 PolarHBondContact O-N 2.91Å; V27-V30 PolarHBondContact O-N 3.49Å; V27-Q31 WeakPolarHBondContact O-CG 3.36Å; V27-Q31 PolarHBondContact O-N 2.73Å
28	R	94.5	Very high	85.9	Confident	135 Å²	135	106.5 Å²	106.5	51%	0.509	53%	0.528	S	S	.	.	H	α-helix	trans	-61.8	-38.1	175.9	-71.4	170.1	-179.6	157.3	-1.7	112.2	S24 D25 D26 R32	S24-R28 VanDerWaalsContact O-CG 3.31Å; S24-R28 WeakPolarHBondContact O-CG 3.45Å; S24-R28 PolarHBondContact O-N 3.1Å; D25-R28 PolarHBondContact O-N 3.15Å; D25-R28 IonicContact OD1-CZ 3.98Å; D25-R28 IonicContact OD1-NH1 3.75Å; D25-R28 PolarHBondContact OD1-NH1 3.18Å; D26-R28 VanDerWaalsContact C-N 3.33Å; D26-R28 PolarHBondContact O-N 3.07Å; R28-R32 WeakPolarHBondContact O-CB 3.43Å; R28-R32 WeakPolarHBondContact O-CG 3.26Å; R28-R32 PolarHBondContact O-N 2.92Å
29	R	94.8	Very high	87.8	Confident	112 Å²	112	103.5 Å²	103.5	42%	0.423	51%	0.514	S	S	.	.	H	α-helix	trans	-64.8	-45.2	176.9	-176.4	-175.2	-66.2	153.7	-6.6	111	D25 D26 V27 R32 R33	D25-R29 VanDerWaalsContact O-CB 3.24Å; D25-R29 WeakPolarHBondContact O-CB 3.43Å; D25-R29 PolarHBondContact O-N 3.48Å; D26-R29 WeakPolarHBondContact O-CB 3.47Å; D26-R29 PolarHBondContact O-N 2.92Å; D26-R29 VanDerWaalsContact O-N 3.14Å; D26-R29 IonicContact OD1-CZ 3.08Å; D26-R29 IonicContact OD1-NH1 3.23Å; D26-R29 PolarHBondContact OD1-NH1 3.24Å; V27-R29 VanDerWaalsContact C-N 3.32Å; V27-R29 PolarHBondContact O-N 2.91Å; R29-R32 PolarHBondContact O-N 3.5Å; R29-R33 WeakPolarHBondContact O-CG 3.31Å; R29-R33 PolarHBondContact O-N 2.87Å
30	V	95.9	Very high	89.9	Confident	95 Å²	95	102.2 Å²	102.2	58%	0.576	50%	0.497	S	S	*	.	H	α-helix	trans	-61.2	-48.1	175.6	173.6	0	0	0	0	110.6	D26 V27 R32 R33 E34	D26-V30 WeakPolarHBondContact O-CG2 3.41Å; D26-V30 PolarHBondContact O-N 2.95Å; V27-V30 PolarHBondContact O-N 3.49Å; V30-R32 VanDerWaalsContact C-N 3.31Å; V30-R32 PolarHBondContact O-N 3.45Å; V30-R33 PolarHBondContact O-N 3.42Å; V30-E34 PolarHBondContact O-N 2.88Å
31	Q	96.3	Very high	91.8	Very high	104 Å²	104	99.4 Å²	99.4	49%	0.486	49%	0.487	S	S	.	.	H	α-helix	trans	-59.1	-40.7	177.1	-71.8	178.3	8.1	0	0	112.6	V27 E34 K35	V27-Q31 WeakPolarHBondContact O-CG 3.36Å; V27-Q31 PolarHBondContact O-N 2.73Å; Q31-E34 PolarHBondContact O-N 2.87Å; Q31-K35 WeakPolarHBondContact O-CB 3.36Å; Q31-K35 WeakPolarHBondContact O-CG 3.47Å; Q31-K35 PolarHBondContact O-N 3.07Å
32	R	97.3	Very high	93.6	Very high	163 Å²	163	100.8 Å²	100.8	62%	0.615	49%	0.491	S	S	*	.	H	α-helix	trans	-64.4	-43.6	175.6	-77.9	-174.3	-67.1	176.4	-2.3	112.3	R28 R29 V30 E34 K35 N36	R28-R32 WeakPolarHBondContact O-CB 3.43Å; R28-R32 WeakPolarHBondContact O-CG 3.26Å; R28-R32 PolarHBondContact O-N 2.92Å; R29-R32 PolarHBondContact O-N 3.5Å; V30-R32 VanDerWaalsContact C-N 3.31Å; V30-R32 PolarHBondContact O-N 3.45Å; R32-E34 VanDerWaalsContact C-N 3.32Å; R32-E34 PolarHBondContact O-N 2.87Å; R32-K35 PolarHBondContact O-N 3.45Å; R32-N36 WeakPolarHBondContact O-CB 3.38Å; R32-N36 PolarHBondContact O-N 3.33Å
33	R	97.7	Very high	95.2	Very high	159 Å²	159	99.9 Å²	99.9	60%	0.6	49%	0.493	S	S	*	.	H	α-helix	trans	-61.8	-41.7	176.5	-73	174.8	178.7	-179.1	-0.2	111.3	R29 V30 N36 R37	R29-R33 WeakPolarHBondContact O-CG 3.31Å; R29-R33 PolarHBondContact O-N 2.87Å; V30-R33 PolarHBondContact O-N 3.42Å; R33-N36 PolarHBondContact O-N 3.17Å; R33-R37 WeakPolarHBondContact O-CB 3.4Å; R33-R37 PolarHBondContact O-N 2.98Å
34	E	97.7	Very high	96.2	Very high	85 Å²	85	104.5 Å²	104.5	40%	0.397	50%	0.497	S	S	.	.	H	α-helix	trans	-65.8	-45.9	177.3	-172.6	54.7	-151.5	0	0	112	V30 Q31 R32 N36 R37 I38	V30-E34 PolarHBondContact O-N 2.88Å; Q31-E34 PolarHBondContact O-N 2.87Å; R32-E34 VanDerWaalsContact C-N 3.32Å; R32-E34 PolarHBondContact O-N 2.87Å; E34-N36 VanDerWaalsContact C-N 3.32Å; E34-N36 PolarHBondContact O-N 2.94Å; E34-R37 WeakPolarHBondContact O-CB 3.39Å; E34-R37 PolarHBondContact O-N 2.84Å; E34-R37 IonicContact OE2-CZ 3.99Å; E34-R37 IonicContact OE2-NH1 3.42Å; E34-R37 PolarHBondContact OE2-NH1 3.48Å; E34-I38 HydrophobicContact CG-CD1 4.33Å; E34-I38 WeakPolarHBondContact O-CG1 3.31Å; E34-I38 PolarHBondContact O-N 3.45Å
35	K	98.2	Very high	96.9	Very high	147 Å²	147	107 Å²	107	64%	0.639	50%	0.503	S	S	*	.	H	α-helix	trans	-58.7	-42.7	173.6	-73.4	177.6	-178.7	-178.5	0	112.3	Q31 R32 I38 A39	Q31-K35 WeakPolarHBondContact O-CB 3.36Å; Q31-K35 WeakPolarHBondContact O-CG 3.47Å; Q31-K35 PolarHBondContact O-N 3.07Å; R32-K35 PolarHBondContact O-N 3.45Å; K35-I38 PolarHBondContact O-N 3.2Å; K35-A39 VanDerWaalsContact O-CB 3.3Å; K35-A39 WeakPolarHBondContact O-CB 3.46Å; K35-A39 PolarHBondContact O-N 3.09Å
36	N	98	Very high	97.3	Very high	112 Å²	112	111.3 Å²	111.3	60%	0.599	52%	0.515	S	S	*	.	H	α-helix	trans	-67.6	-38.7	177.8	-177.4	-94.7	0	0	0	112	R32 R33 E34 A39 A40	R32-N36 WeakPolarHBondContact O-CB 3.38Å; R32-N36 PolarHBondContact O-N 3.33Å; R33-N36 PolarHBondContact O-N 3.17Å; E34-N36 VanDerWaalsContact C-N 3.32Å; E34-N36 PolarHBondContact O-N 2.94Å; N36-A39 PolarHBondContact O-N 3.29Å; N36-A40 VanDerWaalsContact O-CB 3.3Å; N36-A40 WeakPolarHBondContact O-CB 3.47Å; N36-A40 PolarHBondContact O-N 2.82Å
37	R	98.3	Very high	97.6	Very high	147 Å²	147	114.6 Å²	114.6	56%	0.555	53%	0.528	S	S	*	.	H	α-helix	trans	-57.2	-50.2	173.7	179.1	-178.1	-72.6	110.1	-1.1	110.9	R33 E34 A40 Q41	R33-R37 WeakPolarHBondContact O-CB 3.4Å; R33-R37 PolarHBondContact O-N 2.98Å; E34-R37 WeakPolarHBondContact O-CB 3.39Å; E34-R37 PolarHBondContact O-N 2.84Å; E34-R37 IonicContact OE2-CZ 3.99Å; E34-R37 IonicContact OE2-NH1 3.42Å; E34-R37 PolarHBondContact OE2-NH1 3.48Å; R37-A40 PolarHBondContact O-N 3Å; R37-Q41 WeakPolarHBondContact O-CB 3.5Å; R37-Q41 PolarHBondContact O-N 2.69Å
