A0A096NVL9_PAPAN Loading...

Otoraplin

AlphaFold DB (F7GGY6), UniProt , Accession A0A096NVL9, Species PAPAN (Papio anubis, Olive baboon), Gene OTOR, Length 128 aa.

						>A0A096NVL9_PAPAN|A0A096NVL9|OTOR
MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLARAQEDYNAPDCRFINVKKGQQIYVYSKLVKENEAGEFWAGSVYGDGQDEMGVVGYFPSNLVKEQRVYQEATKEVPTTDIDFFCE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44	Very low	54.5	Low	249 Å²	249	153.5 Å²	153.5	100%	1.227	82%	0.819	S	S	*	*				0	99.7	0	-61.1	-174.1	-138	0	0	107.8
2	A	44.1	Very low	55	Low	95 Å²	95	155.2 Å²	155.2	79%	0.785	83%	0.826	S	S	*	*			trans	-118.9	108.4	176.7	0	0	0	0	0	107.6
3	R	49.1	Very low	55.6	Low	243 Å²	243	152.8 Å²	152.8	92%	0.917	82%	0.82	S	S	*	*			trans	-87.4	106.1	175.7	-77.9	-177.3	170	175.4	-2.9	107.8	L5	R3-L5 PolarHBondContact O-N 2.83Å
4	I	57.4	Low	56	Low	150 Å²	150	147.6 Å²	147.6	77%	0.769	81%	0.81	S	S	*	*			trans	-76.1	107.3	171.7	-59.9	156.4	0	0	0	106.3	L6	I4-L6 PolarHBondContact O-N 2.88Å
5	L	55.7	Low	56.4	Low	137 Å²	137	145.8 Å²	145.8	72%	0.717	80%	0.804	S	S	*	*			trans	-81.5	100.5	173.1	-126.5	88.6	0	0	0	108	R3 L7	R3-L5 PolarHBondContact O-N 2.83Å; L5-L7 HydrophobicContact CD2-CD2 4.24Å; L5-L7 HydrophobicContact CD2-CG 4.49Å; L5-L7 PolarHBondContact O-N 2.86Å; L5-L7 VanDerWaalsContact O-N 3.15Å
6	L	58.9	Low	56.3	Low	142 Å²	142	143.9 Å²	143.9	74%	0.743	80%	0.802	S	S	*	*			trans	-74	96.3	167.6	-79.6	160.8	0	0	0	108.4	I4 F8	I4-L6 PolarHBondContact O-N 2.88Å; L6-F8 HydrophobicContact CB-CE2 4.46Å; L6-F8 PolarHBondContact O-N 2.92Å
7	L	58.1	Low	56.3	Low	140 Å²	140	139 Å²	139	73%	0.733	79%	0.785	S	S	*	*			trans	-78.5	95.8	169.9	-71.6	168.7	0	0	0	108.6	L5 L9	L5-L7 HydrophobicContact CD2-CD2 4.24Å; L5-L7 HydrophobicContact CD2-CG 4.49Å; L5-L7 PolarHBondContact O-N 2.86Å; L5-L7 VanDerWaalsContact O-N 3.15Å; L7-L9 PolarHBondContact O-N 2.79Å; L7-L9 VanDerWaalsContact O-N 3.15Å
8	F	55.4	Low	56.3	Low	190 Å²	190	139.1 Å²	139.1	83%	0.833	79%	0.789	S	S	*	*			trans	-67.5	101.8	163.6	-82.9	-93.7	0	0	0	108.4	L6 P10	L6-F8 HydrophobicContact CB-CE2 4.46Å; L6-F8 PolarHBondContact O-N 2.92Å; F8-P10 WeakPolarHBondContact O-CD 3.25Å
9	L	58.7	Low	56.1	Low	159 Å²	159	140.2 Å²	140.2	83%	0.832	79%	0.786	S	S	*	*			trans	-79.7	113	165.9	-83.2	149.8	0	0	0	107.6	L7 G11	L7-L9 PolarHBondContact O-N 2.79Å; L7-L9 VanDerWaalsContact O-N 3.15Å; L9-G11 PolarHBondContact O-N 3.23Å
10	P	56.6	Low	56	Low	117 Å²	117	136.4 Å²	136.4	76%	0.76	78%	0.78	S	S	*	*			trans	-62.8	125.9	175.7	25.6	-30.7	0	0	0	108.4	F8 L12	F8-P10 WeakPolarHBondContact O-CD 3.25Å; P10-L12 PolarHBondContact O-N 3.17Å
11	G	61.2	Low	56.1	Low	67 Å²	67	137 Å²	137	69%	0.691	78%	0.779	S	S	*	*			trans	-54.8	126.6	176.9	0	0	0	0	0	110	L9 V13	L9-G11 PolarHBondContact O-N 3.23Å; G11-V13 VanDerWaalsContact C-N 3.27Å; G11-V13 PolarHBondContact O-N 2.82Å
12	L	61.1	Low	56.9	Low	173 Å²	173	132.2 Å²	132.2	91%	0.906	75%	0.752	S	S	*	*			trans	-67.7	88.5	174.4	-165.2	80.3	0	0	0	107.9	P10 A14	P10-L12 PolarHBondContact O-N 3.17Å; L12-A14 PolarHBondContact O-N 3.22Å
13	V	62.4	Low	58.3	Low	124 Å²	124	130.3 Å²	130.3	75%	0.752	73%	0.727	S	S	*	*			trans	-71.1	98.4	168.2	-178.9	0	0	0	0	106.1	G11 V15	G11-V13 VanDerWaalsContact C-N 3.27Å; G11-V13 PolarHBondContact O-N 2.82Å; V13-V15 VanDerWaalsContact C-N 3.29Å; V13-V15 HydrophobicContact CG1-CG2 4.28Å; V13-V15 PolarHBondContact O-N 3Å
14	A	62	Low	60	Low	81 Å²	81	125.4 Å²	125.4	67%	0.669	72%	0.719	S	S	*	*			trans	-66	94.4	167.3	0	0	0	0	0	107.6	L12 C16	L12-A14 PolarHBondContact O-N 3.22Å; A14-C16 PolarHBondContact O-N 3.28Å
15	V	62	Low	61.5	Low	120 Å²	120	123.7 Å²	123.7	73%	0.727	70%	0.703	S	S	*	*			trans	-68.2	102.3	167.1	-175.8	0	0	0	0	105.6	V13 A17	V13-V15 VanDerWaalsContact C-N 3.29Å; V13-V15 HydrophobicContact CG1-CG2 4.28Å; V13-V15 PolarHBondContact O-N 3Å; V15-A17 PolarHBondContact O-N 2.87Å
16	C	54.3	Low	63.2	Low	115 Å²	115	118.4 Å²	118.4	78%	0.777	68%	0.675	S	S	*	*			trans	-62.7	92	166.3	-66	0	0	0	0	107	A14 V18	A14-C16 PolarHBondContact O-N 3.28Å; C16-V18 PolarHBondContact O-N 2.88Å
17	A	57	Low	64.9	Low	61 Å²	61	111.8 Å²	111.8	50%	0.504	64%	0.641	S	S	.	*			trans	-63.8	104.1	168.4	0	0	0	0	0	106.9	V15 H19	V15-A17 PolarHBondContact O-N 2.87Å; A17-H19 VanDerWaalsContact CB-CE1 3.42Å; A17-H19 WeakPolarHBondContact CB-CE1 3.5Å; A17-H19 PolarHBondContact O-N 3.31Å; A17-H19 PolarHBondContact O-ND1 3.47Å
18	V	55.1	Low	66.7	Low	141 Å²	141	107.6 Å²	107.6	86%	0.855	62%	0.624	S	S	*	*			trans	-65.8	89.2	170.1	-174.1	0	0	0	0	106.1	C16 G20	C16-V18 PolarHBondContact O-N 2.88Å; V18-G20 VanDerWaalsContact C-N 3.31Å; V18-G20 PolarHBondContact O-N 3.13Å; V18-G20 VanDerWaalsContact O-N 3.07Å
19	H	52.3	Low	68.6	Low	159 Å²	159	102.5 Å²	102.5	74%	0.736	60%	0.601	S	S	*	*			trans	-75.5	94.1	169.1	-70.3	76.5	0	0	0	105.5	A17 I21	A17-H19 VanDerWaalsContact CB-CE1 3.42Å; A17-H19 WeakPolarHBondContact CB-CE1 3.5Å; A17-H19 PolarHBondContact O-N 3.31Å; A17-H19 PolarHBondContact O-ND1 3.47Å; H19-I21 PolarHBondContact O-N 2.9Å; H19-I21 VanDerWaalsContact O-N 3.07Å
20	G	54.9	Low	70.4	Confident	64 Å²	64	96 Å²	96	66%	0.66	57%	0.566	S	S	*	*			trans	-51.5	118.4	161.2	0	0	0	0	0	107	V18 F22	V18-G20 VanDerWaalsContact C-N 3.31Å; V18-G20 PolarHBondContact O-N 3.13Å; V18-G20 VanDerWaalsContact O-N 3.07Å; G20-F22 PolarHBondContact O-N 3.48Å
21	I	57.4	Low	72.4	Confident	150 Å²	150	93 Å²	93	77%	0.769	54%	0.543	S	S	*	.			trans	-71.9	102.3	179.7	-57.8	175.5	0	0	0	105.4	H19 M23	H19-I21 PolarHBondContact O-N 2.9Å; H19-I21 VanDerWaalsContact O-N 3.07Å; I21-M23 HydrophobicContact CG2-CG 4.43Å; I21-M23 PolarHBondContact O-N 3.05Å
22	F	62.4	Low	74.2	Confident	149 Å²	149	89.8 Å²	89.8	65%	0.654	51%	0.51	S	S	*	.			trans	-70	102.1	172.7	-156.1	-93.6	0	0	0	107.1	G20 D122	G20-F22 PolarHBondContact O-N 3.48Å; F22-D122 HydrophobicContact CE2-CB 3.98Å; F22-D122 HydrophobicContact CZ-CB 3.66Å; F22-D122 WeakPolarHBondContact CZ-OD1 3.49Å
23	M	73.2	Confident	75.9	Confident	55 Å²	55	82 Å²	82	27%	0.271	47%	0.472	S	S	.	.	P	Polyproline II helix	trans	-74.5	145.1	179.8	-59.1	-162.7	80.4	0	0	109.8	I21 D54 R56	I21-M23 HydrophobicContact CG2-CG 4.43Å; I21-M23 PolarHBondContact O-N 3.05Å; M23-D54 HydrophobicContact CE-CB 4.14Å; M23-D54 WeakPolarHBondContact CE-OD2 3.42Å; M23-R56 HydrophobicContact SD-CG 4.06Å
24	D	83.3	Confident	77.5	Confident	140 Å²	140	77.3 Å²	77.3	75%	0.749	44%	0.442	S	S	*	.	P	Polyproline II helix	trans	-61	142.4	174.7	-71.2	-37.9	0	0	0	111	R56	D24-R56 PolarHBondContact O-NH1 3Å
25	R	89.6	Confident	79	Confident	114 Å²	114	78.7 Å²	78.7	43%	0.43	44%	0.438	S	S	.	.	P	Polyproline II helix	trans	-63.1	136.7	177	-61.8	-172.4	178.8	-174.9	0.5	110.1	A27 T120 D122 F125	R25-A27 VanDerWaalsContact C-N 3.33Å; R25-T120 PolarHBondContact NH1-O 2.73Å; R25-T120 VanDerWaalsContact NH1-O 3.1Å; R25-D122 IonicContact CZ-OD1 3.24Å; R25-D122 VanDerWaalsContact CZ-OD1 3.24Å; R25-D122 IonicContact NE-OD1 3.34Å; R25-D122 PolarHBondContact NE-OD1 3.34Å; R25-D122 IonicContact NH2-OD1 2.68Å; R25-D122 PolarHBondContact NH2-OD1 2.02Å; R25-D122 IonicContact NH2-OD2 3.58Å; R25-F125 HydrophobicContact CB-CD2 3.85Å; R25-F125 HydrophobicContact CB-CE2 3.57Å; R25-F125 HydrophobicContact CB-CZ 4.29Å; R25-F125 HydrophobicContact CG-CD2 3.73Å; R25-F125 HydrophobicContact CG-CE2 3.76Å
26	L	92.1	Very high	80.5	Confident	25 Å²	25	80.7 Å²	80.7	13%	0.131	44%	0.44	C	S	.	.	S	Bend	trans	-74.5	-26.3	177.4	-62.4	174.5	0	0	0	112.5	F57 L72 Y99 F125	L26-F57 HydrophobicContact CD1-CE1 4.17Å; L26-F57 HydrophobicContact CD1-CZ 3.81Å; L26-F57 HydrophobicContact CD2-CZ 4Å; L26-L72 HydrophobicContact CB-CD1 3.58Å; L26-L72 HydrophobicContact CD1-CD1 4.27Å; L26-Y99 HydrophobicContact CD1-CD1 4.36Å; L26-Y99 HydrophobicContact CD1-CD2 3.7Å; L26-Y99 HydrophobicContact CD1-CE2 4.16Å; L26-Y99 HydrophobicContact CD1-CG 3.83Å; L26-F125 HydrophobicContact CB-CD1 4.16Å; L26-F125 HydrophobicContact CB-CE1 3.6Å; L26-F125 HydrophobicContact CB-CZ 4.21Å; L26-F125 HydrophobicContact CD1-CD1 4.07Å; L26-F125 HydrophobicContact CD1-CE1 4.06Å; L26-F125 HydrophobicContact CG-CD1 3.94Å; L26-F125 HydrophobicContact CG-CE1 3.89Å
