A0A096NWQ9_PAPAN Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (A0A2K5KV73), UniProt , Accession A0A096NWQ9, Species PAPAN (Papio anubis, Olive baboon), Gene n/a, Length 101 aa.

						>A0A096NWQ9_PAPAN|A0A096NWQ9
MIFSGPADPRPTAHDPPTHRPTHPRIGPALAFTISGSSSVAAMKKVVQQLQLEAGLNSVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.4	Very low	52.7	Low	238 Å²	238	148.5 Å²	148.5	100%	1.172	85%	0.846	S	S	*	*				0	84.3	0	-67.5	170.6	178.2	0	0	106.2
2	I	50.3	Low	53.2	Low	144 Å²	144	148 Å²	148	74%	0.738	85%	0.848	S	S	*	*				46	104.1	107.8	-51.9	-87.9	0	0	0	111.1
3	F	50.3	Low	53.2	Low	215 Å²	215	143.6 Å²	143.6	94%	0.943	84%	0.841	S	S	*	*			trans	-143.9	116.1	130.5	-99.2	-77.4	0	0	0	109.3
4	S	48.8	Very low	53.6	Low	110 Å²	110	146.1 Å²	146.1	77%	0.769	84%	0.84	S	S	*	*			trans	-67.9	149.6	172.5	-51.3	0	0	0	0	111
5	G	47.3	Very low	53.6	Low	76 Å²	76	146 Å²	146	78%	0.784	84%	0.835	S	S	*	*			trans	-172.7	103.5	166.6	0	0	0	0	0	112
6	P	64.4	Low	54.3	Low	127 Å²	127	142.8 Å²	142.8	83%	0.825	82%	0.822	S	S	*	*			trans	-97.4	151.5	177.1	36.4	-28.7	0	0	0	111
7	A	55.1	Low	54.3	Low	99 Å²	99	141 Å²	141	82%	0.818	82%	0.816	S	S	*	*			trans	-164.7	92.9	158.9	0	0	0	0	0	111.7
8	D	56.5	Low	54.5	Low	161 Å²	161	140.8 Å²	140.8	86%	0.861	82%	0.818	S	S	*	*			trans	-72.9	127.1	155.2	-119.5	-53.9	0	0	0	108.3	R10	D8-R10 PolarHBondContact O-N 3.06Å
9	P	57.8	Low	54.6	Low	118 Å²	118	142.5 Å²	142.5	77%	0.766	82%	0.817	S	S	*	*			trans	-75.8	99.7	172.9	28.3	-29.3	0	0	0	109.7
10	R	57.1	Low	54.6	Low	226 Å²	226	145.8 Å²	145.8	85%	0.853	82%	0.815	S	S	*	*			trans	-59.5	134.3	165.6	-170	178.8	-172.3	-136.5	2	109.3	D8 T12	D8-R10 PolarHBondContact O-N 3.06Å; R10-T12 PolarHBondContact O-N 3.09Å
11	P	50.7	Low	54.3	Low	120 Å²	120	143.4 Å²	143.4	78%	0.779	81%	0.806	S	S	*	*			trans	-66.1	123.6	175.8	25.9	-31.8	0	0	0	109.6	A13	P11-A13 PolarHBondContact O-N 3.11Å; P11-A13 VanDerWaalsContact O-N 3.09Å
12	T	58.3	Low	55.1	Low	142 Å²	142	137.9 Å²	137.9	87%	0.871	79%	0.786	S	S	*	*			trans	-66.7	104.6	172.2	-7.1	0	0	0	0	108.1	R10 H14	R10-T12 PolarHBondContact O-N 3.09Å; T12-H14 PolarHBondContact O-N 3.26Å; T12-H14 VanDerWaalsContact O-N 3.11Å
13	A	53.2	Low	55.1	Low	91 Å²	91	138.6 Å²	138.6	75%	0.752	79%	0.786	S	S	*	*			trans	-63.9	110.2	165.4	0	0	0	0	0	107.5	P11 D15	P11-A13 PolarHBondContact O-N 3.11Å; P11-A13 VanDerWaalsContact O-N 3.09Å; A13-D15 PolarHBondContact O-N 3.16Å; A13-D15 VanDerWaalsContact O-N 3.16Å