38	I	98.4	Very high	97.8	Very high	91 Å²	91	114.5 Å²	114.5	47%	0.467	53%	0.527	S	S	.	.	H	α-helix	trans	-62.3	-44.4	176.6	-64.2	167.4	0	0	0	110.7	E34 K35 A40 Q41 K42	E34-I38 HydrophobicContact CG-CD1 4.33Å; E34-I38 WeakPolarHBondContact O-CG1 3.31Å; E34-I38 PolarHBondContact O-N 3.45Å; K35-I38 PolarHBondContact O-N 3.2Å; I38-A40 PolarHBondContact O-N 3.34Å; I38-Q41 PolarHBondContact O-N 2.93Å; I38-K42 WeakPolarHBondContact O-CB 3.15Å; I38-K42 PolarHBondContact O-N 3.33Å
39	A	98.5	Very high	98	Very high	54 Å²	54	112.8 Å²	112.8	45%	0.446	53%	0.525	S	S	.	.	H	α-helix	trans	-63	-42.7	179.7	0	0	0	0	0	112.4	K35 N36 K42 S43	K35-A39 VanDerWaalsContact O-CB 3.3Å; K35-A39 WeakPolarHBondContact O-CB 3.46Å; K35-A39 PolarHBondContact O-N 3.09Å; N36-A39 PolarHBondContact O-N 3.29Å; A39-K42 PolarHBondContact O-N 2.86Å; A39-S43 WeakPolarHBondContact O-CB 3.03Å; A39-S43 PolarHBondContact O-N 2.88Å
40	A	98.5	Very high	98.2	Very high	36 Å²	36	115.2 Å²	115.2	30%	0.298	54%	0.539	S	S	.	.	H	α-helix	trans	-65.3	-43.2	176.7	0	0	0	0	0	111.4	N36 R37 I38 S43 R44	N36-A40 VanDerWaalsContact O-CB 3.3Å; N36-A40 WeakPolarHBondContact O-CB 3.47Å; N36-A40 PolarHBondContact O-N 2.82Å; R37-A40 PolarHBondContact O-N 3Å; I38-A40 PolarHBondContact O-N 3.34Å; A40-S43 PolarHBondContact O-N 2.99Å; A40-R44 VanDerWaalsContact O-CG 3.32Å; A40-R44 WeakPolarHBondContact O-CG 3.26Å; A40-R44 PolarHBondContact O-N 3.08Å
41	Q	98.6	Very high	98.3	Very high	131 Å²	131	113.5 Å²	113.5	61%	0.612	53%	0.534	S	S	*	.	H	α-helix	trans	-59.6	-47.1	173.3	-177.8	-179.7	-5.7	0	0	111.2	R37 I38 S43 R44 Q45	R37-Q41 WeakPolarHBondContact O-CB 3.5Å; R37-Q41 PolarHBondContact O-N 2.69Å; I38-Q41 PolarHBondContact O-N 2.93Å; Q41-S43 VanDerWaalsContact C-N 3.32Å; Q41-S43 PolarHBondContact O-N 3.32Å; Q41-R44 PolarHBondContact O-N 2.88Å; Q41-Q45 WeakPolarHBondContact O-CB 2.96Å; Q41-Q45 PolarHBondContact O-N 2.8Å
42	K	98.7	Very high	98.4	Very high	103 Å²	103	112.7 Å²	112.7	45%	0.448	53%	0.534	S	S	.	.	H	α-helix	trans	-63.2	-37.7	177.2	-168.1	174.1	-172.1	175.9	0	112	I38 A39 Q45 R46	I38-K42 WeakPolarHBondContact O-CB 3.15Å; I38-K42 PolarHBondContact O-N 3.33Å; A39-K42 PolarHBondContact O-N 2.86Å; K42-Q45 PolarHBondContact O-N 3.08Å; K42-R46 VanDerWaalsContact CE-CZ 3.5Å; K42-R46 VanDerWaalsContact CE-NH2 3.26Å; K42-R46 WeakPolarHBondContact O-CG 3.32Å; K42-R46 PolarHBondContact O-N 3.3Å
43	S	98.7	Very high	98.5	Very high	74 Å²	74	109.1 Å²	109.1	52%	0.517	53%	0.53	S	S	.	.	H	α-helix	trans	-63.7	-46.9	175.5	-168.5	0	0	0	0	111.5	A39 A40 Q41 R46 Q47	A39-S43 WeakPolarHBondContact O-CB 3.03Å; A39-S43 PolarHBondContact O-N 2.88Å; A40-S43 PolarHBondContact O-N 2.99Å; Q41-S43 VanDerWaalsContact C-N 3.32Å; Q41-S43 PolarHBondContact O-N 3.32Å; S43-R46 PolarHBondContact O-N 3.45Å; S43-Q47 PolarHBondContact O-N 3.24Å; S43-Q47 VanDerWaalsContact O-N 3.11Å
44	R	98.7	Very high	98.5	Very high	182 Å²	182	106.9 Å²	106.9	69%	0.687	53%	0.529	S	S	*	.	H	α-helix	trans	-59.9	-46.8	174.9	-70.1	171	-177.2	-177.2	-0.4	110.9	A40 Q41 R46 Q47 T48	A40-R44 VanDerWaalsContact O-CG 3.32Å; A40-R44 WeakPolarHBondContact O-CG 3.26Å; A40-R44 PolarHBondContact O-N 3.08Å; Q41-R44 PolarHBondContact O-N 2.88Å; R44-R46 PolarHBondContact O-N 3.01Å; R44-Q47 WeakPolarHBondContact O-CB 3.47Å; R44-Q47 PolarHBondContact O-N 2.86Å; R44-Q47 VanDerWaalsContact O-N 3.12Å; R44-T48 PolarHBondContact O-N 3.15Å; R44-T48 PolarHBondContact O-OG1 2.81Å
45	Q	98.7	Very high	98.6	Very high	104 Å²	104	108.2 Å²	108.2	49%	0.486	54%	0.535	S	S	.	.	H	α-helix	trans	-57.9	-46	177.6	-175.4	-179.2	26.7	0	0	112.1	Q41 K42 Q47 T48 Q49	Q41-Q45 WeakPolarHBondContact O-CB 2.96Å; Q41-Q45 PolarHBondContact O-N 2.8Å; K42-Q45 PolarHBondContact O-N 3.08Å; Q45-Q47 VanDerWaalsContact C-N 3.28Å; Q45-Q47 PolarHBondContact O-N 2.86Å; Q45-T48 PolarHBondContact O-N 2.94Å; Q45-Q49 HydrophobicContact CG-CG 4.46Å; Q45-Q49 WeakPolarHBondContact O-CB 3.37Å; Q45-Q49 WeakPolarHBondContact O-CG 3.45Å; Q45-Q49 PolarHBondContact O-N 3.31Å
46	R	98.7	Very high	98.6	Very high	145 Å²	145	106.5 Å²	106.5	55%	0.547	53%	0.533	S	S	.	.	H	α-helix	trans	-60.7	-38.9	176.7	-74.9	-176.9	-129.9	-107	18.6	112.4	K42 S43 R44 K50	K42-R46 VanDerWaalsContact CE-CZ 3.5Å; K42-R46 VanDerWaalsContact CE-NH2 3.26Å; K42-R46 WeakPolarHBondContact O-CG 3.32Å; K42-R46 PolarHBondContact O-N 3.3Å; S43-R46 PolarHBondContact O-N 3.45Å; R44-R46 PolarHBondContact O-N 3.01Å; R46-K50 WeakPolarHBondContact O-CB 3.38Å; R46-K50 PolarHBondContact O-N 2.76Å
47	Q	98.5	Very high	98.6	Very high	144 Å²	144	106.4 Å²	106.4	67%	0.673	53%	0.528	S	S	*	.	H	α-helix	trans	-67.6	-44.2	178.7	-171.7	173.4	21.3	0	0	111.3	S43 R44 Q45 K50 A51	S43-Q47 PolarHBondContact O-N 3.24Å; S43-Q47 VanDerWaalsContact O-N 3.11Å; R44-Q47 WeakPolarHBondContact O-CB 3.47Å; R44-Q47 PolarHBondContact O-N 2.86Å; R44-Q47 VanDerWaalsContact O-N 3.12Å; Q45-Q47 VanDerWaalsContact C-N 3.28Å; Q45-Q47 PolarHBondContact O-N 2.86Å; Q47-K50 PolarHBondContact O-N 3.49Å; Q47-A51 PolarHBondContact O-N 2.9Å
48	T	98.6	Very high	98.6	Very high	81 Å²	81	102 Å²	102	50%	0.497	52%	0.52	S	S	.	.	H	α-helix	trans	-58.8	-51.1	173.6	-56	0	0	0	0	110.8	R44 Q45 K50 A51 D52	R44-T48 PolarHBondContact O-N 3.15Å; R44-T48 PolarHBondContact O-OG1 2.81Å; Q45-T48 PolarHBondContact O-N 2.94Å; T48-K50 VanDerWaalsContact C-N 3.29Å; T48-K50 PolarHBondContact O-N 2.98Å; T48-A51 WeakPolarHBondContact O-CA 3.47Å; T48-A51 WeakPolarHBondContact O-CB 3.3Å; T48-A51 PolarHBondContact O-N 2.84Å; T48-D52 VanDerWaalsContact O-CG 3.23Å; T48-D52 PolarHBondContact O-N 3.02Å