27	A	94.6	Very high	82.3	Confident	4 Å²	4	76.2 Å²	76.2	3%	0.033	41%	0.409	C	S	.	.			trans	-158.6	159.6	174.2	0	0	0	0	0	109	R25 L72 V73 T120	R25-A27 VanDerWaalsContact C-N 3.33Å; A27-L72 HydrophobicContact CB-CB 3.89Å; A27-L72 HydrophobicContact CB-CD1 4.06Å; A27-L72 HydrophobicContact CB-CD2 4.4Å; A27-L72 HydrophobicContact CB-CG 4.35Å; A27-V73 VanDerWaalsContact CB-O 3.3Å; A27-V73 WeakPolarHBondContact CB-O 3.43Å; A27-T120 PolarHBondContact O-OG1 3.43Å
28	S	94.8	Very high	84	Confident	52 Å²	52	77.8 Å²	77.8	36%	0.364	41%	0.413	S	S	.	.	S	Bend	trans	-85.4	-18	172.7	80.2	0	0	0	0	113.3	E75 T120	S28-E75 WeakPolarHBondContact CA-OE1 3.14Å; S28-E75 VanDerWaalsContact CB-OE1 3.24Å; S28-E75 WeakPolarHBondContact CB-OE1 3.17Å; S28-E75 WeakPolarHBondContact CB-OE2 3.2Å; S28-E75 PolarHBondContact N-OE1 2.74Å; S28-E75 PolarHBondContact N-OE2 3.27Å; S28-E75 VanDerWaalsContact OG-CD 3.28Å; S28-E75 PolarHBondContact OG-OE1 3.01Å; S28-E75 PolarHBondContact OG-OE2 3.27Å; S28-T120 WeakPolarHBondContact CA-OG1 3.03Å; S28-T120 PolarHBondContact O-N 2.89Å; S28-T120 PolarHBondContact O-OG1 2.68Å
29	K	96.3	Very high	85.9	Confident	83 Å²	83	77.7 Å²	77.7	36%	0.361	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	155.7	-177.8	-55.9	-173.1	-173.2	177.2	0	113.1	V73 E75 E117 V118	K29-V73 HydrophobicContact CB-CB 4.14Å; K29-V73 HydrophobicContact CB-CG2 3.91Å; K29-V73 PolarHBondContact O-N 2.84Å; K29-E75 PolarHBondContact N-OE1 2.99Å; K29-E117 HydrophobicContact CB-CG 4.25Å; K29-E117 VanDerWaalsContact CD-CD 3.46Å; K29-E117 HydrophobicContact CD-CG 3.8Å; K29-E117 WeakPolarHBondContact CD-OE1 3.3Å; K29-E117 WeakPolarHBondContact CE-OE1 3.25Å; K29-E117 IonicContact NZ-OE1 2.74Å; K29-E117 PolarHBondContact NZ-OE1 3.07Å; K29-V118 WeakPolarHBondContact CA-O 3.32Å
30	K	97.1	Very high	87.9	Confident	22 Å²	22	71.8 Å²	71.8	10%	0.096	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.6	148.4	175.3	59.3	-178.1	174.7	179.1	0	111	C37 L72 E117 V118 T120 D124	K30-C37 VanDerWaalsContact CE-SG 3.51Å; K30-L72 HydrophobicContact CB-CD2 3.84Å; K30-E117 WeakPolarHBondContact O-CA 3.11Å; K30-V118 HydrophobicContact CG-CB 4.3Å; K30-V118 PolarHBondContact N-O 3.12Å; K30-V118 PolarHBondContact O-N 3.21Å; K30-T120 HydrophobicContact CB-CG2 4.18Å; K30-T120 HydrophobicContact CD-CG2 4.35Å; K30-T120 HydrophobicContact CG-CG2 4.18Å; K30-D124 IonicContact NZ-OD1 2.68Å; K30-D124 PolarHBondContact NZ-OD1 3.14Å; K30-D124 IonicContact NZ-OD2 3.43Å; K30-D124 PolarHBondContact NZ-OD2 3.26Å
31	L	98	Very high	90	Very high	53 Å²	53	68.8 Å²	68.8	28%	0.277	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.8	129.9	170.8	-67.1	172.7	0	0	0	109.7	S70 K71 V73 A114 K116 E117	L31-S70 CarbonylContact O-C 3.54Å; L31-S70 VanDerWaalsContact O-CA 3.29Å; L31-S70 WeakPolarHBondContact O-CA 3.27Å; L31-K71 HydrophobicContact CB-CB 4.39Å; L31-K71 PolarHBondContact N-O 3.04Å; L31-K71 PolarHBondContact O-N 3.22Å; L31-V73 HydrophobicContact CG-CG2 4.07Å; L31-A114 HydrophobicContact CB-CB 3.95Å; L31-K116 CarbonylContact C-O 3.6Å; L31-K116 WeakPolarHBondContact CA-O 3.35Å; L31-E117 HydrophobicContact CD2-CB 4.05Å
32	C	98	Very high	91.9	Very high	0 Å²	0	61.7 Å²	61.7	0%	0	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.6	162.1	-176.9	-63.3	0	0	0	0	111.3	D34 C37 A114 T115 K116	C32-D34 VanDerWaalsContact C-N 3.34Å; C32-D34 WeakPolarHBondContact CB-O 3.46Å; C32-C37 HydrophobicContact CB-CB 3.75Å; C32-C37 WeakPolarHBondContact CB-SG 3.43Å; C32-C37 WeakPolarHBondContact SG-CB 3.48Å; C32-C37 CovalentContact SG-SG 2.02Å; C32-C37 PolarHBondContact SG-SG 2.8Å; C32-A114 CarbonylContact O-C 3.44Å; C32-A114 WeakPolarHBondContact O-CA 3.4Å; C32-T115 PolarHBondContact O-N 3.15Å; C32-K116 PolarHBondContact N-O 3.48Å; C32-K116 WeakPolarHBondContact O-CB 3.04Å; C32-K116 PolarHBondContact O-N 3.1Å
33	A	97.6	Very high	93.6	Very high	11 Å²	11	55.4 Å²	55.4	9%	0.091	28%	0.278	C	S	.	.	S	Bend	trans	-71.4	-32.2	173	0	0	0	0	0	111.9	I41 Q112	A33-I41 HydrophobicContact CB-CG1 4.08Å; A33-Q112 HydrophobicContact CB-CB 3.81Å
34	D	96.1	Very high	94.8	Very high	24 Å²	24	52.8 Å²	52.8	13%	0.128	27%	0.266	C	S	.	.	S	Bend	trans	-138.9	169.3	-179	62.8	-77.4	0	0	0	111	C32 E36 C37 V38 Y39	C32-D34 VanDerWaalsContact C-N 3.34Å; C32-D34 WeakPolarHBondContact CB-O 3.46Å; D34-E36 PolarHBondContact O-N 3.1Å; D34-E36 WeakPolarHBondContact OD2-CA 3.44Å; D34-E36 PolarHBondContact OD2-N 3.39Å; D34-C37 PolarHBondContact O-N 3.43Å; D34-C37 PolarHBondContact OD2-N 2.97Å; D34-V38 PolarHBondContact OD1-N 2.96Å; D34-V38 VanDerWaalsContact OD1-N 3.14Å; D34-V38 PolarHBondContact OD2-N 2.91Å; D34-Y39 HydrophobicContact CB-CD2 3.9Å; D34-Y39 WeakPolarHBondContact OD1-CB 3.29Å; D34-Y39 WeakPolarHBondContact OD1-CD2 3.35Å; D34-Y39 PolarHBondContact OD1-N 3.42Å
35	D	94.1	Very high	95.5	Very high	111 Å²	111	50.9 Å²	50.9	59%	0.594	25%	0.248	S	C	*	.	T	Hydrogen-bonded Turn	trans	-68.3	-18.4	-175.2	-58.8	-53.8	0	0	0	113.2	K116	D35-K116 IonicContact OD1-NZ 3.96Å
36	E	92	Very high	95.9	Very high	161 Å²	161	45.6 Å²	45.6	75%	0.752	23%	0.228	S	C	*	.	T	Hydrogen-bonded Turn	trans	-101.3	-2.6	178.1	-59.4	-172.1	141.1	0	0	112.7	D34 V38	D34-E36 PolarHBondContact O-N 3.1Å; D34-E36 WeakPolarHBondContact OD2-CA 3.44Å; D34-E36 PolarHBondContact OD2-N 3.39Å; E36-V38 HydrophobicContact CB-CG2 3.74Å; E36-V38 PolarHBondContact O-N 2.92Å
37	C	93.5	Very high	96.2	Very high	21 Å²	21	48.2 Å²	48.2	14%	0.142	24%	0.24	C	C	.	.	S	Bend	trans	55.3	31.8	-177.4	-52.3	0	0	0	0	114	K30 C32 D34	K30-C37 VanDerWaalsContact CE-SG 3.51Å; C32-C37 HydrophobicContact CB-CB 3.75Å; C32-C37 WeakPolarHBondContact CB-SG 3.43Å; C32-C37 WeakPolarHBondContact SG-CB 3.48Å; C32-C37 CovalentContact SG-SG 2.02Å; C32-C37 PolarHBondContact SG-SG 2.8Å; D34-C37 PolarHBondContact O-N 3.43Å; D34-C37 PolarHBondContact OD2-N 2.97Å
38	V	92.1	Very high	96.3	Very high	95 Å²	95	53.6 Å²	53.6	58%	0.576	27%	0.265	S	S	*	.			trans	-87.2	-32.6	-177	177.8	0	0	0	0	111.5	D34 E36	D34-V38 PolarHBondContact OD1-N 2.96Å; D34-V38 VanDerWaalsContact OD1-N 3.14Å; D34-V38 PolarHBondContact OD2-N 2.91Å; E36-V38 HydrophobicContact CB-CG2 3.74Å; E36-V38 PolarHBondContact O-N 2.92Å
39	Y	94.3	Very high	96.4	Very high	139 Å²	139	55.3 Å²	55.3	55%	0.545	27%	0.269	S	S	.	.	S	Bend	trans	-85.3	141	-176.9	-67.2	-64.4	0	0	0	113.1	D34 I41	D34-Y39 HydrophobicContact CB-CD2 3.9Å; D34-Y39 WeakPolarHBondContact OD1-CB 3.29Å; D34-Y39 WeakPolarHBondContact OD1-CD2 3.35Å; D34-Y39 PolarHBondContact OD1-N 3.42Å; Y39-I41 PolarHBondContact O-N 2.82Å
40	T	95.8	Very high	96.5	Very high	35 Å²	35	52.9 Å²	52.9	22%	0.215	26%	0.258	C	S	.	.			trans	-63.7	126.3	172.5	-49.6	0	0	0	0	111.3	S42 Y67 V68 Y69 Y111	T40-S42 WeakPolarHBondContact CG2-O 3.25Å; T40-Y67 HydrophobicContact CG2-CD1 3.76Å; T40-Y67 HydrophobicContact CG2-CG 4.25Å; T40-V68 CarbonylContact C-O 3.56Å; T40-V68 WeakPolarHBondContact CG2-O 3.46Å; T40-Y69 WeakPolarHBondContact OG1-CE1 3.49Å; T40-Y111 HydrophobicContact CG2-CD2 3.9Å; T40-Y111 HydrophobicContact CG2-CE2 4.14Å
41	I	98.1	Very high	96.5	Very high	1 Å²	1	57 Å²	57	1%	0.005	28%	0.282	C	S	.	.			trans	-72.6	-54.5	172.3	-64.4	163.8	0	0	0	109.5	A33 Y39 V68 Y69 K71 Y111 Q112 A114	A33-I41 HydrophobicContact CB-CG1 4.08Å; Y39-I41 PolarHBondContact O-N 2.82Å; I41-V68 WeakPolarHBondContact CB-O 3.29Å; I41-V68 PolarHBondContact N-O 2.57Å; I41-Y69 VanDerWaalsContact CD1-C 3.48Å; I41-Y69 WeakPolarHBondContact CD1-O 3.42Å; I41-K71 HydrophobicContact CD1-CG 4.2Å; I41-Y111 PolarHBondContact O-N 2.68Å; I41-Q112 WeakPolarHBondContact CG2-O 3.49Å; I41-Q112 PolarHBondContact O-N 3.35Å; I41-Q112 VanDerWaalsContact O-N 3.1Å; I41-Q112 VanDerWaalsContact O-O 3.1Å; I41-A114 HydrophobicContact CD1-CB 3.64Å; I41-A114 HydrophobicContact CG1-CB 4.02Å; I41-A114 HydrophobicContact CG2-CB 3.97Å