14	H	58.9	Low	55.2	Low	178 Å²	178	133.2 Å²	133.2	82%	0.824	77%	0.773	S	S	*	*			trans	-74.5	99.1	172.6	-156.9	-67.4	0	0	0	107	T12	T12-H14 PolarHBondContact O-N 3.26Å; T12-H14 VanDerWaalsContact O-N 3.11Å
15	D	54.2	Low	55.5	Low	145 Å²	145	138.7 Å²	138.7	78%	0.775	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-61.6	131.8	171.5	-105.3	-48.4	0	0	0	109.2	A13	A13-D15 PolarHBondContact O-N 3.16Å; A13-D15 VanDerWaalsContact O-N 3.16Å
16	P	64.3	Low	55.9	Low	95 Å²	95	142.8 Å²	142.8	62%	0.617	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-73	142.7	172.6	28.5	-30.9	0	0	0	110	T18	P16-T18 PolarHBondContact O-N 3.14Å; P16-T18 VanDerWaalsContact O-N 3.14Å
17	P	55	Low	55.2	Low	112 Å²	112	138.1 Å²	138.1	73%	0.727	75%	0.754	S	S	*	*	P	Polyproline II helix	trans	-62.4	122.3	177.6	24.6	-30.9	0	0	0	109.6	H19	P17-H19 VanDerWaalsContact C-N 3.33Å; P17-H19 PolarHBondContact O-N 2.86Å
18	T	56.9	Low	55.1	Low	137 Å²	137	139.1 Å²	139.1	84%	0.84	75%	0.751	S	S	*	*			trans	-63.8	94.2	171.6	-61.3	0	0	0	0	108.3	P16 R20	P16-T18 PolarHBondContact O-N 3.14Å; P16-T18 VanDerWaalsContact O-N 3.14Å; T18-R20 VanDerWaalsContact C-N 3.28Å; T18-R20 PolarHBondContact O-N 2.92Å
19	H	57.4	Low	54.8	Low	174 Å²	174	135.3 Å²	135.3	81%	0.806	74%	0.742	S	S	*	*			trans	-70.7	91.3	169.3	-123.9	-89	0	0	0	107.7	P17 P21	P17-H19 VanDerWaalsContact C-N 3.33Å; P17-H19 PolarHBondContact O-N 2.86Å; H19-P21 WeakPolarHBondContact O-CD 3.18Å
20	R	53.4	Low	54.7	Low	208 Å²	208	136.9 Å²	136.9	79%	0.785	74%	0.743	S	S	*	*			trans	-63.6	115	172.6	-162	179.1	-170	-132	3.5	107.4	T18 T22	T18-R20 VanDerWaalsContact C-N 3.28Å; T18-R20 PolarHBondContact O-N 2.92Å; R20-T22 PolarHBondContact O-N 2.94Å
21	P	49.1	Very low	54.7	Low	96 Å²	96	130.4 Å²	130.4	62%	0.623	74%	0.738	S	S	*	*			trans	-73.2	102.6	176	-9.8	26.8	0	0	0	107.3	H19 H23	H19-P21 WeakPolarHBondContact O-CD 3.18Å; P21-H23 PolarHBondContact O-N 2.99Å
22	T	58.2	Low	55	Low	121 Å²	121	130.4 Å²	130.4	74%	0.742	73%	0.726	S	S	*	*			trans	-71.7	81.8	160.1	46.4	0	0	0	0	107.2	R20 P24	R20-T22 PolarHBondContact O-N 2.94Å; T22-P24 WeakPolarHBondContact O-CD 3.41Å
23	H	50.9	Low	54.9	Low	159 Å²	159	129.8 Å²	129.8	74%	0.736	72%	0.722	S	S	*	*			trans	-61.9	123.3	164.3	-78.5	-76.1	0	0	0	107.9	P21 R25	P21-H23 PolarHBondContact O-N 2.99Å; H23-R25 PolarHBondContact O-N 2.8Å; H23-R25 VanDerWaalsContact O-N 3.1Å
24	P	51.5	Low	55.4	Low	103 Å²	103	131.5 Å²	131.5	67%	0.669	72%	0.718	S	S	*	*			trans	-64.9	115.6	166.5	5.4	5.3	0	0	0	106.4	T22 I26	T22-P24 WeakPolarHBondContact O-CD 3.41Å; P24-I26 HydrophobicContact CB-CG1 4.43Å; P24-I26 PolarHBondContact O-N 3.1Å