49	Q	98.8	Very high	98.7	Very high	100 Å²	100	102.2 Å²	102.2	47%	0.467	52%	0.519	S	S	.	.	H	α-helix	trans	-57	-41.2	177.8	-74.9	176.3	-22.4	0	0	112.7	Q45 A51 D52 T53	Q45-Q49 HydrophobicContact CG-CG 4.46Å; Q45-Q49 WeakPolarHBondContact O-CB 3.37Å; Q45-Q49 WeakPolarHBondContact O-CG 3.45Å; Q45-Q49 PolarHBondContact O-N 3.31Å; Q49-A51 VanDerWaalsContact C-N 3.34Å; Q49-A51 PolarHBondContact O-N 3.15Å; Q49-D52 PolarHBondContact O-N 3.39Å; Q49-T53 WeakPolarHBondContact O-CB 3.27Å; Q49-T53 PolarHBondContact O-N 2.96Å; Q49-T53 PolarHBondContact O-OG1 3.23Å
50	K	98.7	Very high	98.7	Very high	163 Å²	163	103.3 Å²	103.3	71%	0.709	52%	0.518	S	S	*	.	H	α-helix	trans	-62.5	-41.4	176.2	-177.3	176.8	179	-179.3	0	111.8	R46 Q47 T48 L54	R46-K50 WeakPolarHBondContact O-CB 3.38Å; R46-K50 PolarHBondContact O-N 2.76Å; Q47-K50 PolarHBondContact O-N 3.49Å; T48-K50 VanDerWaalsContact C-N 3.29Å; T48-K50 PolarHBondContact O-N 2.98Å; K50-L54 WeakPolarHBondContact O-CB 3.42Å; K50-L54 PolarHBondContact O-N 3.41Å
51	A	98.6	Very high	98.7	Very high	58 Å²	58	106.2 Å²	106.2	48%	0.479	53%	0.528	S	S	.	.	H	α-helix	trans	-65.5	-42.9	176.5	0	0	0	0	0	111.3	Q47 T48 Q49 L54 H55	Q47-A51 PolarHBondContact O-N 2.9Å; T48-A51 WeakPolarHBondContact O-CA 3.47Å; T48-A51 WeakPolarHBondContact O-CB 3.3Å; T48-A51 PolarHBondContact O-N 2.84Å; Q49-A51 VanDerWaalsContact C-N 3.34Å; Q49-A51 PolarHBondContact O-N 3.15Å; A51-L54 PolarHBondContact O-N 3.09Å; A51-H55 WeakPolarHBondContact O-CB 3.38Å; A51-H55 PolarHBondContact O-N 3.02Å
52	D	98.8	Very high	98.7	Very high	88 Å²	88	106.1 Å²	106.1	47%	0.471	53%	0.527	S	S	.	.	H	α-helix	trans	-62.7	-45.4	177.5	-59.9	-23.4	0	0	0	111.2	T48 Q49 L54 H55 L56	T48-D52 VanDerWaalsContact O-CG 3.23Å; T48-D52 PolarHBondContact O-N 3.02Å; Q49-D52 PolarHBondContact O-N 3.39Å; D52-L54 PolarHBondContact O-N 3.46Å; D52-H55 PolarHBondContact O-N 3.02Å; D52-L56 WeakPolarHBondContact O-CG 3.47Å; D52-L56 PolarHBondContact O-N 3.5Å
53	T	98.5	Very high	98.7	Very high	87 Å²	87	108.7 Å²	108.7	53%	0.534	54%	0.538	S	S	.	.	H	α-helix	trans	-59.7	-45.8	175.7	-59.9	0	0	0	0	111.6	Q49 H55 L56 E57	Q49-T53 WeakPolarHBondContact O-CB 3.27Å; Q49-T53 PolarHBondContact O-N 2.96Å; Q49-T53 PolarHBondContact O-OG1 3.23Å; T53-H55 VanDerWaalsContact C-N 3.3Å; T53-H55 PolarHBondContact O-N 2.93Å; T53-L56 PolarHBondContact O-N 3.42Å; T53-E57 WeakPolarHBondContact O-CB 3.25Å; T53-E57 PolarHBondContact O-N 3.35Å
54	L	98.8	Very high	98.7	Very high	113 Å²	113	109.6 Å²	109.6	59%	0.592	54%	0.535	S	S	*	.	H	α-helix	trans	-63.3	-38.5	178.8	-178.1	63.2	0	0	0	111.8	K50 A51 D52 S58	K50-L54 WeakPolarHBondContact O-CB 3.42Å; K50-L54 PolarHBondContact O-N 3.41Å; A51-L54 PolarHBondContact O-N 3.09Å; D52-L54 PolarHBondContact O-N 3.46Å; L54-S58 WeakPolarHBondContact O-CB 3.39Å; L54-S58 PolarHBondContact O-N 2.89Å
55	H	98.6	Very high	98.7	Very high	112 Å²	112	104.5 Å²	104.5	52%	0.519	52%	0.521	S	S	.	.	H	α-helix	trans	-63.1	-50	176.2	-171.4	-82.1	0	0	0	111.4	A51 D52 T53 E57 S58 E59	A51-H55 WeakPolarHBondContact O-CB 3.38Å; A51-H55 PolarHBondContact O-N 3.02Å; D52-H55 PolarHBondContact O-N 3.02Å; T53-H55 VanDerWaalsContact C-N 3.3Å; T53-H55 PolarHBondContact O-N 2.93Å; H55-E57 VanDerWaalsContact C-N 3.31Å; H55-E57 PolarHBondContact O-N 3.23Å; H55-S58 WeakPolarHBondContact O-CB 3.33Å; H55-S58 PolarHBondContact O-N 3.38Å; H55-S58 VanDerWaalsContact O-N 3.15Å; H55-E59 IonicContact CE1-OE1 2.71Å; H55-E59 PolarHBondContact CE1-OE1 3.43Å; H55-E59 VanDerWaalsContact CE1-OE1 3.23Å; H55-E59 IonicContact CE1-OE2 2.66Å; H55-E59 PolarHBondContact CE1-OE2 2.85Å; H55-E59 VanDerWaalsContact ND1-CD 3.31Å; H55-E59 IonicContact ND1-OE1 2.92Å; H55-E59 IonicContact ND1-OE2 3.57Å; H55-E59 PolarHBondContact ND1-OE2 3.43Å; H55-E59 VanDerWaalsContact ND1-OE2 3.08Å; H55-E59 WeakPolarHBondContact O-CG 3.47Å; H55-E59 PolarHBondContact O-N 3.19Å
56	L	98.8	Very high	98.7	Very high	112 Å²	112	102.4 Å²	102.4	59%	0.586	52%	0.521	S	S	*	.	H	α-helix	trans	-60.1	-41.1	178.8	-69.2	172.2	0	0	0	112.1	D52 T53 E59 D60	D52-L56 WeakPolarHBondContact O-CG 3.47Å; D52-L56 PolarHBondContact O-N 3.5Å; T53-L56 PolarHBondContact O-N 3.42Å; L56-E59 PolarHBondContact O-N 2.9Å; L56-D60 WeakPolarHBondContact O-CB 3.42Å; L56-D60 PolarHBondContact O-N 3.44Å
57	E	98.8	Very high	98.7	Very high	109 Å²	109	98.3 Å²	98.3	51%	0.509	52%	0.519	S	S	.	.	H	α-helix	trans	-64.7	-41	175.8	-173.7	178	-179	0	0	111.6	T53 H55 D60 L61	T53-E57 WeakPolarHBondContact O-CB 3.25Å; T53-E57 PolarHBondContact O-N 3.35Å; H55-E57 VanDerWaalsContact C-N 3.31Å; H55-E57 PolarHBondContact O-N 3.23Å; E57-D60 PolarHBondContact O-N 3.01Å; E57-L61 HydrophobicContact CG-CD1 4.15Å; E57-L61 WeakPolarHBondContact O-CB 3.4Å; E57-L61 VanDerWaalsContact O-CG 3.28Å; E57-L61 WeakPolarHBondContact O-CG 3.36Å; E57-L61 PolarHBondContact O-N 2.89Å
58	S	98.7	Very high	98.7	Very high	54 Å²	54	96 Å²	96	38%	0.378	51%	0.51	S	S	.	.	H	α-helix	trans	-60.4	-47.6	175.2	-167.1	0	0	0	0	111.7	L54 H55 D60 L61 E62	L54-S58 WeakPolarHBondContact O-CB 3.39Å; L54-S58 PolarHBondContact O-N 2.89Å; H55-S58 WeakPolarHBondContact O-CB 3.33Å; H55-S58 PolarHBondContact O-N 3.38Å; H55-S58 VanDerWaalsContact O-N 3.15Å; S58-D60 VanDerWaalsContact C-N 3.34Å; S58-D60 PolarHBondContact O-N 2.98Å; S58-L61 PolarHBondContact O-N 2.69Å; S58-E62 WeakPolarHBondContact O-CB 3.35Å; S58-E62 WeakPolarHBondContact O-CG 3.48Å; S58-E62 PolarHBondContact O-N 2.97Å