42	S	97.9	Very high	96.4	Very high	0 Å²	0	55.9 Å²	55.9	0%	0	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.7	162.7	-173.1	62.5	0	0	0	0	113.6	T40 V68 E107 R109	T40-S42 WeakPolarHBondContact CG2-O 3.25Å; S42-V68 PolarHBondContact N-O 2.8Å; S42-V68 PolarHBondContact O-N 2.83Å; S42-E107 WeakPolarHBondContact CB-OE1 3.36Å; S42-E107 PolarHBondContact OG-OE1 3.26Å; S42-R109 CarbonylContact C-O 3.59Å; S42-R109 WeakPolarHBondContact CA-O 3.44Å; S42-R109 WeakPolarHBondContact CB-O 3.17Å
43	L	97.3	Very high	96.2	Very high	17 Å²	17	60.4 Å²	60.4	9%	0.089	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	120.3	165.3	-175.4	65.5	0	0	0	108.4	Q65 I66 Y67 Q108 R109 Y111	L43-Q65 HydrophobicContact CD1-CB 3.94Å; L43-I66 WeakPolarHBondContact CA-O 2.91Å; L43-Y67 HydrophobicContact CD1-CD1 3.72Å; L43-Y67 HydrophobicContact CD1-CE1 3.68Å; L43-Y67 HydrophobicContact CD1-CG 4.41Å; L43-Q108 PolarHBondContact O-N 2.86Å; L43-R109 PolarHBondContact N-O 2.98Å; L43-R109 PolarHBondContact O-N 2.83Å; L43-Y111 HydrophobicContact CB-CE2 3.85Å
44	A	97.9	Very high	96	Very high	0 Å²	0	61.9 Å²	61.9	0%	0	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	155.4	176.6	0	0	0	0	0	111.3	Q65 I66 V68 V105 K106 E107	A44-Q65 CarbonylContact O-C 3.48Å; A44-Q65 VanDerWaalsContact O-CA 3.3Å; A44-Q65 WeakPolarHBondContact O-CA 3.47Å; A44-I66 PolarHBondContact N-O 2.85Å; A44-I66 PolarHBondContact O-N 2.78Å; A44-V68 HydrophobicContact CB-CG2 4.04Å; A44-V105 HydrophobicContact CB-CB 3.89Å; A44-V105 HydrophobicContact CB-CG2 3.79Å; A44-K106 WeakPolarHBondContact CA-O 3.22Å; A44-E107 HydrophobicContact CB-CG 4.41Å
45	R	97.8	Very high	95.8	Very high	101 Å²	101	64.8 Å²	64.8	38%	0.381	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	126.3	173.5	-170.8	176.5	-172.9	87.1	0.5	109.9	Q47 G63 Q64 V105 K106 Q108	R45-Q47 PolarHBondContact O-N 3.01Å; R45-Q47 PolarHBondContact O-NE2 3.25Å; R45-G63 PolarHBondContact NE-O 3.44Å; R45-G63 PolarHBondContact NH1-O 3.03Å; R45-G63 PolarHBondContact NH2-O 2.94Å; R45-G63 VanDerWaalsContact NH2-O 3.13Å; R45-Q64 WeakPolarHBondContact CA-O 3.26Å; R45-V105 WeakPolarHBondContact O-CA 3.35Å; R45-K106 PolarHBondContact N-O 2.87Å; R45-K106 PolarHBondContact O-N 3.15Å; R45-Q108 HydrophobicContact CB-CG 3.76Å
46	A	98.1	Very high	95.8	Very high	2 Å²	2	61 Å²	61	2%	0.017	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.7	130.7	176.4	0	0	0	0	0	111.4	V60 K61 G63 Q64 I66	A46-V60 HydrophobicContact CB-CG1 3.29Å; A46-K61 WeakPolarHBondContact CB-O 3.3Å; A46-G63 PolarHBondContact O-N 2.9Å; A46-Q64 PolarHBondContact N-O 3.16Å; A46-I66 HydrophobicContact CB-CD1 4.5Å
47	Q	98.4	Very high	96	Very high	80 Å²	80	54.1 Å²	54.1	37%	0.374	28%	0.282	S	S	.	.	S	Bend	trans	-93.1	-24.7	178.4	-59	-53.8	-64.2	0	0	112.2	R45 K62 L104 K106	R45-Q47 PolarHBondContact O-N 3.01Å; R45-Q47 PolarHBondContact O-NE2 3.25Å; Q47-K62 WeakPolarHBondContact O-CD 3.4Å; Q47-K62 WeakPolarHBondContact O-CE 3.49Å; Q47-K62 VanDerWaalsContact O-CG 3.32Å; Q47-K62 WeakPolarHBondContact O-CG 3.41Å; Q47-L104 PolarHBondContact N-O 3.15Å; Q47-K106 HydrophobicContact CG-CB 4.12Å
48	E	97.4	Very high	96.1	Very high	118 Å²	118	53.8 Å²	53.8	55%	0.551	28%	0.279	S	S	*	.	S	Bend	trans	-141.3	167.4	-176.1	-60	-174.1	172.2	0	0	110.4	L104	E48-L104 HydrophobicContact CB-CD2 4.45Å
49	D	97.6	Very high	96.2	Very high	87 Å²	87	53.9 Å²	53.9	47%	0.465	28%	0.276	S	S	.	.			trans	-78.2	141.9	171.2	-82.7	19.1	0	0	0	109.9	V60 K61 K62	D49-V60 CarbonylContact C-O 3.51Å; D49-V60 WeakPolarHBondContact CA-O 3.17Å; D49-K61 HydrophobicContact CB-CD 4.45Å; D49-K61 WeakPolarHBondContact OD1-CA 3.48Å; D49-K61 VanDerWaalsContact OD2-CD 3.25Å; D49-K61 WeakPolarHBondContact OD2-CD 3.14Å; D49-K61 IonicContact OD2-NZ 2.86Å; D49-K61 PolarHBondContact OD2-NZ 2.86Å; D49-K62 WeakPolarHBondContact OD1-CB 3.17Å; D49-K62 PolarHBondContact OD1-N 2.78Å
50	Y	97.5	Very high	96.3	Very high	33 Å²	33	47.4 Å²	47.4	13%	0.129	25%	0.251	C	S	.	.	B	Isolated β-bridge	trans	-134.2	126	174.5	179.3	-115.5	0	0	0	109.3	P53 F57 I58 N59 V60 F100 P101 L104	Y50-P53 WeakPolarHBondContact OH-CD 3.39Å; Y50-F57 HydrophobicContact CE1-CB 4.1Å; Y50-F57 HydrophobicContact CE1-CD1 4.32Å; Y50-F57 WeakPolarHBondContact OH-CD1 3.25Å; Y50-F57 WeakPolarHBondContact OH-CG 3.22Å; Y50-I58 VanDerWaalsContact CD1-O 3.25Å; Y50-I58 WeakPolarHBondContact CD1-O 3.36Å; Y50-I58 WeakPolarHBondContact CE1-O 3.37Å; Y50-N59 WeakPolarHBondContact O-CA 3.43Å; Y50-V60 PolarHBondContact N-O 2Å; Y50-V60 PolarHBondContact O-N 2.91Å; Y50-F100 HydrophobicContact CD1-CB 4.19Å; Y50-F100 HydrophobicContact CE1-CB 4.2Å; Y50-P101 HydrophobicContact CD2-CG 4.28Å; Y50-P101 HydrophobicContact CE2-CG 3.82Å; Y50-L104 HydrophobicContact CD2-CD1 3.52Å; Y50-L104 HydrophobicContact CE2-CD1 4.37Å; Y50-L104 HydrophobicContact CG-CD1 3.74Å
51	N	97	Very high	96.3	Very high	109 Å²	109	50.2 Å²	50.2	58%	0.583	26%	0.26	S	S	*	.			trans	-103.5	126.4	173.2	-57.6	-66	0	0	0	108.5	N59	N51-N59 VanDerWaalsContact CA-OD1 3.3Å; N51-N59 WeakPolarHBondContact CA-OD1 3.49Å
52	A	95.8	Very high	96.3	Very high	29 Å²	29	57.1 Å²	57.1	24%	0.24	29%	0.29	C	S	.	.			trans	-62.2	124	-178.5	0	0	0	0	0	110.5	D54 F57 N59	A52-D54 VanDerWaalsContact C-N 3.34Å; A52-F57 HydrophobicContact CB-CB 3.74Å; A52-F57 VanDerWaalsContact CB-O 3.25Å; A52-F57 WeakPolarHBondContact CB-O 3.37Å; A52-N59 PolarHBondContact N-OD1 3.01Å
53	P	94	Very high	96.2	Very high	95 Å²	95	58 Å²	58	62%	0.617	30%	0.3	S	S	*	.	S	Bend	trans	-73.7	-28.2	177.9	29.3	-35.6	0	0	0	112.5	Y50 F57	Y50-P53 WeakPolarHBondContact OH-CD 3.39Å; P53-F57 HydrophobicContact CG-CD2 3.59Å; P53-F57 HydrophobicContact CG-CE2 3.89Å; P53-F57 HydrophobicContact CG-CG 4.06Å
54	D	93.6	Very high	96.2	Very high	42 Å²	42	60.4 Å²	60.4	23%	0.225	31%	0.31	C	S	.	.	S	Bend	trans	-150	176.8	176	67.4	57.2	0	0	0	110.5	M23 A52 R56 F57	M23-D54 HydrophobicContact CE-CB 4.14Å; M23-D54 WeakPolarHBondContact CE-OD2 3.42Å; A52-D54 VanDerWaalsContact C-N 3.34Å; D54-R56 PolarHBondContact O-N 2.83Å; D54-R56 VanDerWaalsContact OD1-CB 3.22Å; D54-R56 WeakPolarHBondContact OD1-CB 3.41Å; D54-R56 WeakPolarHBondContact OD1-CG 3.43Å; D54-R56 IonicContact OD1-CZ 2.83Å; D54-R56 PolarHBondContact OD1-N 2.85Å; D54-R56 IonicContact OD1-NE 2.99Å; D54-R56 PolarHBondContact OD1-NE 3.38Å; D54-R56 IonicContact OD1-NH2 2.67Å; D54-R56 IonicContact OD2-CZ 3.01Å; D54-R56 IonicContact OD2-NE 3.9Å; D54-R56 PolarHBondContact OD2-NE 2.95Å; D54-R56 IonicContact OD2-NH2 3.01Å; D54-R56 PolarHBondContact OD2-NH2 3.01Å; D54-F57 PolarHBondContact O-N 3.43Å; D54-F57 VanDerWaalsContact O-N 3.12Å; D54-F57 VanDerWaalsContact OD1-CD2 3.25Å; D54-F57 WeakPolarHBondContact OD1-CD2 3.37Å; D54-F57 WeakPolarHBondContact OD2-CE2 3.42Å
55	C	92.8	Very high	96	Very high	85 Å²	85	63.5 Å²	63.5	57%	0.574	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.1	-17.7	-173.9	49.1	0	0	0	0	115.3	F57 C127	C55-F57 PolarHBondContact O-N 3.32Å; C55-C127 VanDerWaalsContact C-SG 3.57Å; C55-C127 HydrophobicContact CB-CB 3.58Å; C55-C127 WeakPolarHBondContact CB-SG 3.41Å; C55-C127 WeakPolarHBondContact SG-CB 3.3Å; C55-C127 CovalentContact SG-SG 2Å; C55-C127 PolarHBondContact SG-SG 3.03Å