59	E	98.8	Very high	98.7	Very high	97 Å²	97	100.5 Å²	100.5	45%	0.453	52%	0.518	S	S	.	.	H	α-helix	trans	-62.2	-41.4	178.9	-71.1	179.6	126.8	0	0	112	H55 L56 E62 K63	H55-E59 IonicContact CE1-OE1 2.71Å; H55-E59 PolarHBondContact CE1-OE1 3.43Å; H55-E59 VanDerWaalsContact CE1-OE1 3.23Å; H55-E59 IonicContact CE1-OE2 2.66Å; H55-E59 PolarHBondContact CE1-OE2 2.85Å; H55-E59 VanDerWaalsContact ND1-CD 3.31Å; H55-E59 IonicContact ND1-OE1 2.92Å; H55-E59 IonicContact ND1-OE2 3.57Å; H55-E59 PolarHBondContact ND1-OE2 3.43Å; H55-E59 VanDerWaalsContact ND1-OE2 3.08Å; H55-E59 WeakPolarHBondContact O-CG 3.47Å; H55-E59 PolarHBondContact O-N 3.19Å; L56-E59 PolarHBondContact O-N 2.9Å; E59-E62 PolarHBondContact O-N 3.34Å; E59-K63 WeakPolarHBondContact O-CB 3.46Å; E59-K63 PolarHBondContact O-N 2.97Å
60	D	98.8	Very high	98.7	Very high	77 Å²	77	102 Å²	102	41%	0.412	52%	0.523	S	S	.	.	H	α-helix	trans	-65.3	-45.5	177.1	-173.5	61.8	0	0	0	111.6	L56 E57 S58 E62 K63 Q64	L56-D60 WeakPolarHBondContact O-CB 3.42Å; L56-D60 PolarHBondContact O-N 3.44Å; E57-D60 PolarHBondContact O-N 3.01Å; S58-D60 VanDerWaalsContact C-N 3.34Å; S58-D60 PolarHBondContact O-N 2.98Å; D60-E62 VanDerWaalsContact C-N 3.33Å; D60-E62 PolarHBondContact O-N 2.92Å; D60-K63 WeakPolarHBondContact O-CB 3.44Å; D60-K63 PolarHBondContact O-N 3.45Å; D60-Q64 WeakPolarHBondContact O-CG 3.39Å; D60-Q64 PolarHBondContact O-N 3.15Å; D60-Q64 PolarHBondContact OD2-NE2 3.02Å
61	L	98.9	Very high	98.8	Very high	97 Å²	97	99 Å²	99	51%	0.508	51%	0.512	S	S	.	.	H	α-helix	trans	-61.6	-39.9	175.6	-73.4	173.4	0	0	0	112.1	E57 S58 Q64 N65	E57-L61 HydrophobicContact CG-CD1 4.15Å; E57-L61 WeakPolarHBondContact O-CB 3.4Å; E57-L61 VanDerWaalsContact O-CG 3.28Å; E57-L61 WeakPolarHBondContact O-CG 3.36Å; E57-L61 PolarHBondContact O-N 2.89Å; S58-L61 PolarHBondContact O-N 2.69Å; L61-Q64 PolarHBondContact O-N 3.4Å; L61-N65 VanDerWaalsContact O-CB 3.25Å; L61-N65 WeakPolarHBondContact O-CB 3.28Å; L61-N65 PolarHBondContact O-N 3.42Å
62	E	98.7	Very high	98.8	Very high	128 Å²	128	101.4 Å²	101.4	60%	0.598	52%	0.516	S	S	*	.	H	α-helix	trans	-62.4	-44	175.1	-77.3	174.5	-159.5	0	0	111.8	S58 E59 D60 N65 A66	S58-E62 WeakPolarHBondContact O-CB 3.35Å; S58-E62 WeakPolarHBondContact O-CG 3.48Å; S58-E62 PolarHBondContact O-N 2.97Å; E59-E62 PolarHBondContact O-N 3.34Å; D60-E62 VanDerWaalsContact C-N 3.33Å; D60-E62 PolarHBondContact O-N 2.92Å; E62-N65 PolarHBondContact O-N 3.45Å; E62-A66 WeakPolarHBondContact O-CB 3.45Å; E62-A66 PolarHBondContact O-N 2.93Å
63	K	98.8	Very high	98.8	Very high	157 Å²	157	103.4 Å²	103.4	68%	0.683	52%	0.52	S	S	*	.	H	α-helix	trans	-62.5	-46.8	176	-177.1	-175.2	176.8	-173.7	0	111.7	E59 D60 A66 A67	E59-K63 WeakPolarHBondContact O-CB 3.46Å; E59-K63 PolarHBondContact O-N 2.97Å; D60-K63 WeakPolarHBondContact O-CB 3.44Å; D60-K63 PolarHBondContact O-N 3.45Å; K63-A66 PolarHBondContact O-N 3.43Å; K63-A67 PolarHBondContact O-N 2.98Å
64	Q	98.8	Very high	98.8	Very high	94 Å²	94	103.5 Å²	103.5	44%	0.439	51%	0.514	S	S	.	.	H	α-helix	trans	-61.9	-43.7	176.7	-70.2	-174.7	43.4	0	0	111.3	D60 L61 A66 A67 L68	D60-Q64 WeakPolarHBondContact O-CG 3.39Å; D60-Q64 PolarHBondContact O-N 3.15Å; D60-Q64 PolarHBondContact OD2-NE2 3.02Å; L61-Q64 PolarHBondContact O-N 3.4Å; Q64-A66 VanDerWaalsContact C-N 3.33Å; Q64-A66 PolarHBondContact O-N 3.47Å; Q64-A67 PolarHBondContact O-N 3.31Å; Q64-L68 WeakPolarHBondContact O-CG 3.5Å; Q64-L68 PolarHBondContact O-N 2.97Å
65	N	98.8	Very high	98.8	Very high	74 Å²	74	102.5 Å²	102.5	40%	0.396	51%	0.509	S	S	.	.	H	α-helix	trans	-61.2	-43.1	177.8	-159.6	-67.8	0	0	0	111.3	L61 E62 A67 L68 R69	L61-N65 VanDerWaalsContact O-CB 3.25Å; L61-N65 WeakPolarHBondContact O-CB 3.28Å; L61-N65 PolarHBondContact O-N 3.42Å; E62-N65 PolarHBondContact O-N 3.45Å; N65-A67 PolarHBondContact O-N 3.08Å; N65-L68 PolarHBondContact O-N 3.23Å; N65-R69 WeakPolarHBondContact O-CB 3.46Å; N65-R69 VanDerWaalsContact O-CG 3.27Å; N65-R69 WeakPolarHBondContact O-CG 3.49Å; N65-R69 PolarHBondContact O-N 3.28Å; N65-R69 WeakPolarHBondContact OD1-CD 3.43Å; N65-R69 VanDerWaalsContact OD1-CZ 3.22Å; N65-R69 PolarHBondContact OD1-NE 3.49Å; N65-R69 PolarHBondContact OD1-NH2 3.04Å
66	A	98.8	Very high	98.8	Very high	60 Å²	60	100.1 Å²	100.1	50%	0.496	50%	0.502	S	S	.	.	H	α-helix	trans	-62.1	-41.7	175.4	0	0	0	0	0	112.3	E62 K63 Q64 R69 K70	E62-A66 WeakPolarHBondContact O-CB 3.45Å; E62-A66 PolarHBondContact O-N 2.93Å; K63-A66 PolarHBondContact O-N 3.43Å; Q64-A66 VanDerWaalsContact C-N 3.33Å; Q64-A66 PolarHBondContact O-N 3.47Å; A66-R69 PolarHBondContact O-N 3.36Å; A66-K70 PolarHBondContact O-N 2.87Å; A66-K70 VanDerWaalsContact O-N 3.09Å
67	A	98.8	Very high	98.8	Very high	60 Å²	60	99.6 Å²	99.6	50%	0.496	50%	0.497	S	S	.	.	H	α-helix	trans	-63	-47.9	175.8	0	0	0	0	0	111.9	K63 Q64 N65 R69 K70 E71	K63-A67 PolarHBondContact O-N 2.98Å; Q64-A67 PolarHBondContact O-N 3.31Å; N65-A67 PolarHBondContact O-N 3.08Å; A67-R69 PolarHBondContact O-N 3.05Å; A67-K70 WeakPolarHBondContact O-CB 3.48Å; A67-K70 PolarHBondContact O-N 3.26Å; A67-K70 VanDerWaalsContact O-N 3.15Å; A67-E71 PolarHBondContact O-N 3.39Å
68	L	98.9	Very high	98.8	Very high	95 Å²	95	99.1 Å²	99.1	50%	0.497	50%	0.495	S	S	.	.	H	α-helix	trans	-62.7	-41.1	177.7	-70.6	170.6	0	0	0	112	Q64 N65 K70 E71 I72	Q64-L68 WeakPolarHBondContact O-CG 3.5Å; Q64-L68 PolarHBondContact O-N 2.97Å; N65-L68 PolarHBondContact O-N 3.23Å; L68-K70 VanDerWaalsContact C-N 3.28Å; L68-K70 PolarHBondContact O-N 3.01Å; L68-E71 PolarHBondContact O-N 2.89Å; L68-I72 VanDerWaalsContact O-CG1 3.3Å; L68-I72 WeakPolarHBondContact O-CG1 3.48Å; L68-I72 PolarHBondContact O-N 3.34Å
69	R	98.7	Very high	98.8	Very high	175 Å²	175	101.9 Å²	101.9	66%	0.66	51%	0.505	S	S	*	.	H	α-helix	trans	-60.5	-39	174.4	-76.1	177	-175.7	-178.6	3.8	112.1	N65 A66 A67 K73	N65-R69 WeakPolarHBondContact O-CB 3.46Å; N65-R69 VanDerWaalsContact O-CG 3.27Å; N65-R69 WeakPolarHBondContact O-CG 3.49Å; N65-R69 PolarHBondContact O-N 3.28Å; N65-R69 WeakPolarHBondContact OD1-CD 3.43Å; N65-R69 VanDerWaalsContact OD1-CZ 3.22Å; N65-R69 PolarHBondContact OD1-NE 3.49Å; N65-R69 PolarHBondContact OD1-NH2 3.04Å; A66-R69 PolarHBondContact O-N 3.36Å; A67-R69 PolarHBondContact O-N 3.05Å; R69-K73 WeakPolarHBondContact O-CB 3.43Å; R69-K73 PolarHBondContact O-N 3.12Å; R69-K73 VanDerWaalsContact O-N 3.08Å
70	K	98.8	Very high	98.7	Very high	132 Å²	132	103.8 Å²	103.8	57%	0.574	51%	0.512	S	S	*	.	H	α-helix	trans	-65.4	-44.8	175.4	-178.5	-177.4	175.1	-175.3	0	111.1	A66 A67 L68 K73 Q74	A66-K70 PolarHBondContact O-N 2.87Å; A66-K70 VanDerWaalsContact O-N 3.09Å; A67-K70 WeakPolarHBondContact O-CB 3.48Å; A67-K70 PolarHBondContact O-N 3.26Å; A67-K70 VanDerWaalsContact O-N 3.15Å; L68-K70 VanDerWaalsContact C-N 3.28Å; L68-K70 PolarHBondContact O-N 3.01Å; K70-K73 WeakPolarHBondContact O-CB 3.48Å; K70-K73 PolarHBondContact O-N 3.11Å; K70-Q74 WeakPolarHBondContact O-CG 3.45Å; K70-Q74 PolarHBondContact O-N 3.33Å
71	E	98.7	Very high	98.7	Very high	100 Å²	100	107.2 Å²	107.2	47%	0.467	52%	0.52	S	S	.	.	H	α-helix	trans	-62.2	-46.8	177.6	-175.5	174.7	-172.4	0	0	111.7	A67 L68 K73 Q74 L75	A67-E71 PolarHBondContact O-N 3.39Å; L68-E71 PolarHBondContact O-N 2.89Å; E71-K73 VanDerWaalsContact C-N 3.26Å; E71-K73 PolarHBondContact O-N 3.39Å; E71-Q74 PolarHBondContact O-N 2.96Å; E71-Q74 VanDerWaalsContact O-N 3.15Å; E71-L75 HydrophobicContact CG-CD1 3.9Å; E71-L75 HydrophobicContact CG-CG 4.33Å; E71-L75 WeakPolarHBondContact O-CB 3.32Å; E71-L75 WeakPolarHBondContact O-CG 3.4Å; E71-L75 PolarHBondContact O-N 2.88Å
72	I	98.8	Very high	98.7	Very high	109 Å²	109	108.1 Å²	108.1	56%	0.559	52%	0.52	S	S	*	.	H	α-helix	trans	-54.9	-45.4	174.1	-70.6	167	0	0	0	110.6	L68 T76	L68-I72 VanDerWaalsContact O-CG1 3.3Å; L68-I72 WeakPolarHBondContact O-CG1 3.48Å; L68-I72 PolarHBondContact O-N 3.34Å; I72-T76 VanDerWaalsContact O-CB 3.26Å; I72-T76 WeakPolarHBondContact O-CB 3.32Å; I72-T76 PolarHBondContact O-N 3Å; I72-T76 PolarHBondContact O-OG1 3.28Å
73	K	98.8	Very high	98.7	Very high	130 Å²	130	105 Å²	105	57%	0.565	51%	0.509	S	S	*	.	H	α-helix	trans	-61.3	-48.3	178.1	-176.9	-178.2	173	-177.4	0	111.4	R69 K70 E71 T76 E77	R69-K73 WeakPolarHBondContact O-CB 3.43Å; R69-K73 PolarHBondContact O-N 3.12Å; R69-K73 VanDerWaalsContact O-N 3.08Å; K70-K73 WeakPolarHBondContact O-CB 3.48Å; K70-K73 PolarHBondContact O-N 3.11Å; E71-K73 VanDerWaalsContact C-N 3.26Å; E71-K73 PolarHBondContact O-N 3.39Å; K73-T76 PolarHBondContact O-N 3.18Å; K73-E77 WeakPolarHBondContact CE-OE1 3.32Å; K73-E77 IonicContact NZ-OE1 3.75Å; K73-E77 WeakPolarHBondContact O-CG 3.38Å; K73-E77 PolarHBondContact O-N 2.92Å
74	Q	98.8	Very high	98.6	Very high	89 Å²	89	101.2 Å²	101.2	42%	0.416	50%	0.503	S	S	.	.	H	α-helix	trans	-60.5	-50.5	179.4	-73.3	177.2	-30.2	0	0	111.7	K70 E71 T76 E77 E78	K70-Q74 WeakPolarHBondContact O-CG 3.45Å; K70-Q74 PolarHBondContact O-N 3.33Å; E71-Q74 PolarHBondContact O-N 2.96Å; E71-Q74 VanDerWaalsContact O-N 3.15Å; Q74-T76 VanDerWaalsContact C-N 3.28Å; Q74-T76 PolarHBondContact O-N 3.17Å; Q74-E77 WeakPolarHBondContact O-CB 3.33Å; Q74-E77 PolarHBondContact O-N 2.86Å; Q74-E77 VanDerWaalsContact O-N 3.08Å; Q74-E78 WeakPolarHBondContact O-CG 3.48Å; Q74-E78 PolarHBondContact O-N 3.41Å
75	L	98.8	Very high	98.6	Very high	92 Å²	92	99.6 Å²	99.6	48%	0.482	50%	0.499	S	S	.	.	H	α-helix	trans	-62.1	-36.3	178.5	-68.3	174.1	0	0	0	112.1	E71 E78 L79	E71-L75 HydrophobicContact CG-CD1 3.9Å; E71-L75 HydrophobicContact CG-CG 4.33Å; E71-L75 WeakPolarHBondContact O-CB 3.32Å; E71-L75 WeakPolarHBondContact O-CG 3.4Å; E71-L75 PolarHBondContact O-N 2.88Å; L75-E78 PolarHBondContact O-N 3.33Å; L75-L79 VanDerWaalsContact O-CB 3.31Å; L75-L79 WeakPolarHBondContact O-CB 3.4Å; L75-L79 PolarHBondContact O-N 2.95Å
76	T	98.6	Very high	98.4	Very high	61 Å²	61	101.5 Å²	101.5	37%	0.374	51%	0.509	S	S	.	.	H	α-helix	trans	-65.8	-39.1	174.9	-59.5	0	0	0	0	111.7	I72 K73 Q74 K80	I72-T76 VanDerWaalsContact O-CB 3.26Å; I72-T76 WeakPolarHBondContact O-CB 3.32Å; I72-T76 PolarHBondContact O-N 3Å; I72-T76 PolarHBondContact O-OG1 3.28Å; K73-T76 PolarHBondContact O-N 3.18Å; Q74-T76 VanDerWaalsContact C-N 3.28Å; Q74-T76 PolarHBondContact O-N 3.17Å; T76-K80 HydrophobicContact CG2-CD 4.44Å; T76-K80 VanDerWaalsContact O-CG 3.26Å; T76-K80 WeakPolarHBondContact O-CG 3.3Å; T76-K80 PolarHBondContact O-N 3.37Å; T76-K80 VanDerWaalsContact O-N 3.09Å
77	E	98.7	Very high	98.2	Very high	102 Å²	102	103.2 Å²	103.2	48%	0.477	51%	0.51	S	S	.	.	H	α-helix	trans	-67.8	-42.6	175.6	-73.2	170.2	-178.3	0	0	111.4	K73 Q74 K80 Y81	K73-E77 WeakPolarHBondContact CE-OE1 3.32Å; K73-E77 IonicContact NZ-OE1 3.75Å; K73-E77 WeakPolarHBondContact O-CG 3.38Å; K73-E77 PolarHBondContact O-N 2.92Å; Q74-E77 WeakPolarHBondContact O-CB 3.33Å; Q74-E77 PolarHBondContact O-N 2.86Å; Q74-E77 VanDerWaalsContact O-N 3.08Å; E77-K80 PolarHBondContact O-N 3.46Å; E77-Y81 WeakPolarHBondContact O-CB 3.42Å; E77-Y81 PolarHBondContact O-N 3.09Å