56	R	94	Very high	96	Very high	31 Å²	31	58.7 Å²	58.7	12%	0.117	31%	0.307	C	S	.	.	T	Hydrogen-bonded Turn	trans	-72.2	-23.2	176.1	-57.1	173.7	-66.5	176.8	-1.4	111.2	M23 D24 D54 G98 Y99	M23-R56 HydrophobicContact SD-CG 4.06Å; D24-R56 PolarHBondContact O-NH1 3Å; D54-R56 PolarHBondContact O-N 2.83Å; D54-R56 VanDerWaalsContact OD1-CB 3.22Å; D54-R56 WeakPolarHBondContact OD1-CB 3.41Å; D54-R56 WeakPolarHBondContact OD1-CG 3.43Å; D54-R56 IonicContact OD1-CZ 2.83Å; D54-R56 PolarHBondContact OD1-N 2.85Å; D54-R56 IonicContact OD1-NE 2.99Å; D54-R56 PolarHBondContact OD1-NE 3.38Å; D54-R56 IonicContact OD1-NH2 2.67Å; D54-R56 IonicContact OD2-CZ 3.01Å; D54-R56 IonicContact OD2-NE 3.9Å; D54-R56 PolarHBondContact OD2-NE 2.95Å; D54-R56 IonicContact OD2-NH2 3.01Å; D54-R56 PolarHBondContact OD2-NH2 3.01Å; R56-G98 WeakPolarHBondContact O-CA 3.3Å; R56-Y99 HydrophobicContact CB-CD2 4.12Å; R56-Y99 VanDerWaalsContact O-CD2 3.26Å; R56-Y99 WeakPolarHBondContact O-CD2 3.48Å; R56-Y99 PolarHBondContact O-N 3.05Å
57	F	95.6	Very high	95.9	Very high	17 Å²	17	61.7 Å²	61.7	8%	0.075	32%	0.318	C	S	.	.	B	Isolated β-bridge	trans	-100	152.5	-175.4	-60.9	-88.8	0	0	0	111.4	L26 Y50 A52 P53 D54 C55 F81 Y99	L26-F57 HydrophobicContact CD1-CE1 4.17Å; L26-F57 HydrophobicContact CD1-CZ 3.81Å; L26-F57 HydrophobicContact CD2-CZ 4Å; Y50-F57 HydrophobicContact CE1-CB 4.1Å; Y50-F57 HydrophobicContact CE1-CD1 4.32Å; Y50-F57 WeakPolarHBondContact OH-CD1 3.25Å; Y50-F57 WeakPolarHBondContact OH-CG 3.22Å; A52-F57 HydrophobicContact CB-CB 3.74Å; A52-F57 VanDerWaalsContact CB-O 3.25Å; A52-F57 WeakPolarHBondContact CB-O 3.37Å; P53-F57 HydrophobicContact CG-CD2 3.59Å; P53-F57 HydrophobicContact CG-CE2 3.89Å; P53-F57 HydrophobicContact CG-CG 4.06Å; D54-F57 PolarHBondContact O-N 3.43Å; D54-F57 VanDerWaalsContact O-N 3.12Å; D54-F57 VanDerWaalsContact OD1-CD2 3.25Å; D54-F57 WeakPolarHBondContact OD1-CD2 3.37Å; D54-F57 WeakPolarHBondContact OD2-CE2 3.42Å; C55-F57 PolarHBondContact O-N 3.32Å; F57-F81 HydrophobicContact CD1-CD1 4.44Å; F57-F81 HydrophobicContact CD1-CE1 4.45Å; F57-F81 AromaticContact CE1-CD1 3.6Å; F57-F81 HydrophobicContact CE1-CD1 3.6Å; F57-F81 AromaticContact CE1-CE1 3.49Å; F57-F81 HydrophobicContact CE1-CE1 3.49Å; F57-F81 VanDerWaalsContact CE1-CE1 3.49Å; F57-F81 HydrophobicContact CE1-CG 4.27Å; F57-F81 HydrophobicContact CE1-CZ 4.1Å; F57-F81 HydrophobicContact CZ-CD1 4.48Å; F57-F81 HydrophobicContact CZ-CE1 4.13Å; F57-F81 HydrophobicContact CZ-CZ 4.29Å; F57-Y99 WeakPolarHBondContact CA-O 3Å; F57-Y99 WeakPolarHBondContact CB-O 2.89Å; F57-Y99 WeakPolarHBondContact CD1-O 3.26Å
58	I	95.4	Very high	95.8	Very high	14 Å²	14	57.9 Å²	57.9	7%	0.072	30%	0.3	C	S	.	.	P	Polyproline II helix	trans	-103.2	145.5	174.3	50.2	163.4	0	0	0	111.3	Y50 V60 G84 V86 V96 Y99 F100	Y50-I58 VanDerWaalsContact CD1-O 3.25Å; Y50-I58 WeakPolarHBondContact CD1-O 3.36Å; Y50-I58 WeakPolarHBondContact CE1-O 3.37Å; I58-V60 HydrophobicContact CD1-CG2 4.09Å; I58-V60 HydrophobicContact CG1-CG2 4.18Å; I58-G84 WeakPolarHBondContact CD1-O 3.29Å; I58-V86 HydrophobicContact CD1-CG2 4.12Å; I58-V96 HydrophobicContact CG2-CG1 4.33Å; I58-Y99 PolarHBondContact N-O 3.42Å; I58-Y99 VanDerWaalsContact N-O 3.07Å; I58-F100 HydrophobicContact CD1-CD1 3.99Å; I58-F100 HydrophobicContact CG1-CD1 4.2Å
59	N	94.9	Very high	95.8	Very high	96 Å²	96	53.6 Å²	53.6	51%	0.513	28%	0.279	S	S	.	.	P	Polyproline II helix	trans	-72.6	134.7	168.5	-67	-64.3	0	0	0	109.4	Y50 N51 A52	Y50-N59 WeakPolarHBondContact O-CA 3.43Å; N51-N59 VanDerWaalsContact CA-OD1 3.3Å; N51-N59 WeakPolarHBondContact CA-OD1 3.49Å; A52-N59 PolarHBondContact N-OD1 3.01Å
60	V	95.8	Very high	95.8	Very high	4 Å²	4	49.8 Å²	49.8	2%	0.024	26%	0.259	C	S	.	.	B	Isolated β-bridge	trans	-130.4	135.2	179.5	176.5	0	0	0	0	108.7	A46 D49 Y50 I58 I66 V86 F100	A46-V60 HydrophobicContact CB-CG1 3.29Å; D49-V60 CarbonylContact C-O 3.51Å; D49-V60 WeakPolarHBondContact CA-O 3.17Å; Y50-V60 PolarHBondContact N-O 2Å; Y50-V60 PolarHBondContact O-N 2.91Å; I58-V60 HydrophobicContact CD1-CG2 4.09Å; I58-V60 HydrophobicContact CG1-CG2 4.18Å; V60-I66 HydrophobicContact CG1-CD1 3.75Å; V60-I66 HydrophobicContact CG2-CD1 3.92Å; V60-V86 HydrophobicContact CG2-CG2 4.4Å; V60-F100 HydrophobicContact CG2-CB 4.49Å
61	K	96.4	Very high	95.8	Very high	93 Å²	93	49.9 Å²	49.9	40%	0.404	26%	0.26	S	S	.	.			trans	-105.9	143.9	172.3	-64.8	-56.2	-169.6	-174.7	0	110.9	A46 D49 G63 Q64	A46-K61 WeakPolarHBondContact CB-O 3.3Å; D49-K61 HydrophobicContact CB-CD 4.45Å; D49-K61 WeakPolarHBondContact OD1-CA 3.48Å; D49-K61 VanDerWaalsContact OD2-CD 3.25Å; D49-K61 WeakPolarHBondContact OD2-CD 3.14Å; D49-K61 IonicContact OD2-NZ 2.86Å; D49-K61 PolarHBondContact OD2-NZ 2.86Å; K61-G63 PolarHBondContact O-N 2.91Å; K61-Q64 HydrophobicContact CB-CG 4.11Å; K61-Q64 VanDerWaalsContact O-CB 3.29Å; K61-Q64 WeakPolarHBondContact O-CB 3.27Å; K61-Q64 WeakPolarHBondContact O-CG 3.43Å; K61-Q64 PolarHBondContact O-N 2.96Å
62	K	97.6	Very high	95.8	Very high	146 Å²	146	45.3 Å²	45.3	64%	0.635	24%	0.236	S	C	*	.	T	Hydrogen-bonded Turn	trans	-50.2	130.9	176.1	178.1	169.5	-174	162.5	0	110.7	Q47 D49 Q64	Q47-K62 WeakPolarHBondContact O-CD 3.4Å; Q47-K62 WeakPolarHBondContact O-CE 3.49Å; Q47-K62 VanDerWaalsContact O-CG 3.32Å; Q47-K62 WeakPolarHBondContact O-CG 3.41Å; D49-K62 WeakPolarHBondContact OD1-CB 3.17Å; D49-K62 PolarHBondContact OD1-N 2.78Å; K62-Q64 VanDerWaalsContact C-N 3.32Å
63	G	96.1	Very high	95.8	Very high	20 Å²	20	45.9 Å²	45.9	21%	0.206	24%	0.236	C	C	.	.	T	Hydrogen-bonded Turn	trans	86.9	-11.1	179.8	0	0	0	0	0	115.1	R45 A46 K61	R45-G63 PolarHBondContact NE-O 3.44Å; R45-G63 PolarHBondContact NH1-O 3.03Å; R45-G63 PolarHBondContact NH2-O 2.94Å; R45-G63 VanDerWaalsContact NH2-O 3.13Å; A46-G63 PolarHBondContact O-N 2.9Å; K61-G63 PolarHBondContact O-N 2.91Å
64	Q	95.4	Very high	95.7	Very high	67 Å²	67	47 Å²	47	31%	0.313	23%	0.231	S	C	.	.			trans	-63.7	147	171.1	-72.5	-176.5	-46.2	0	0	110.9	R45 A46 K61 K62 V86	R45-Q64 WeakPolarHBondContact CA-O 3.26Å; A46-Q64 PolarHBondContact N-O 3.16Å; K61-Q64 HydrophobicContact CB-CG 4.11Å; K61-Q64 VanDerWaalsContact O-CB 3.29Å; K61-Q64 WeakPolarHBondContact O-CB 3.27Å; K61-Q64 WeakPolarHBondContact O-CG 3.43Å; K61-Q64 PolarHBondContact O-N 2.96Å; K62-Q64 VanDerWaalsContact C-N 3.32Å; Q64-V86 HydrophobicContact CB-CG1 4.08Å; Q64-V86 HydrophobicContact CG-CG1 4.21Å
65	Q	95.2	Very high	95.5	Very high	65 Å²	65	47.5 Å²	47.5	30%	0.304	23%	0.232	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-92.6	145.2	171.9	-72.4	-177.5	-28.6	0	0	109.5	L43 A44 Y87	L43-Q65 HydrophobicContact CD1-CB 3.94Å; A44-Q65 CarbonylContact O-C 3.48Å; A44-Q65 VanDerWaalsContact O-CA 3.3Å; A44-Q65 WeakPolarHBondContact O-CA 3.47Å; Q65-Y87 HydrophobicContact CB-CG 4.5Å; Q65-Y87 WeakPolarHBondContact O-CB 3.41Å; Q65-Y87 PolarHBondContact O-N 3.35Å
66	I	96.4	Very high	94.9	Very high	0 Å²	0	51 Å²	51	0%	0	25%	0.246	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	126.3	-176.5	-57.4	164.2	0	0	0	108.2	L43 A44 A46 V60 S85 V86 F100 V105	L43-I66 WeakPolarHBondContact CA-O 2.91Å; A44-I66 PolarHBondContact N-O 2.85Å; A44-I66 PolarHBondContact O-N 2.78Å; A46-I66 HydrophobicContact CB-CD1 4.5Å; V60-I66 HydrophobicContact CG1-CD1 3.75Å; V60-I66 HydrophobicContact CG2-CD1 3.92Å; I66-S85 CarbonylContact C-O 3.58Å; I66-S85 VanDerWaalsContact CA-O 3.29Å; I66-S85 WeakPolarHBondContact CA-O 3.35Å; I66-S85 WeakPolarHBondContact CG2-O 3.33Å; I66-V86 HydrophobicContact CG1-CG2 4.45Å; I66-F100 HydrophobicContact CD1-CE2 4.41Å; I66-F100 HydrophobicContact CD1-CZ 4.37Å; I66-F100 HydrophobicContact CG2-CD1 4.5Å; I66-F100 HydrophobicContact CG2-CE1 3.63Å; I66-F100 HydrophobicContact CG2-CZ 3.8Å; I66-V105 HydrophobicContact CD1-CG1 3.76Å
67	Y	96.2	Very high	94	Very high	64 Å²	64	58.9 Å²	58.9	25%	0.251	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.6	122.3	166.5	-71.5	-57.3	0	0	0	109.2	T40 L43 G84 S85 Y87 Y111	T40-Y67 HydrophobicContact CG2-CD1 3.76Å; T40-Y67 HydrophobicContact CG2-CG 4.25Å; L43-Y67 HydrophobicContact CD1-CD1 3.72Å; L43-Y67 HydrophobicContact CD1-CE1 3.68Å; L43-Y67 HydrophobicContact CD1-CG 4.41Å; Y67-G84 CarbonylContact O-C 3.49Å; Y67-G84 WeakPolarHBondContact O-CA 3.42Å; Y67-S85 PolarHBondContact N-O 3.49Å; Y67-S85 PolarHBondContact O-N 2.86Å; Y67-Y87 HydrophobicContact CD2-CD2 4.22Å; Y67-Y87 AromaticContact CE2-CD2 3.36Å; Y67-Y87 HydrophobicContact CE2-CD2 3.36Å; Y67-Y87 AromaticContact CE2-CE2 3.78Å; Y67-Y87 HydrophobicContact CE2-CE2 3.78Å; Y67-Y87 AromaticContact CZ-CD2 3.7Å; Y67-Y87 AromaticContact CZ-CE2 3.87Å; Y67-Y87 VanDerWaalsContact OH-CE2 3.27Å; Y67-Y87 WeakPolarHBondContact OH-CE2 3.17Å; Y67-Y111 HydrophobicContact CD1-CE2 4.42Å; Y67-Y111 HydrophobicContact CE1-CE2 4.29Å
68	V	97.7	Very high	93	Very high	0 Å²	0	59.7 Å²	59.7	0%	0	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	125	-179.5	-173.7	0	0	0	0	109	T40 I41 S42 A44 K71 W82 F100	T40-V68 CarbonylContact C-O 3.56Å; T40-V68 WeakPolarHBondContact CG2-O 3.46Å; I41-V68 WeakPolarHBondContact CB-O 3.29Å; I41-V68 PolarHBondContact N-O 2.57Å; S42-V68 PolarHBondContact N-O 2.8Å; S42-V68 PolarHBondContact O-N 2.83Å; A44-V68 HydrophobicContact CB-CG2 4.04Å; V68-K71 HydrophobicContact CG1-CG 4.31Å; V68-W82 HydrophobicContact CG1-CB 4.11Å; V68-W82 HydrophobicContact CG1-CD2 4.38Å; V68-W82 HydrophobicContact CG1-CE3 4.02Å; V68-W82 HydrophobicContact CG1-CG 4.46Å; V68-W82 HydrophobicContact CG2-CE3 4.14Å; V68-F100 HydrophobicContact CG2-CZ 4.2Å
69	Y	96.9	Very high	92.5	Very high	29 Å²	29	60.8 Å²	60.8	11%	0.114	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	-32.9	-178	-57.9	-72.3	0	0	0	113	T40 I41 A83 S85 V97	T40-Y69 WeakPolarHBondContact OG1-CE1 3.49Å; I41-Y69 VanDerWaalsContact CD1-C 3.48Å; I41-Y69 WeakPolarHBondContact CD1-O 3.42Å; Y69-A83 PolarHBondContact N-O 3.22Å; Y69-S85 WeakPolarHBondContact CE2-OG 3.48Å; Y69-S85 PolarHBondContact OH-OG 2.51Å; Y69-S85 VanDerWaalsContact OH-OG 3.13Å; Y69-V97 HydrophobicContact CD2-CG2 4.45Å; Y69-V97 HydrophobicContact CE2-CG2 4.18Å
70	S	97.8	Very high	92.4	Very high	7 Å²	7	61 Å²	61	5%	0.049	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.8	154.1	174	69.6	0	0	0	0	112.4	L31 W82 A83	L31-S70 CarbonylContact O-C 3.54Å; L31-S70 VanDerWaalsContact O-CA 3.29Å; L31-S70 WeakPolarHBondContact O-CA 3.27Å; S70-W82 CarbonylContact O-C 3.58Å; S70-W82 WeakPolarHBondContact O-CA 3.38Å; S70-A83 PolarHBondContact N-O 3.05Å; S70-A83 PolarHBondContact O-N 2.92Å; S70-A83 WeakPolarHBondContact OG-CB 3.44Å
71	K	97.9	Very high	92.5	Very high	34 Å²	34	62.3 Å²	62.3	15%	0.148	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	114.1	176.3	-59.1	-176.2	174.1	179.9	0	107.9	L31 I41 V68 W82 E107 A114	L31-K71 HydrophobicContact CB-CB 4.39Å; L31-K71 PolarHBondContact N-O 3.04Å; L31-K71 PolarHBondContact O-N 3.22Å; I41-K71 HydrophobicContact CD1-CG 4.2Å; V68-K71 HydrophobicContact CG1-CG 4.31Å; K71-W82 HydrophobicContact CB-CG 4.18Å; K71-W82 HydrophobicContact CD-CD2 4.13Å; K71-W82 HydrophobicContact CD-CH2 4.47Å; K71-W82 HydrophobicContact CD-CZ2 3.83Å; K71-W82 HydrophobicContact CG-CD2 3.88Å; K71-W82 HydrophobicContact CG-CG 3.8Å; K71-W82 HydrophobicContact CG-CZ2 4.47Å; K71-E107 VanDerWaalsContact NZ-CD 3.25Å; K71-E107 IonicContact NZ-OE1 3.46Å; K71-E107 PolarHBondContact NZ-OE1 2.97Å; K71-E107 IonicContact NZ-OE2 3.88Å; K71-E107 PolarHBondContact NZ-OE2 3.27Å; K71-A114 HydrophobicContact CD-CB 4.39Å
72	L	97.1	Very high	92.5	Very high	13 Å²	13	59.7 Å²	59.7	7%	0.068	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.7	139.7	179.6	-62.9	-170.6	0	0	0	110.2	L26 A27 K30 K74 F81 Y99 T120 F125	L26-L72 HydrophobicContact CB-CD1 3.58Å; L26-L72 HydrophobicContact CD1-CD1 4.27Å; A27-L72 HydrophobicContact CB-CB 3.89Å; A27-L72 HydrophobicContact CB-CD1 4.06Å; A27-L72 HydrophobicContact CB-CD2 4.4Å; A27-L72 HydrophobicContact CB-CG 4.35Å; K30-L72 HydrophobicContact CB-CD2 3.84Å; L72-K74 PolarHBondContact O-N 3.07Å; L72-F81 VanDerWaalsContact CB-O 3.26Å; L72-F81 WeakPolarHBondContact CB-O 3.39Å; L72-F81 HydrophobicContact CD1-CB 4.1Å; L72-F81 WeakPolarHBondContact CG-O 3.42Å; L72-F81 PolarHBondContact N-O 3.01Å; L72-Y99 HydrophobicContact CD1-CD1 3.97Å; L72-Y99 HydrophobicContact CD1-CE1 3.72Å; L72-Y99 HydrophobicContact CD2-CE1 3.84Å; L72-Y99 HydrophobicContact CG-CD1 4.22Å; L72-Y99 HydrophobicContact CG-CE1 3.83Å; L72-T120 HydrophobicContact CD2-CG2 4.19Å; L72-F125 HydrophobicContact CD1-CE1 4.04Å; L72-F125 HydrophobicContact CD1-CZ 4.45Å
73	V	95.6	Very high	92.5	Very high	41 Å²	41	53 Å²	53	25%	0.248	27%	0.271	C	S	.	.	P	Polyproline II helix	trans	-74.3	123.4	172.2	-179.9	0	0	0	0	107.3	A27 K29 L31 E75	A27-V73 VanDerWaalsContact CB-O 3.3Å; A27-V73 WeakPolarHBondContact CB-O 3.43Å; K29-V73 HydrophobicContact CB-CB 4.14Å; K29-V73 HydrophobicContact CB-CG2 3.91Å; K29-V73 PolarHBondContact O-N 2.84Å; L31-V73 HydrophobicContact CG-CG2 4.07Å; V73-E75 PolarHBondContact O-N 3.07Å
74	K	91.6	Very high	92.5	Very high	118 Å²	118	52 Å²	52	51%	0.513	26%	0.261	S	S	.	.	P	Polyproline II helix	trans	-62.7	127.3	178.9	-172.1	-174.9	-174.6	170.8	0	110.4	L72 A78 E80	L72-K74 PolarHBondContact O-N 3.07Å; K74-A78 WeakPolarHBondContact CE-O 3.21Å; K74-E80 HydrophobicContact CB-CG 4.14Å; K74-E80 HydrophobicContact CD-CG 3.81Å; K74-E80 HydrophobicContact CG-CG 4.15Å; K74-E80 IonicContact NZ-OE1 3.94Å
75	E	88.3	Confident	92.4	Very high	53 Å²	53	49 Å²	49	25%	0.248	25%	0.247	C	C	.	.			trans	-126.1	134.1	176.4	-71.9	170.7	-163.5	0	0	110.2	S28 K29 V73 E77 A78	S28-E75 WeakPolarHBondContact CA-OE1 3.14Å; S28-E75 VanDerWaalsContact CB-OE1 3.24Å; S28-E75 WeakPolarHBondContact CB-OE1 3.17Å; S28-E75 WeakPolarHBondContact CB-OE2 3.2Å; S28-E75 PolarHBondContact N-OE1 2.74Å; S28-E75 PolarHBondContact N-OE2 3.27Å; S28-E75 VanDerWaalsContact OG-CD 3.28Å; S28-E75 PolarHBondContact OG-OE1 3.01Å; S28-E75 PolarHBondContact OG-OE2 3.27Å; K29-E75 PolarHBondContact N-OE1 2.99Å; V73-E75 PolarHBondContact O-N 3.07Å; E75-E77 PolarHBondContact O-N 3.47Å; E75-A78 WeakPolarHBondContact O-CB 3.11Å; E75-A78 PolarHBondContact O-N 2.99Å; E75-A78 VanDerWaalsContact O-N 3.1Å
76	N	80.3	Confident	92.4	Very high	160 Å²	160	47.1 Å²	47.1	86%	0.856	24%	0.24	S	C	*	.	T	Hydrogen-bonded Turn	trans	54	-135.5	179.8	-51.3	-49.7	0	0	0	112.5	A78	N76-A78 VanDerWaalsContact C-N 3.3Å
77	E	76.4	Confident	91.9	Very high	196 Å²	196	51.7 Å²	51.7	92%	0.916	26%	0.258	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.4	6.9	176.5	-60	-177	171	0	0	112.8	E75	E75-E77 PolarHBondContact O-N 3.47Å
78	A	75	Confident	90.9	Very high	34 Å²	34	50.1 Å²	50.1	28%	0.281	26%	0.261	S	S	.	.			trans	-63.7	144.7	177.3	0	0	0	0	0	110.7	K74 E75 N76	K74-A78 WeakPolarHBondContact CE-O 3.21Å; E75-A78 WeakPolarHBondContact O-CB 3.11Å; E75-A78 PolarHBondContact O-N 2.99Å; E75-A78 VanDerWaalsContact O-N 3.1Å; N76-A78 VanDerWaalsContact C-N 3.3Å
79	G	83.7	Confident	89.3	Confident	36 Å²	36	58.5 Å²	58.5	37%	0.371	31%	0.306	S	S	.	.			trans	-62.7	160.6	174.7	0	0	0	0	0	112.3	F81	G79-F81 WeakPolarHBondContact O-CD2 3.38Å; G79-F81 WeakPolarHBondContact O-CE2 3.29Å; G79-F81 PolarHBondContact O-N 2.83Å
80	E	93.1	Very high	87.4	Confident	100 Å²	100	59.2 Å²	59.2	47%	0.467	32%	0.322	S	S	.	.			trans	-84.3	108.5	171.7	-69.3	178.1	-175.8	0	0	109.2	K74 P101 S102	K74-E80 HydrophobicContact CB-CG 4.14Å; K74-E80 HydrophobicContact CD-CG 3.81Å; K74-E80 HydrophobicContact CG-CG 4.15Å; K74-E80 IonicContact NZ-OE1 3.94Å; E80-P101 WeakPolarHBondContact O-CA 3.17Å; E80-S102 WeakPolarHBondContact CB-OG 3.42Å; E80-S102 PolarHBondContact O-N 3.31Å; E80-S102 PolarHBondContact O-OG 2.69Å