78	E	98.6	Very high	98	Very high	99 Å²	99	104.1 Å²	104.1	46%	0.463	51%	0.512	S	S	.	.	H	α-helix	trans	-62.4	-45.5	175	-74	179.9	-156.4	0	0	112.1	Q74 L75 K80 Y81 F82	Q74-E78 WeakPolarHBondContact O-CG 3.48Å; Q74-E78 PolarHBondContact O-N 3.41Å; L75-E78 PolarHBondContact O-N 3.33Å; E78-K80 VanDerWaalsContact C-N 3.35Å; E78-K80 PolarHBondContact O-N 2.95Å; E78-Y81 WeakPolarHBondContact O-CB 3.36Å; E78-Y81 PolarHBondContact O-N 2.94Å; E78-F82 HydrophobicContact CB-CD2 4.41Å; E78-F82 HydrophobicContact CB-CE2 4.23Å; E78-F82 WeakPolarHBondContact O-CD2 3.3Å; E78-F82 PolarHBondContact O-N 3.37Å
79	L	98.6	Very high	97.8	Very high	111 Å²	111	104.1 Å²	104.1	58%	0.581	51%	0.51	S	S	*	.	H	α-helix	trans	-55.5	-52.5	174.3	-172.2	172.5	0	0	0	109.8	L75 Y81 F82 T83	L75-L79 VanDerWaalsContact O-CB 3.31Å; L75-L79 WeakPolarHBondContact O-CB 3.4Å; L75-L79 PolarHBondContact O-N 2.95Å; L79-Y81 VanDerWaalsContact C-N 3.29Å; L79-Y81 PolarHBondContact O-N 3.43Å; L79-F82 PolarHBondContact O-N 3.3Å; L79-T83 WeakPolarHBondContact CD2-OG1 3.43Å; L79-T83 WeakPolarHBondContact O-CB 3.36Å; L79-T83 PolarHBondContact O-N 2.99Å; L79-T83 PolarHBondContact O-OG1 2.8Å; L79-T83 VanDerWaalsContact O-OG1 3.07Å
80	K	98.5	Very high	97.4	Very high	138 Å²	138	101.5 Å²	101.5	60%	0.6	51%	0.505	S	S	*	.	H	α-helix	trans	-57.8	-42.6	178.4	-74.3	172.6	-177.9	178.6	0	112	T76 E77 E78 S84	T76-K80 HydrophobicContact CG2-CD 4.44Å; T76-K80 VanDerWaalsContact O-CG 3.26Å; T76-K80 WeakPolarHBondContact O-CG 3.3Å; T76-K80 PolarHBondContact O-N 3.37Å; T76-K80 VanDerWaalsContact O-N 3.09Å; E77-K80 PolarHBondContact O-N 3.46Å; E78-K80 VanDerWaalsContact C-N 3.35Å; E78-K80 PolarHBondContact O-N 2.95Å; K80-S84 WeakPolarHBondContact O-CB 3.41Å; K80-S84 PolarHBondContact O-N 2.82Å
81	Y	98.5	Very high	96.9	Very high	149 Å²	149	100.3 Å²	100.3	58%	0.584	51%	0.511	S	S	*	.	H	α-helix	trans	-61.3	-52.7	177.7	173.7	-104.2	0	0	0	111.3	E77 E78 L79 T83 S84 V85	E77-Y81 WeakPolarHBondContact O-CB 3.42Å; E77-Y81 PolarHBondContact O-N 3.09Å; E78-Y81 WeakPolarHBondContact O-CB 3.36Å; E78-Y81 PolarHBondContact O-N 2.94Å; L79-Y81 VanDerWaalsContact C-N 3.29Å; L79-Y81 PolarHBondContact O-N 3.43Å; Y81-T83 PolarHBondContact O-N 3.42Å; Y81-S84 WeakPolarHBondContact O-CB 3.32Å; Y81-S84 PolarHBondContact O-N 3.49Å; Y81-S84 VanDerWaalsContact O-N 3.17Å; Y81-V85 HydrophobicContact CD2-CG2 4.44Å; Y81-V85 HydrophobicContact CE1-CG2 4.15Å; Y81-V85 HydrophobicContact CE2-CG2 4.02Å; Y81-V85 WeakPolarHBondContact O-CG2 3.33Å; Y81-V85 PolarHBondContact O-N 2.89Å
82	F	98.5	Very high	96.5	Very high	116 Å²	116	102.2 Å²	102.2	51%	0.509	52%	0.523	S	S	.	.	H	α-helix	trans	-65.4	-40.5	-179.8	-68.8	-52	0	0	0	112.6	E78 L79 S84 V85 L86	E78-F82 HydrophobicContact CB-CD2 4.41Å; E78-F82 HydrophobicContact CB-CE2 4.23Å; E78-F82 WeakPolarHBondContact O-CD2 3.3Å; E78-F82 PolarHBondContact O-N 3.37Å; L79-F82 PolarHBondContact O-N 3.3Å; F82-S84 VanDerWaalsContact C-N 3.3Å; F82-S84 PolarHBondContact O-N 3.36Å; F82-V85 PolarHBondContact O-N 3.46Å; F82-L86 WeakPolarHBondContact O-CB 3.49Å; F82-L86 VanDerWaalsContact O-CG 3.31Å; F82-L86 WeakPolarHBondContact O-CG 3.37Å; F82-L86 PolarHBondContact O-N 3.18Å
83	T	97.9	Very high	95.9	Very high	62 Å²	62	98 Å²	98	38%	0.38	50%	0.503	S	S	.	.	H	α-helix	trans	-58.3	-43.7	172.3	-64.4	0	0	0	0	111.1	L79 Y81 V85 L86 N87	L79-T83 WeakPolarHBondContact CD2-OG1 3.43Å; L79-T83 WeakPolarHBondContact O-CB 3.36Å; L79-T83 PolarHBondContact O-N 2.99Å; L79-T83 PolarHBondContact O-OG1 2.8Å; L79-T83 VanDerWaalsContact O-OG1 3.07Å; Y81-T83 PolarHBondContact O-N 3.42Å; T83-V85 PolarHBondContact O-N 2.87Å; T83-L86 PolarHBondContact O-N 2.88Å; T83-N87 VanDerWaalsContact O-CB 3.31Å; T83-N87 WeakPolarHBondContact O-CB 3.22Å; T83-N87 PolarHBondContact O-N 3.49Å; T83-N87 PolarHBondContact O-ND2 2.86Å; T83-N87 PolarHBondContact O-OD1 3.38Å
84	S	97.9	Very high	95.2	Very high	78 Å²	78	96.3 Å²	96.3	55%	0.545	51%	0.508	S	S	.	.	H	α-helix	trans	-61.9	-44.3	176.3	-173.6	0	0	0	0	112.2	K80 Y81 F82 S88	K80-S84 WeakPolarHBondContact O-CB 3.41Å; K80-S84 PolarHBondContact O-N 2.82Å; Y81-S84 WeakPolarHBondContact O-CB 3.32Å; Y81-S84 PolarHBondContact O-N 3.49Å; Y81-S84 VanDerWaalsContact O-N 3.17Å; F82-S84 VanDerWaalsContact C-N 3.3Å; F82-S84 PolarHBondContact O-N 3.36Å; S84-S88 WeakPolarHBondContact O-CB 3.44Å; S84-S88 PolarHBondContact O-N 3.17Å; S84-S88 PolarHBondContact O-OG 3.25Å
85	V	97.4	Very high	94.5	Very high	60 Å²	60	96.9 Å²	96.9	36%	0.364	52%	0.517	S	S	.	.	H	α-helix	trans	-62.9	-48.3	178.6	171.4	0	0	0	0	110.5	Y81 F82 T83 N87 S88 H89	Y81-V85 HydrophobicContact CD2-CG2 4.44Å; Y81-V85 HydrophobicContact CE1-CG2 4.15Å; Y81-V85 HydrophobicContact CE2-CG2 4.02Å; Y81-V85 WeakPolarHBondContact O-CG2 3.33Å; Y81-V85 PolarHBondContact O-N 2.89Å; F82-V85 PolarHBondContact O-N 3.46Å; T83-V85 PolarHBondContact O-N 2.87Å; V85-N87 PolarHBondContact O-N 3.44Å; V85-S88 PolarHBondContact O-N 2.98Å; V85-S88 PolarHBondContact O-OG 3.21Å; V85-H89 PolarHBondContact O-N 3.37Å
86	L	96.1	Very high	93	Very high	113 Å²	113	96.7 Å²	96.7	59%	0.592	52%	0.516	S	S	*	.	H	α-helix	trans	-61.6	-45.4	178.8	-70.7	177.9	0	0	0	112	F82 T83 S88 H89 E90	F82-L86 WeakPolarHBondContact O-CB 3.49Å; F82-L86 VanDerWaalsContact O-CG 3.31Å; F82-L86 WeakPolarHBondContact O-CG 3.37Å; F82-L86 PolarHBondContact O-N 3.18Å; T83-L86 PolarHBondContact O-N 2.88Å; L86-S88 VanDerWaalsContact C-N 3.28Å; L86-S88 PolarHBondContact O-N 3.01Å; L86-H89 PolarHBondContact O-N 2.8Å; L86-H89 VanDerWaalsContact O-N 3.1Å; L86-E90 PolarHBondContact O-N 2.93Å
87	N	94.8	Very high	91.4	Very high	97 Å²	97	97.7 Å²	97.7	52%	0.519	53%	0.531	S	S	.	.	H	α-helix	trans	-62.1	-36.6	177.7	-69.3	-5.8	0	0	0	112	T83 V85 H89 P91	T83-N87 VanDerWaalsContact O-CB 3.31Å; T83-N87 WeakPolarHBondContact O-CB 3.22Å; T83-N87 PolarHBondContact O-N 3.49Å; T83-N87 PolarHBondContact O-ND2 2.86Å; T83-N87 PolarHBondContact O-OD1 3.38Å; V85-N87 PolarHBondContact O-N 3.44Å; N87-H89 VanDerWaalsContact C-N 3.31Å; N87-P91 WeakPolarHBondContact O-CD 3.24Å
88	S	94.2	Very high	89.7	Confident	78 Å²	78	97 Å²	97	55%	0.545	54%	0.543	S	S	.	.	H	α-helix	trans	-71.2	-27.7	176.5	74.1	0	0	0	0	113.2	S84 V85 L86	S84-S88 WeakPolarHBondContact O-CB 3.44Å; S84-S88 PolarHBondContact O-N 3.17Å; S84-S88 PolarHBondContact O-OG 3.25Å; V85-S88 PolarHBondContact O-N 2.98Å; V85-S88 PolarHBondContact O-OG 3.21Å; L86-S88 VanDerWaalsContact C-N 3.28Å; L86-S88 PolarHBondContact O-N 3.01Å
89	H	94	Very high	87.6	Confident	96 Å²	96	95.6 Å²	95.6	44%	0.444	54%	0.544	S	S	.	.	H	α-helix	trans	-84	-34.9	178.9	171.7	-92.2	0	0	0	113	V85 L86 N87 P91 L92 C93	V85-H89 PolarHBondContact O-N 3.37Å; L86-H89 PolarHBondContact O-N 2.8Å; L86-H89 VanDerWaalsContact O-N 3.1Å; N87-H89 VanDerWaalsContact C-N 3.31Å; H89-P91 VanDerWaalsContact C-CD 3.46Å; H89-L92 WeakPolarHBondContact O-CA 3.41Å; H89-L92 WeakPolarHBondContact O-CB 3.36Å; H89-L92 PolarHBondContact O-N 2.96Å; H89-C93 VanDerWaalsContact CE1-CB 3.43Å; H89-C93 WeakPolarHBondContact CE1-CB 3.31Å; H89-C93 PolarHBondContact CE1-SG 3.4Å; H89-C93 PolarHBondContact O-N 2.9Å; H89-C93 VanDerWaalsContact O-N 3.15Å
90	E	91	Very high	85	Confident	120 Å²	120	96.2 Å²	96.2	56%	0.561	55%	0.552	S	S	*	*	G	3₁₀ helix	trans	-42.2	-51.9	-177.3	-167.8	-166.9	-177.2	0	0	114.2	L86 L92 C93 L96	L86-E90 PolarHBondContact O-N 2.93Å; E90-L92 PolarHBondContact O-N 2.96Å; E90-C93 WeakPolarHBondContact O-CB 3.42Å; E90-C93 PolarHBondContact O-N 3.33Å; E90-L96 HydrophobicContact CG-CD1 3.88Å
91	P	88.1	Confident	82.7	Confident	107 Å²	107	95.2 Å²	95.2	70%	0.695	56%	0.56	S	S	*	*	G	3₁₀ helix	trans	-70.1	-15.1	-178.8	28.7	-37	0	0	0	114.4	N87 H89	N87-P91 WeakPolarHBondContact O-CD 3.24Å; H89-P91 VanDerWaalsContact C-CD 3.46Å
92	L	89.7	Confident	80.4	Confident	139 Å²	139	93.6 Å²	93.6	73%	0.728	57%	0.57	S	S	*	*	G	3₁₀ helix	trans	-96.2	-10.3	178.8	-54.4	178.1	0	0	0	112	H89 E90 S94	H89-L92 WeakPolarHBondContact O-CA 3.41Å; H89-L92 WeakPolarHBondContact O-CB 3.36Å; H89-L92 PolarHBondContact O-N 2.96Å; E90-L92 PolarHBondContact O-N 2.96Å; L92-S94 PolarHBondContact O-N 2.77Å
93	C	87.1	Confident	78.3	Confident	20 Å²	20	93.4 Å²	93.4	14%	0.135	58%	0.58	C	S	.	*			trans	-79.1	101.9	-173.1	-169.5	0	0	0	0	111.4	H89 E90 V95 L96 A97	H89-C93 VanDerWaalsContact CE1-CB 3.43Å; H89-C93 WeakPolarHBondContact CE1-CB 3.31Å; H89-C93 PolarHBondContact CE1-SG 3.4Å; H89-C93 PolarHBondContact O-N 2.9Å; H89-C93 VanDerWaalsContact O-N 3.15Å; E90-C93 WeakPolarHBondContact O-CB 3.42Å; E90-C93 PolarHBondContact O-N 3.33Å; C93-V95 PolarHBondContact O-N 2.87Å; C93-L96 HydrophobicContact CB-CB 4.15Å; C93-L96 HydrophobicContact CB-CD1 4.03Å; C93-L96 HydrophobicContact CB-CG 4.12Å; C93-L96 PolarHBondContact O-N 3.17Å; C93-A97 PolarHBondContact O-N 2.66Å; C93-A97 VanDerWaalsContact O-N 3.09Å
94	S	83.8	Confident	76.2	Confident	95 Å²	95	96 Å²	96	66%	0.664	60%	0.598	S	S	*	*	H	α-helix	trans	-60.1	-28.1	175	56.8	0	0	0	0	113.5	L92 A98	L92-S94 PolarHBondContact O-N 2.77Å; S94-A98 WeakPolarHBondContact O-CB 3.21Å; S94-A98 PolarHBondContact O-N 2.71Å; S94-A98 VanDerWaalsContact O-N 3.09Å
95	V	83.7	Confident	74.3	Confident	102 Å²	102	100.8 Å²	100.8	62%	0.618	61%	0.612	S	S	*	*	H	α-helix	trans	-65.4	-46.3	176.4	-177.6	0	0	0	0	110.7	C93 A98 S99	C93-V95 PolarHBondContact O-N 2.87Å; V95-A98 PolarHBondContact O-N 3.34Å; V95-S99 PolarHBondContact O-N 3.31Å; V95-S99 VanDerWaalsContact O-N 3.13Å; V95-S99 PolarHBondContact O-OG 2.84Å
96	L	67.8	Low	72.5	Confident	87 Å²	87	103.6 Å²	103.6	46%	0.455	63%	0.629	S	S	.	*	H	α-helix	trans	-69.3	-36.7	177.6	-68.8	176.6	0	0	0	111.9	E90 C93 A98 S99	E90-L96 HydrophobicContact CG-CD1 3.88Å; C93-L96 HydrophobicContact CB-CB 4.15Å; C93-L96 HydrophobicContact CB-CD1 4.03Å; C93-L96 HydrophobicContact CB-CG 4.12Å; C93-L96 PolarHBondContact O-N 3.17Å; L96-A98 PolarHBondContact O-N 2.9Å; L96-S99 CarbonylContact O-C 3.56Å; L96-S99 PolarHBondContact O-N 2.8Å; L96-S99 VanDerWaalsContact O-N 3.15Å
97	A	64	Low	71	Confident	83 Å²	83	103.8 Å²	103.8	69%	0.686	64%	0.635	S	S	*	*	H	α-helix	trans	-61.9	-30.6	174.2	0	0	0	0	0	112.6	C93	C93-A97 PolarHBondContact O-N 2.66Å; C93-A97 VanDerWaalsContact O-N 3.09Å
98	A	63.4	Low	69.4	Low	88 Å²	88	109.2 Å²	109.2	73%	0.727	65%	0.649	S	S	*	*	H	α-helix	trans	-84.1	-19.5	176	0	0	0	0	0	113.7	S94 V95 L96	S94-A98 WeakPolarHBondContact O-CB 3.21Å; S94-A98 PolarHBondContact O-N 2.71Å; S94-A98 VanDerWaalsContact O-N 3.09Å; V95-A98 PolarHBondContact O-N 3.34Å; L96-A98 PolarHBondContact O-N 2.9Å
99	S	55.1	Low	67.8	Low	69 Å²	69	110 Å²	110	48%	0.483	66%	0.655	S	S	.	*			trans	-108.9	73.7	-177.8	69.2	0	0	0	0	112.3	V95 L96	V95-S99 PolarHBondContact O-N 3.31Å; V95-S99 VanDerWaalsContact O-N 3.13Å; V95-S99 PolarHBondContact O-OG 2.84Å; L96-S99 CarbonylContact O-C 3.56Å; L96-S99 PolarHBondContact O-N 2.8Å; L96-S99 VanDerWaalsContact O-N 3.15Å
100	T	43.1	Very low	66.2	Low	123 Å²	123	110 Å²	110	76%	0.755	67%	0.672	S	S	*	*			trans	-110.5	118.9	149.1	44.4	0	0	0	0	106