81	F	97.1	Very high	85.2	Confident	33 Å²	33	67.3 Å²	67.3	15%	0.145	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	138.9	-177.5	-59.9	-74.8	0	0	0	111.5	F57 L72 G79 Y99 F100 P101	F57-F81 HydrophobicContact CD1-CD1 4.44Å; F57-F81 HydrophobicContact CD1-CE1 4.45Å; F57-F81 AromaticContact CE1-CD1 3.6Å; F57-F81 HydrophobicContact CE1-CD1 3.6Å; F57-F81 AromaticContact CE1-CE1 3.49Å; F57-F81 HydrophobicContact CE1-CE1 3.49Å; F57-F81 VanDerWaalsContact CE1-CE1 3.49Å; F57-F81 HydrophobicContact CE1-CG 4.27Å; F57-F81 HydrophobicContact CE1-CZ 4.1Å; F57-F81 HydrophobicContact CZ-CD1 4.48Å; F57-F81 HydrophobicContact CZ-CE1 4.13Å; F57-F81 HydrophobicContact CZ-CZ 4.29Å; L72-F81 VanDerWaalsContact CB-O 3.26Å; L72-F81 WeakPolarHBondContact CB-O 3.39Å; L72-F81 HydrophobicContact CD1-CB 4.1Å; L72-F81 WeakPolarHBondContact CG-O 3.42Å; L72-F81 PolarHBondContact N-O 3.01Å; G79-F81 WeakPolarHBondContact O-CD2 3.38Å; G79-F81 WeakPolarHBondContact O-CE2 3.29Å; G79-F81 PolarHBondContact O-N 2.83Å; F81-Y99 HydrophobicContact CB-CD1 4.41Å; F81-F100 WeakPolarHBondContact CA-O 3.24Å; F81-P101 HydrophobicContact CD1-CG 4.27Å; F81-P101 HydrophobicContact CE1-CB 4.5Å; F81-P101 HydrophobicContact CE1-CG 4.01Å
82	W	97.9	Very high	83.1	Confident	37 Å²	37	73.3 Å²	73.3	14%	0.14	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	152.1	171	-61.8	-8.2	0	0	0	109.4	V68 S70 K71 Y99 F100 V105 E107	V68-W82 HydrophobicContact CG1-CB 4.11Å; V68-W82 HydrophobicContact CG1-CD2 4.38Å; V68-W82 HydrophobicContact CG1-CE3 4.02Å; V68-W82 HydrophobicContact CG1-CG 4.46Å; V68-W82 HydrophobicContact CG2-CE3 4.14Å; S70-W82 CarbonylContact O-C 3.58Å; S70-W82 WeakPolarHBondContact O-CA 3.38Å; K71-W82 HydrophobicContact CB-CG 4.18Å; K71-W82 HydrophobicContact CD-CD2 4.13Å; K71-W82 HydrophobicContact CD-CH2 4.47Å; K71-W82 HydrophobicContact CD-CZ2 3.83Å; K71-W82 HydrophobicContact CG-CD2 3.88Å; K71-W82 HydrophobicContact CG-CG 3.8Å; K71-W82 HydrophobicContact CG-CZ2 4.47Å; W82-Y99 CarbonylContact O-C 3.6Å; W82-Y99 VanDerWaalsContact O-CA 3.27Å; W82-Y99 WeakPolarHBondContact O-CA 3.35Å; W82-F100 HydrophobicContact CB-CE1 4.42Å; W82-F100 HydrophobicContact CB-CE2 4.15Å; W82-F100 HydrophobicContact CB-CZ 3.92Å; W82-F100 HydrophobicContact CE3-CE2 4.34Å; W82-F100 HydrophobicContact CE3-CZ 4.49Å; W82-F100 PolarHBondContact N-O 3.5Å; W82-F100 PolarHBondContact O-N 2.78Å; W82-V105 HydrophobicContact CE3-CG2 4.09Å; W82-V105 HydrophobicContact CZ3-CG2 3.87Å; W82-E107 HydrophobicContact CH2-CG 3.92Å; W82-E107 VanDerWaalsContact CH2-OE2 3.3Å; W82-E107 WeakPolarHBondContact CH2-OE2 3.07Å; W82-E107 HydrophobicContact CZ3-CG 3.73Å
83	A	97.1	Very high	81.1	Confident	6 Å²	6	80.5 Å²	80.5	5%	0.05	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	134.7	173.6	0	0	0	0	0	110.3	Y69 S70 G98 Y99	Y69-A83 PolarHBondContact N-O 3.22Å; S70-A83 PolarHBondContact N-O 3.05Å; S70-A83 PolarHBondContact O-N 2.92Å; S70-A83 WeakPolarHBondContact OG-CB 3.44Å; A83-G98 WeakPolarHBondContact CA-O 3.48Å; A83-Y99 HydrophobicContact CB-CD1 3.9Å; A83-Y99 HydrophobicContact CB-CE1 3.73Å
84	G	95.7	Very high	79.5	Confident	0 Å²	0	85.5 Å²	85.5	0%	0	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-164	175.5	-179.6	0	0	0	0	0	113.3	I58 Y67 V97 G98	I58-G84 WeakPolarHBondContact CD1-O 3.29Å; Y67-G84 CarbonylContact O-C 3.49Å; Y67-G84 WeakPolarHBondContact O-CA 3.42Å; G84-V97 WeakPolarHBondContact O-CA 3.39Å; G84-G98 PolarHBondContact N-O 2.91Å; G84-G98 PolarHBondContact O-N 2.85Å
85	S	94.6	Very high	78.9	Confident	3 Å²	3	81.1 Å²	81.1	2%	0.021	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	139.8	173.5	61.1	0	0	0	0	110	I66 Y67 Y69 G95	I66-S85 CarbonylContact C-O 3.58Å; I66-S85 VanDerWaalsContact CA-O 3.29Å; I66-S85 WeakPolarHBondContact CA-O 3.35Å; I66-S85 WeakPolarHBondContact CG2-O 3.33Å; Y67-S85 PolarHBondContact N-O 3.49Å; Y67-S85 PolarHBondContact O-N 2.86Å; Y69-S85 WeakPolarHBondContact CE2-OG 3.48Å; Y69-S85 PolarHBondContact OH-OG 2.51Å; Y69-S85 VanDerWaalsContact OH-OG 3.13Å; S85-G95 VanDerWaalsContact CB-O 3.29Å; S85-G95 WeakPolarHBondContact CB-O 3.47Å
86	V	94.1	Very high	78.9	Confident	26 Å²	26	84.4 Å²	84.4	16%	0.158	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.9	132.8	172.5	176.8	0	0	0	0	108.9	I58 V60 Q64 I66 G88	I58-V86 HydrophobicContact CD1-CG2 4.12Å; V60-V86 HydrophobicContact CG2-CG2 4.4Å; Q64-V86 HydrophobicContact CB-CG1 4.08Å; Q64-V86 HydrophobicContact CG-CG1 4.21Å; I66-V86 HydrophobicContact CG1-CG2 4.45Å; V86-G88 PolarHBondContact O-N 3.47Å; V86-G88 VanDerWaalsContact O-N 3.16Å
87	Y	85.2	Confident	79.5	Confident	96 Å²	96	80.3 Å²	80.3	38%	0.376	44%	0.441	S	S	.	.			trans	-62.1	113.1	171.7	-168.9	-94.2	0	0	0	109.4	Q65 Y67	Q65-Y87 HydrophobicContact CB-CG 4.5Å; Q65-Y87 WeakPolarHBondContact O-CB 3.41Å; Q65-Y87 PolarHBondContact O-N 3.35Å; Y67-Y87 HydrophobicContact CD2-CD2 4.22Å; Y67-Y87 AromaticContact CE2-CD2 3.36Å; Y67-Y87 HydrophobicContact CE2-CD2 3.36Å; Y67-Y87 AromaticContact CE2-CE2 3.78Å; Y67-Y87 HydrophobicContact CE2-CE2 3.78Å; Y67-Y87 AromaticContact CZ-CD2 3.7Å; Y67-Y87 AromaticContact CZ-CE2 3.87Å; Y67-Y87 VanDerWaalsContact OH-CE2 3.27Å; Y67-Y87 WeakPolarHBondContact OH-CE2 3.17Å
88	G	76.1	Confident	80.4	Confident	31 Å²	31	71.3 Å²	71.3	32%	0.32	40%	0.4	S	S	.	.			trans	-80.2	154.2	175	0	0	0	0	0	112.2	V86 G90	V86-G88 PolarHBondContact O-N 3.47Å; V86-G88 VanDerWaalsContact O-N 3.16Å; G88-G90 PolarHBondContact O-N 2.88Å
89	D	63.3	Low	81.4	Confident	176 Å²	176	70.2 Å²	70.2	94%	0.941	39%	0.389	S	S	*	.	S	Bend	trans	-73.1	-9.2	173.8	-76.8	-26.9	0	0	0	112.8
90	G	58.5	Low	82.1	Confident	44 Å²	44	68.6 Å²	68.6	45%	0.454	37%	0.372	S	S	.	.	S	Bend	trans	-98.4	122.3	170.9	0	0	0	0	0	110.7	G88 D92 E93	G88-G90 PolarHBondContact O-N 2.88Å; G90-D92 PolarHBondContact O-N 3.13Å; G90-E93 PolarHBondContact O-N 3.01Å
91	Q	50.2	Low	82.3	Confident	177 Å²	177	64.8 Å²	64.8	83%	0.827	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.9	-10.1	-173.5	-65.9	179.1	2.4	0	0	114.6
92	D	53.8	Low	82.3	Confident	159 Å²	159	63.8 Å²	63.8	85%	0.85	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	-119.4	0.4	-170.8	-62.4	-36.5	0	0	0	114.7	G90	G90-D92 PolarHBondContact O-N 3.13Å
93	E	56.4	Low	82.2	Confident	164 Å²	164	68 Å²	68	77%	0.766	38%	0.379	S	S	*	.			trans	-107.9	104.2	177.4	-70.3	-171.3	175.8	0	0	110.6	G90 G95	G90-E93 PolarHBondContact O-N 3.01Å; E93-G95 PolarHBondContact O-N 2.67Å
94	M	62.4	Low	82.2	Confident	147 Å²	147	68.9 Å²	68.9	72%	0.724	38%	0.382	S	S	*	.			trans	-65.5	107.7	168.1	-162	153.2	125.8	0	0	107.4
95	G	77.6	Confident	82.3	Confident	26 Å²	26	69.8 Å²	69.8	27%	0.268	39%	0.387	S	S	.	.	P	Polyproline II helix	trans	-57.3	157.9	179.9	0	0	0	0	0	111.7	S85 E93 V97	S85-G95 VanDerWaalsContact CB-O 3.29Å; S85-G95 WeakPolarHBondContact CB-O 3.47Å; E93-G95 PolarHBondContact O-N 2.67Å; G95-V97 PolarHBondContact O-N 2.83Å
96	V	88.3	Confident	82.4	Confident	121 Å²	121	75.8 Å²	75.8	73%	0.733	41%	0.413	S	S	*	.	P	Polyproline II helix	trans	-50.2	127.6	176.4	179.9	0	0	0	0	109.5	I58	I58-V96 HydrophobicContact CG2-CG1 4.33Å
97	V	92.9	Very high	82.6	Confident	75 Å²	75	77.7 Å²	77.7	46%	0.455	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.1	133.5	175.1	177.9	0	0	0	0	108.4	Y69 G84 G95	Y69-V97 HydrophobicContact CD2-CG2 4.45Å; Y69-V97 HydrophobicContact CE2-CG2 4.18Å; G84-V97 WeakPolarHBondContact O-CA 3.39Å; G95-V97 PolarHBondContact O-N 2.83Å
98	G	95.3	Very high	83.2	Confident	6 Å²	6	78 Å²	78	6%	0.062	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-167	-176.2	168.4	0	0	0	0	0	112.1	R56 A83 G84	R56-G98 WeakPolarHBondContact O-CA 3.3Å; A83-G98 WeakPolarHBondContact CA-O 3.48Å; G84-G98 PolarHBondContact N-O 2.91Å; G84-G98 PolarHBondContact O-N 2.85Å
99	Y	96.9	Very high	84.2	Confident	12 Å²	12	84 Å²	84	5%	0.047	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.5	152	-174.2	-61.2	-77.7	0	0	0	112.7	L26 R56 F57 I58 L72 F81 W82 A83 D124 F125	L26-Y99 HydrophobicContact CD1-CD1 4.36Å; L26-Y99 HydrophobicContact CD1-CD2 3.7Å; L26-Y99 HydrophobicContact CD1-CE2 4.16Å; L26-Y99 HydrophobicContact CD1-CG 3.83Å; R56-Y99 HydrophobicContact CB-CD2 4.12Å; R56-Y99 VanDerWaalsContact O-CD2 3.26Å; R56-Y99 WeakPolarHBondContact O-CD2 3.48Å; R56-Y99 PolarHBondContact O-N 3.05Å; F57-Y99 WeakPolarHBondContact CA-O 3Å; F57-Y99 WeakPolarHBondContact CB-O 2.89Å; F57-Y99 WeakPolarHBondContact CD1-O 3.26Å; I58-Y99 PolarHBondContact N-O 3.42Å; I58-Y99 VanDerWaalsContact N-O 3.07Å; L72-Y99 HydrophobicContact CD1-CD1 3.97Å; L72-Y99 HydrophobicContact CD1-CE1 3.72Å; L72-Y99 HydrophobicContact CD2-CE1 3.84Å; L72-Y99 HydrophobicContact CG-CD1 4.22Å; L72-Y99 HydrophobicContact CG-CE1 3.83Å; F81-Y99 HydrophobicContact CB-CD1 4.41Å; W82-Y99 CarbonylContact O-C 3.6Å; W82-Y99 VanDerWaalsContact O-CA 3.27Å; W82-Y99 WeakPolarHBondContact O-CA 3.35Å; A83-Y99 HydrophobicContact CB-CD1 3.9Å; A83-Y99 HydrophobicContact CB-CE1 3.73Å; Y99-D124 WeakPolarHBondContact CE2-O 3.18Å; Y99-D124 PolarHBondContact OH-O 2.87Å; Y99-F125 HydrophobicContact CE1-CE1 4.32Å; Y99-F125 AromaticContact CE2-CD1 3.64Å; Y99-F125 HydrophobicContact CE2-CD1 3.64Å; Y99-F125 AromaticContact CE2-CE1 3.9Å; Y99-F125 HydrophobicContact CE2-CE1 3.9Å; Y99-F125 AromaticContact CZ-CD1 3.83Å; Y99-F125 AromaticContact CZ-CE1 3.62Å; Y99-F125 WeakPolarHBondContact OH-CE1 3.35Å
100	F	97.4	Very high	85.9	Confident	2 Å²	2	78.6 Å²	78.6	1%	0.009	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.7	153.9	168.2	58.4	-85.7	0	0	0	109.9	Y50 I58 V60 I66 V68 F81 W82 S102 V105	Y50-F100 HydrophobicContact CD1-CB 4.19Å; Y50-F100 HydrophobicContact CE1-CB 4.2Å; I58-F100 HydrophobicContact CD1-CD1 3.99Å; I58-F100 HydrophobicContact CG1-CD1 4.2Å; V60-F100 HydrophobicContact CG2-CB 4.49Å; I66-F100 HydrophobicContact CD1-CE2 4.41Å; I66-F100 HydrophobicContact CD1-CZ 4.37Å; I66-F100 HydrophobicContact CG2-CD1 4.5Å; I66-F100 HydrophobicContact CG2-CE1 3.63Å; I66-F100 HydrophobicContact CG2-CZ 3.8Å; V68-F100 HydrophobicContact CG2-CZ 4.2Å; F81-F100 WeakPolarHBondContact CA-O 3.24Å; W82-F100 HydrophobicContact CB-CE1 4.42Å; W82-F100 HydrophobicContact CB-CE2 4.15Å; W82-F100 HydrophobicContact CB-CZ 3.92Å; W82-F100 HydrophobicContact CE3-CE2 4.34Å; W82-F100 HydrophobicContact CE3-CZ 4.49Å; W82-F100 PolarHBondContact N-O 3.5Å; W82-F100 PolarHBondContact O-N 2.78Å; F100-S102 PolarHBondContact O-N 3.22Å; F100-V105 HydrophobicContact CD2-CG1 3.81Å; F100-V105 HydrophobicContact CE2-CB 4.34Å; F100-V105 HydrophobicContact CE2-CG1 3.57Å; F100-V105 HydrophobicContact CE2-CG2 3.78Å
101	P	97.3	Very high	87.7	Confident	19 Å²	19	81 Å²	81	12%	0.123	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.1	129.9	176.2	-19.3	29.6	0	0	0	112	Y50 E80 F81 N103 L104	Y50-P101 HydrophobicContact CD2-CG 4.28Å; Y50-P101 HydrophobicContact CE2-CG 3.82Å; E80-P101 WeakPolarHBondContact O-CA 3.17Å; F81-P101 HydrophobicContact CD1-CG 4.27Å; F81-P101 HydrophobicContact CE1-CB 4.5Å; F81-P101 HydrophobicContact CE1-CG 4.01Å; P101-N103 WeakPolarHBondContact CB-OD1 3.46Å; P101-N103 PolarHBondContact O-N 3.38Å; P101-L104 HydrophobicContact CB-CD1 4.07Å; P101-L104 HydrophobicContact CB-CG 4.06Å; P101-L104 HydrophobicContact CG-CD1 3.81Å; P101-L104 HydrophobicContact CG-CG 4.36Å; P101-L104 PolarHBondContact O-N 3.1Å
102	S	96.8	Very high	89.9	Confident	13 Å²	13	76.4 Å²	76.4	9%	0.091	39%	0.386	C	S	.	.	G	3₁₀ helix	trans	-59.7	-32.7	-177.2	63.1	0	0	0	0	113	E80 F100 L104 V105	E80-S102 WeakPolarHBondContact CB-OG 3.42Å; E80-S102 PolarHBondContact O-N 3.31Å; E80-S102 PolarHBondContact O-OG 2.69Å; F100-S102 PolarHBondContact O-N 3.22Å; S102-L104 PolarHBondContact O-N 2.8Å; S102-V105 WeakPolarHBondContact O-CG2 3.36Å; S102-V105 PolarHBondContact O-N 2.95Å
103	N	96.2	Very high	91.8	Very high	126 Å²	126	75.2 Å²	75.2	67%	0.674	38%	0.375	S	S	*	.	G	3₁₀ helix	trans	-69.9	-13	-178.1	69.3	-46.4	0	0	0	114	P101 V105	P101-N103 WeakPolarHBondContact CB-OD1 3.46Å; P101-N103 PolarHBondContact O-N 3.38Å; N103-V105 VanDerWaalsContact C-N 3.31Å
104	L	96.7	Very high	93.7	Very high	24 Å²	24	68.3 Å²	68.3	13%	0.126	35%	0.346	C	S	.	.	G	3₁₀ helix	trans	-85.8	-5.7	178.8	-60.6	-178.4	0	0	0	113.1	Q47 E48 Y50 P101 S102	Q47-L104 PolarHBondContact N-O 3.15Å; E48-L104 HydrophobicContact CB-CD2 4.45Å; Y50-L104 HydrophobicContact CD2-CD1 3.52Å; Y50-L104 HydrophobicContact CE2-CD1 4.37Å; Y50-L104 HydrophobicContact CG-CD1 3.74Å; P101-L104 HydrophobicContact CB-CD1 4.07Å; P101-L104 HydrophobicContact CB-CG 4.06Å; P101-L104 HydrophobicContact CG-CD1 3.81Å; P101-L104 HydrophobicContact CG-CG 4.36Å; P101-L104 PolarHBondContact O-N 3.1Å; S102-L104 PolarHBondContact O-N 2.8Å
105	V	97.6	Very high	95.3	Very high	18 Å²	18	66.2 Å²	66.2	11%	0.109	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	156.7	-176.4	-53.1	0	0	0	0	111.7	A44 R45 I66 W82 F100 S102 N103	A44-V105 HydrophobicContact CB-CB 3.89Å; A44-V105 HydrophobicContact CB-CG2 3.79Å; R45-V105 WeakPolarHBondContact O-CA 3.35Å; I66-V105 HydrophobicContact CD1-CG1 3.76Å; W82-V105 HydrophobicContact CE3-CG2 4.09Å; W82-V105 HydrophobicContact CZ3-CG2 3.87Å; F100-V105 HydrophobicContact CD2-CG1 3.81Å; F100-V105 HydrophobicContact CE2-CB 4.34Å; F100-V105 HydrophobicContact CE2-CG1 3.57Å; F100-V105 HydrophobicContact CE2-CG2 3.78Å; S102-V105 WeakPolarHBondContact O-CG2 3.36Å; S102-V105 PolarHBondContact O-N 2.95Å; N103-V105 VanDerWaalsContact C-N 3.31Å
106	K	98.3	Very high	96.3	Very high	130 Å²	130	69 Å²	69	57%	0.565	35%	0.346	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119	116.6	169.3	-176.3	176.6	179.5	177.4	0	109.1	A44 R45 Q47 Q108	A44-K106 WeakPolarHBondContact CA-O 3.22Å; R45-K106 PolarHBondContact N-O 2.87Å; R45-K106 PolarHBondContact O-N 3.15Å; Q47-K106 HydrophobicContact CG-CB 4.12Å; K106-Q108 PolarHBondContact O-N 2.93Å; K106-Q108 PolarHBondContact O-NE2 3.04Å
107	E	97.6	Very high	96.7	Very high	65 Å²	65	68.4 Å²	68.4	30%	0.304	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.9	124.3	172.5	-68.9	-174.4	100.5	0	0	109.7	S42 A44 K71 W82	S42-E107 WeakPolarHBondContact CB-OE1 3.36Å; S42-E107 PolarHBondContact OG-OE1 3.26Å; A44-E107 HydrophobicContact CB-CG 4.41Å; K71-E107 VanDerWaalsContact NZ-CD 3.25Å; K71-E107 IonicContact NZ-OE1 3.46Å; K71-E107 PolarHBondContact NZ-OE1 2.97Å; K71-E107 IonicContact NZ-OE2 3.88Å; K71-E107 PolarHBondContact NZ-OE2 3.27Å; W82-E107 HydrophobicContact CH2-CG 3.92Å; W82-E107 VanDerWaalsContact CH2-OE2 3.3Å; W82-E107 WeakPolarHBondContact CH2-OE2 3.07Å; W82-E107 HydrophobicContact CZ3-CG 3.73Å
108	Q	97.7	Very high	96.9	Very high	102 Å²	102	66.1 Å²	66.1	48%	0.477	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	-39.4	178	-58.8	-60.1	-68	0	0	110.8	L43 R45 K106	L43-Q108 PolarHBondContact O-N 2.86Å; R45-Q108 HydrophobicContact CB-CG 3.76Å; K106-Q108 PolarHBondContact O-N 2.93Å; K106-Q108 PolarHBondContact O-NE2 3.04Å
109	R	97.3	Very high	97	Very high	158 Å²	158	70.2 Å²	70.2	60%	0.596	35%	0.348	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-148.5	127.2	-178.8	-177.7	173	-177.3	179.7	0.7	109.9	S42 L43 Y111	S42-R109 CarbonylContact C-O 3.59Å; S42-R109 WeakPolarHBondContact CA-O 3.44Å; S42-R109 WeakPolarHBondContact CB-O 3.17Å; L43-R109 PolarHBondContact N-O 2.98Å; L43-R109 PolarHBondContact O-N 2.83Å; R109-Y111 HydrophobicContact CG-CD1 4.33Å; R109-Y111 HydrophobicContact CG-CE1 4.1Å
110	V	97.9	Very high	96.9	Very high	63 Å²	63	69.9 Å²	69.9	38%	0.382	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.1	126.6	168.2	-176.3	0	0	0	0	107.6	Q112	V110-Q112 WeakPolarHBondContact CG1-O 3.05Å
111	Y	96.7	Very high	96.8	Very high	93 Å²	93	72.7 Å²	72.7	37%	0.365	36%	0.364	S	S	.	.	S	Bend	trans	-92.6	-42.9	175.4	-60.5	-71.8	0	0	0	110.5	T40 I41 L43 Y67 R109	T40-Y111 HydrophobicContact CG2-CD2 3.9Å; T40-Y111 HydrophobicContact CG2-CE2 4.14Å; I41-Y111 PolarHBondContact O-N 2.68Å; L43-Y111 HydrophobicContact CB-CE2 3.85Å; Y67-Y111 HydrophobicContact CD1-CE2 4.42Å; Y67-Y111 HydrophobicContact CE1-CE2 4.29Å; R109-Y111 HydrophobicContact CG-CD1 4.33Å; R109-Y111 HydrophobicContact CG-CE1 4.1Å