101	P	51.7	Low	64.8	Low	118 Å²	118	111.8 Å²	111.8	77%	0.766	68%	0.68	S	S	*	*	S	Bend		-126.6	149.8	52.7	28.8	-9.7	0	0	0	115
102	S	50.2	Low	63.5	Low	115 Å²	115	111.4 Å²	111.4	80%	0.804	69%	0.685	S	S	*	*	P	Polyproline II helix	trans	-49.3	123.2	176.3	51.5	0	0	0	0	113.8
103	P	54.1	Low	62.1	Low	111 Å²	111	113.3 Å²	113.3	72%	0.721	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-73.7	157.3	162.1	5.6	10.6	0	0	0	110.2
104	P	52.9	Low	60.7	Low	116 Å²	116	120.6 Å²	120.6	75%	0.753	72%	0.72	S	S	*	*	P	Polyproline II helix	trans	-64.7	141.7	-167.9	28.9	-34.3	0	0	0	110.8	V106	P104-V106 PolarHBondContact O-N 3.14Å
105	E	58.6	Low	59.5	Low	179 Å²	179	122.8 Å²	122.8	84%	0.836	72%	0.719	S	S	*	*			trans	-38.3	108.8	171.1	-76.4	-173.1	143.6	0	0	110.4	V107	E105-V107 PolarHBondContact O-N 3.41Å
106	V	60	Low	58.5	Low	119 Å²	119	122.5 Å²	122.5	72%	0.721	72%	0.72	S	S	*	*			trans	-70.9	91	166.8	-179.8	0	0	0	0	105.4	P104 Y108	P104-V106 PolarHBondContact O-N 3.14Å; V106-Y108 PolarHBondContact O-N 3.42Å
107	V	63	Low	58.1	Low	117 Å²	117	126.2 Å²	126.2	71%	0.709	74%	0.735	S	S	*	*			trans	-57.7	104.1	168.9	177.2	0	0	0	0	106.2	E105 S109	E105-V107 PolarHBondContact O-N 3.41Å; V107-S109 VanDerWaalsContact C-N 3.35Å; V107-S109 PolarHBondContact O-N 3.47Å
108	Y	62.5	Low	57.9	Low	212 Å²	212	128.5 Å²	128.5	83%	0.831	74%	0.74	S	S	*	*			trans	-61.1	103.2	167.5	-86	-87.9	0	0	0	107	V106 A110	V106-Y108 PolarHBondContact O-N 3.42Å; Y108-A110 PolarHBondContact O-N 2.96Å
109	S	59.6	Low	57.8	Low	94 Å²	94	129.6 Å²	129.6	66%	0.657	74%	0.742	S	S	*	*			trans	-56.1	111.7	172.1	-108.7	0	0	0	0	107.9	V107 H111	V107-S109 VanDerWaalsContact C-N 3.35Å; V107-S109 PolarHBondContact O-N 3.47Å; S109-H111 VanDerWaalsContact C-N 3.33Å; S109-H111 PolarHBondContact O-N 3Å
110	A	61.6	Low	58.1	Low	97 Å²	97	131.5 Å²	131.5	80%	0.802	76%	0.755	S	S	*	*			trans	-60	101.7	169	0	0	0	0	0	106.9	Y108 A112	Y108-A110 PolarHBondContact O-N 2.96Å; A110-A112 PolarHBondContact O-N 2.92Å
111	H	60.3	Low	59.2	Low	157 Å²	157	130.7 Å²	130.7	73%	0.727	75%	0.752	S	S	*	*			trans	-56.7	107.6	171.3	-73.5	-71.5	0	0	0	107.1	S109 F113	S109-H111 VanDerWaalsContact C-N 3.33Å; S109-H111 PolarHBondContact O-N 3Å; H111-F113 VanDerWaalsContact O-CD2 3.32Å; H111-F113 WeakPolarHBondContact O-CD2 3.41Å; H111-F113 PolarHBondContact O-N 3.35Å
112	A	62	Low	60.1	Low	98 Å²	98	135.6 Å²	135.6	81%	0.81	76%	0.755	S	S	*	*			trans	-63.7	93.3	170	0	0	0	0	0	106.6	A110 H114	A110-A112 PolarHBondContact O-N 2.92Å; A112-H114 PolarHBondContact O-N 3.21Å
113	F	59.9	Low	60.5	Low	180 Å²	180	139.7 Å²	139.7	79%	0.789	76%	0.759	S	S	*	*			trans	-57.8	112.8	167.3	-72.7	-83.2	0	0	0	106.5	H111 Q115	H111-F113 VanDerWaalsContact O-CD2 3.32Å; H111-F113 WeakPolarHBondContact O-CD2 3.41Å; H111-F113 PolarHBondContact O-N 3.35Å; F113-Q115 PolarHBondContact O-N 3.5Å
114	H	58.2	Low	60.3	Low	172 Å²	172	142.2 Å²	142.2	80%	0.796	76%	0.761	S	S	*	*			trans	-60.5	96.4	169.2	-151.8	-35.8	0	0	0	105.7	A112 P116	A112-H114 PolarHBondContact O-N 3.21Å; H114-P116 WeakPolarHBondContact O-CD 3.35Å
115	Q	57.7	Low	61	Low	141 Å²	141	146.2 Å²	146.2	66%	0.659	79%	0.787	S	S	*	*			trans	-70.7	106.8	169.3	-81.9	-81.3	-2.8	0	0	105.7	F113 H117	F113-Q115 PolarHBondContact O-N 3.5Å; Q115-H117 PolarHBondContact O-N 2.84Å
116	P	61.8	Low	61.1	Low	97 Å²	97	144.6 Å²	144.6	63%	0.63	78%	0.784	S	S	*	*			trans	-64.5	112.2	166.2	28.5	-31	0	0	0	106	H114 V118	H114-P116 WeakPolarHBondContact O-CD 3.35Å; P116-V118 VanDerWaalsContact C-N 3.32Å; P116-V118 PolarHBondContact O-N 3.16Å
117	H	60.4	Low	61.1	Low	165 Å²	165	145.9 Å²	145.9	76%	0.764	79%	0.788	S	S	*	*			trans	-58.3	98.3	173.6	-41.3	-73.4	0	0	0	107.7	Q115 S119	Q115-H117 PolarHBondContact O-N 2.84Å; H117-S119 VanDerWaalsContact C-N 3.27Å; H117-S119 PolarHBondContact O-N 3.38Å
118	V	59.4	Low	61	Low	131 Å²	131	147.5 Å²	147.5	79%	0.794	79%	0.792	S	S	*	*			trans	-72.8	94.5	162.9	-73.1	0	0	0	0	105.7	P116 S120	P116-V118 VanDerWaalsContact C-N 3.32Å; P116-V118 PolarHBondContact O-N 3.16Å; V118-S120 PolarHBondContact O-N 2.9Å
119	S	61.5	Low	60.9	Low	110 Å²	110	143.7 Å²	143.7	77%	0.769	79%	0.79	S	S	*	*			trans	-53.3	102	171.5	-64.3	0	0	0	0	108.4	H117 P121	H117-S119 VanDerWaalsContact C-N 3.27Å; H117-S119 PolarHBondContact O-N 3.38Å; S119-P121 WeakPolarHBondContact O-CD 3.39Å
120	S	60.6	Low	61	Low	110 Å²	110	146.8 Å²	146.8	77%	0.769	80%	0.798	S	S	*	*			trans	-68.1	119.3	175.3	-162.2	0	0	0	0	107.5	V118 R122	V118-S120 PolarHBondContact O-N 2.9Å; S120-R122 PolarHBondContact O-N 3.45Å
121	P	67	Low	61	Low	105 Å²	105	150.1 Å²	150.1	68%	0.682	80%	0.798	S	S	*	*			trans	-64.7	111.1	179.7	24.7	-30.5	0	0	0	108.4	S119 F123	S119-P121 WeakPolarHBondContact O-CD 3.39Å; P121-F123 PolarHBondContact O-N 2.85Å
122	R	70.4	Confident	61	Low	221 Å²	221	149.6 Å²	149.6	83%	0.834	80%	0.803	S	S	*	*			trans	-55.8	108	173.2	-169.9	177.3	-165.1	126.2	-0.1	108.1	S120 Q124	S120-R122 PolarHBondContact O-N 3.45Å; R122-Q124 PolarHBondContact O-N 3.07Å
123	F	59.2	Low	61	Low	201 Å²	201	153.6 Å²	153.6	88%	0.882	80%	0.802	S	S	*	*			trans	-61	106.4	165.5	-85.7	-92.4	0	0	0	107.6	P121	P121-F123 PolarHBondContact O-N 2.85Å
124	Q	49.5	Very low	61	Low	165 Å²	165	151.4 Å²	151.4	77%	0.771	80%	0.803	S	S	*	*			trans	-86.2	135.9	158.5	-77.5	-175.6	-36.3	0	0	107.8	R122	R122-Q124 PolarHBondContact O-N 3.07Å
125	P	66.7	Low	61.3	Low	199 Å²	199	149.5 Å²	149.5	100%	1.292	80%	0.804	S	S	*	*			trans	-63.3	0	-177.8	26.6	-33.9	0	0	0	113.3

Retrieved 125 of 125 residues in 94.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).