112	Q	96.3	Very high	96.4	Very high	81 Å²	81	75.1 Å²	75.1	38%	0.379	38%	0.376	S	S	.	.	S	Bend	trans	-144.7	143.7	179.6	-64.5	-171.2	62.8	0	0	109.8	A33 I41 V110	A33-Q112 HydrophobicContact CB-CB 3.81Å; I41-Q112 WeakPolarHBondContact CG2-O 3.49Å; I41-Q112 PolarHBondContact O-N 3.35Å; I41-Q112 VanDerWaalsContact O-N 3.1Å; I41-Q112 VanDerWaalsContact O-O 3.1Å; V110-Q112 WeakPolarHBondContact CG1-O 3.05Å
113	E	95.2	Very high	96.1	Very high	135 Å²	135	81.2 Å²	81.2	63%	0.631	41%	0.406	S	S	*	.			trans	-76.5	136.1	178.2	-65.2	-62	151.8	0	0	111	T115	E113-T115 VanDerWaalsContact C-N 3.3Å; E113-T115 HydrophobicContact CB-CG2 3.89Å; E113-T115 PolarHBondContact O-N 3.35Å
114	A	96.1	Very high	95.9	Very high	18 Å²	18	76.9 Å²	76.9	15%	0.149	38%	0.383	C	S	.	.			trans	-80.6	74.7	-179.9	0	0	0	0	0	111.1	L31 C32 I41 K71	L31-A114 HydrophobicContact CB-CB 3.95Å; C32-A114 CarbonylContact O-C 3.44Å; C32-A114 WeakPolarHBondContact O-CA 3.4Å; I41-A114 HydrophobicContact CD1-CB 3.64Å; I41-A114 HydrophobicContact CG1-CB 4.02Å; I41-A114 HydrophobicContact CG2-CB 3.97Å; K71-A114 HydrophobicContact CD-CB 4.39Å
115	T	95.9	Very high	95.7	Very high	103 Å²	103	76.1 Å²	76.1	63%	0.632	38%	0.379	S	S	*	.			trans	-101.5	-14	-173.4	57.9	0	0	0	0	113.8	C32 E113 E117	C32-T115 PolarHBondContact O-N 3.15Å; E113-T115 VanDerWaalsContact C-N 3.3Å; E113-T115 HydrophobicContact CB-CG2 3.89Å; E113-T115 PolarHBondContact O-N 3.35Å; T115-E117 PolarHBondContact O-N 2.89Å
116	K	97.6	Very high	95.3	Very high	84 Å²	84	82.2 Å²	82.2	37%	0.365	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	110.1	-178.1	-58.7	-58.4	-171.4	156.5	0	109.9	L31 C32 D35	L31-K116 CarbonylContact C-O 3.6Å; L31-K116 WeakPolarHBondContact CA-O 3.35Å; C32-K116 PolarHBondContact N-O 3.48Å; C32-K116 WeakPolarHBondContact O-CB 3.04Å; C32-K116 PolarHBondContact O-N 3.1Å; D35-K116 IonicContact OD1-NZ 3.96Å
117	E	97.8	Very high	94.7	Very high	109 Å²	109	77.7 Å²	77.7	51%	0.509	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.9	118.7	172.7	-172.9	178	107.4	0	0	109.7	K29 K30 L31 T115	K29-E117 HydrophobicContact CB-CG 4.25Å; K29-E117 VanDerWaalsContact CD-CD 3.46Å; K29-E117 HydrophobicContact CD-CG 3.8Å; K29-E117 WeakPolarHBondContact CD-OE1 3.3Å; K29-E117 WeakPolarHBondContact CE-OE1 3.25Å; K29-E117 IonicContact NZ-OE1 2.74Å; K29-E117 PolarHBondContact NZ-OE1 3.07Å; K30-E117 WeakPolarHBondContact O-CA 3.11Å; L31-E117 HydrophobicContact CD2-CB 4.05Å; T115-E117 PolarHBondContact O-N 2.89Å
118	V	97.1	Very high	93.4	Very high	27 Å²	27	86.8 Å²	86.8	16%	0.164	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	137.9	-176.8	-174.8	0	0	0	0	109.1	K29 K30	K29-V118 WeakPolarHBondContact CA-O 3.32Å; K30-V118 HydrophobicContact CG-CB 4.3Å; K30-V118 PolarHBondContact N-O 3.12Å; K30-V118 PolarHBondContact O-N 3.21Å
119	P	96.9	Very high	93.2	Very high	93 Å²	93	86.1 Å²	86.1	60%	0.604	43%	0.428	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-62.4	138.8	172.3	-20.3	32.5	0	0	0	111.5
120	T	95.3	Very high	92.9	Very high	4 Å²	4	82.3 Å²	82.3	3%	0.025	42%	0.42	C	S	.	.			trans	-76.1	150.9	168.4	60.4	0	0	0	0	110.6	R25 A27 S28 K30 L72 D124 F125	R25-T120 PolarHBondContact NH1-O 2.73Å; R25-T120 VanDerWaalsContact NH1-O 3.1Å; A27-T120 PolarHBondContact O-OG1 3.43Å; S28-T120 WeakPolarHBondContact CA-OG1 3.03Å; S28-T120 PolarHBondContact O-N 2.89Å; S28-T120 PolarHBondContact O-OG1 2.68Å; K30-T120 HydrophobicContact CB-CG2 4.18Å; K30-T120 HydrophobicContact CD-CG2 4.35Å; K30-T120 HydrophobicContact CG-CG2 4.18Å; L72-T120 HydrophobicContact CD2-CG2 4.19Å; T120-D124 WeakPolarHBondContact CA-OD2 3.44Å; T120-F125 HydrophobicContact CG2-CE2 4.16Å; T120-F125 HydrophobicContact CG2-CZ 3.88Å
121	T	94	Very high	92.7	Very high	61 Å²	61	83.3 Å²	83.3	37%	0.374	42%	0.422	S	S	.	.			trans	-119.8	170.3	179.3	60.7	0	0	0	0	109.9	I123 D124	T121-I123 PolarHBondContact O-N 3.5Å; T121-I123 WeakPolarHBondContact OG1-CG1 3.41Å; T121-D124 PolarHBondContact N-OD2 3.2Å; T121-D124 WeakPolarHBondContact O-CB 3.38Å; T121-D124 PolarHBondContact O-N 3.21Å; T121-D124 VanDerWaalsContact O-N 3.15Å; T121-D124 PolarHBondContact OG1-OD2 3.05Å
122	D	90.3	Very high	92.4	Very high	71 Å²	71	82.8 Å²	82.8	38%	0.38	43%	0.425	S	S	.	.	G	3₁₀ helix	trans	-68.2	-28.1	-177.7	-57.2	-41.5	0	0	0	112.5	F22 R25 D124 F125 F126	F22-D122 HydrophobicContact CE2-CB 3.98Å; F22-D122 HydrophobicContact CZ-CB 3.66Å; F22-D122 WeakPolarHBondContact CZ-OD1 3.49Å; R25-D122 IonicContact CZ-OD1 3.24Å; R25-D122 VanDerWaalsContact CZ-OD1 3.24Å; R25-D122 IonicContact NE-OD1 3.34Å; R25-D122 PolarHBondContact NE-OD1 3.34Å; R25-D122 IonicContact NH2-OD1 2.68Å; R25-D122 PolarHBondContact NH2-OD1 2.02Å; R25-D122 IonicContact NH2-OD2 3.58Å; D122-D124 PolarHBondContact O-N 3.01Å; D122-F125 PolarHBondContact O-N 3.3Å; D122-F126 PolarHBondContact O-N 3.21Å
123	I	89.8	Confident	92.2	Very high	141 Å²	141	82.9 Å²	82.9	72%	0.723	43%	0.428	S	S	*	.	G	3₁₀ helix	trans	-67.3	-23.4	175.3	61.1	163.5	0	0	0	112.5	T121 F125 F126	T121-I123 PolarHBondContact O-N 3.5Å; T121-I123 WeakPolarHBondContact OG1-CG1 3.41Å; I123-F125 PolarHBondContact O-N 3.33Å; I123-F126 PolarHBondContact O-N 3.26Å
124	D	92.4	Very high	92	Very high	34 Å²	34	79.4 Å²	79.4	18%	0.182	41%	0.414	C	S	.	.	G	3₁₀ helix	trans	-68.3	-18.9	178	-70.7	-61.7	0	0	0	112.3	K30 Y99 T120 T121 D122	K30-D124 IonicContact NZ-OD1 2.68Å; K30-D124 PolarHBondContact NZ-OD1 3.14Å; K30-D124 IonicContact NZ-OD2 3.43Å; K30-D124 PolarHBondContact NZ-OD2 3.26Å; Y99-D124 WeakPolarHBondContact CE2-O 3.18Å; Y99-D124 PolarHBondContact OH-O 2.87Å; T120-D124 WeakPolarHBondContact CA-OD2 3.44Å; T121-D124 PolarHBondContact N-OD2 3.2Å; T121-D124 WeakPolarHBondContact O-CB 3.38Å; T121-D124 PolarHBondContact O-N 3.21Å; T121-D124 VanDerWaalsContact O-N 3.15Å; T121-D124 PolarHBondContact OG1-OD2 3.05Å; D122-D124 PolarHBondContact O-N 3.01Å
125	F	92.4	Very high	91.7	Very high	9 Å²	9	83.8 Å²	83.8	4%	0.039	43%	0.433	C	S	.	.	G	3₁₀ helix	trans	-123.8	12.9	-178	-51.1	-68.2	0	0	0	112.7	R25 L26 L72 Y99 T120 D122 I123	R25-F125 HydrophobicContact CB-CD2 3.85Å; R25-F125 HydrophobicContact CB-CE2 3.57Å; R25-F125 HydrophobicContact CB-CZ 4.29Å; R25-F125 HydrophobicContact CG-CD2 3.73Å; R25-F125 HydrophobicContact CG-CE2 3.76Å; L26-F125 HydrophobicContact CB-CD1 4.16Å; L26-F125 HydrophobicContact CB-CE1 3.6Å; L26-F125 HydrophobicContact CB-CZ 4.21Å; L26-F125 HydrophobicContact CD1-CD1 4.07Å; L26-F125 HydrophobicContact CD1-CE1 4.06Å; L26-F125 HydrophobicContact CG-CD1 3.94Å; L26-F125 HydrophobicContact CG-CE1 3.89Å; L72-F125 HydrophobicContact CD1-CE1 4.04Å; L72-F125 HydrophobicContact CD1-CZ 4.45Å; Y99-F125 HydrophobicContact CE1-CE1 4.32Å; Y99-F125 AromaticContact CE2-CD1 3.64Å; Y99-F125 HydrophobicContact CE2-CD1 3.64Å; Y99-F125 AromaticContact CE2-CE1 3.9Å; Y99-F125 HydrophobicContact CE2-CE1 3.9Å; Y99-F125 AromaticContact CZ-CD1 3.83Å; Y99-F125 AromaticContact CZ-CE1 3.62Å; Y99-F125 WeakPolarHBondContact OH-CE1 3.35Å; T120-F125 HydrophobicContact CG2-CE2 4.16Å; T120-F125 HydrophobicContact CG2-CZ 3.88Å; D122-F125 PolarHBondContact O-N 3.3Å; I123-F125 PolarHBondContact O-N 3.33Å
126	F	88.8	Confident	91.4	Very high	146 Å²	146	82.3 Å²	82.3	64%	0.64	42%	0.418	S	S	*	.			trans	-80.6	145.6	-179.4	-172.9	-98.2	0	0	0	111	D122 I123	D122-F126 PolarHBondContact O-N 3.21Å; I123-F126 PolarHBondContact O-N 3.26Å
127	C	86.1	Confident	90.8	Very high	34 Å²	34	82.2 Å²	82.2	23%	0.23	42%	0.423	C	S	.	.			trans	-115.2	133.2	173.6	-59.1	0	0	0	0	109.8	C55	C55-C127 VanDerWaalsContact C-SG 3.57Å; C55-C127 HydrophobicContact CB-CB 3.58Å; C55-C127 WeakPolarHBondContact CB-SG 3.41Å; C55-C127 WeakPolarHBondContact SG-CB 3.3Å; C55-C127 CovalentContact SG-SG 2Å; C55-C127 PolarHBondContact SG-SG 3.03Å
128	E	69.1	Low	90.2	Very high	257 Å²	257	79.7 Å²	79.7	100%	1.201	42%	0.415	S	S	*	.			trans	-76.6	0	173.2	-63.7	-172.3	162	0	0	113.1

Retrieved 128 of 128 residues in 307.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).