25	R	54.2	Low	55.2	Low	224 Å²	224	127.9 Å²	127.9	85%	0.845	71%	0.713	S	S	*	*			trans	-67.5	83.4	170.3	-172.6	-165.3	173.7	-129.6	-1	107.8	H23 G27	H23-R25 PolarHBondContact O-N 2.8Å; H23-R25 VanDerWaalsContact O-N 3.1Å; R25-G27 PolarHBondContact O-N 2.99Å
26	I	56.2	Low	55.4	Low	163 Å²	163	123.3 Å²	123.3	84%	0.836	70%	0.699	S	S	*	*			trans	-77.5	79.6	163.8	-55.2	174.6	0	0	0	106.1	P24	P24-I26 HydrophobicContact CB-CG1 4.43Å; P24-I26 PolarHBondContact O-N 3.1Å
27	G	50.9	Low	55.3	Low	29 Å²	29	123.9 Å²	123.9	30%	0.299	71%	0.706	S	S	.	*			trans	-110	144.7	155.6	0	0	0	0	0	107.1	R25 A29	R25-G27 PolarHBondContact O-N 2.99Å; G27-A29 VanDerWaalsContact C-N 3.33Å; G27-A29 PolarHBondContact O-N 2.84Å
28	P	51.6	Low	55.9	Low	119 Å²	119	122.6 Å²	122.6	77%	0.773	70%	0.699	S	S	*	*			trans	-65.2	102.9	171.4	28.4	-29.4	0	0	0	106.4	L30	P28-L30 PolarHBondContact O-N 2.8Å
29	A	50.9	Low	57.1	Low	81 Å²	81	116.4 Å²	116.4	67%	0.669	66%	0.661	S	S	*	*			trans	-67.2	87.2	162.1	0	0	0	0	0	105.9	G27 A31	G27-A29 VanDerWaalsContact C-N 3.33Å; G27-A29 PolarHBondContact O-N 2.84Å; A29-A31 PolarHBondContact O-N 2.86Å
30	L	56.3	Low	58.5	Low	151 Å²	151	111.3 Å²	111.3	79%	0.791	64%	0.643	S	S	*	*			trans	-68.3	72.7	157.8	-64.1	179.1	0	0	0	106.3	P28 F32	P28-L30 PolarHBondContact O-N 2.8Å; L30-F32 PolarHBondContact O-N 2.94Å
31	A	57.2	Low	60.3	Low	90 Å²	90	104 Å²	104	74%	0.744	63%	0.627	S	S	*	*			trans	-70.4	79.5	167.3	0	0	0	0	0	106.7	A29 T33	A29-A31 PolarHBondContact O-N 2.86Å; A31-T33 PolarHBondContact O-N 2.86Å
32	F	57	Low	62.3	Low	121 Å²	121	101.4 Å²	101.4	53%	0.531	61%	0.613	S	S	.	*			trans	-84.6	104.4	173.9	-164.4	-88.4	0	0	0	107.3	L30 I34	L30-F32 PolarHBondContact O-N 2.94Å; F32-I34 HydrophobicContact CD1-CG1 4.37Å; F32-I34 PolarHBondContact O-N 3.12Å
33	T	56.4	Low	64	Low	128 Å²	128	99.4 Å²	99.4	79%	0.785	60%	0.596	S	S	*	*			trans	-58.2	103	170.7	46	0	0	0	0	108.8	A31 S35	A31-T33 PolarHBondContact O-N 2.86Å; T33-S35 PolarHBondContact O-N 3.38Å; T33-S35 VanDerWaalsContact O-N 3.12Å
34	I	62.1	Low	66	Low	128 Å²	128	98.3 Å²	98.3	66%	0.656	59%	0.59	S	S	*	*			trans	-71	104.6	177.8	-97.1	165.3	0	0	0	108.3	F32 M43	F32-I34 HydrophobicContact CD1-CG1 4.37Å; F32-I34 PolarHBondContact O-N 3.12Å; I34-M43 HydrophobicContact CD1-SD 4.45Å
35	S	55.3	Low	68.1	Low	102 Å²	102	100.8 Å²	100.8	71%	0.713	59%	0.59	S	S	*	*			trans	-143.9	120.9	166.5	-153.9	0	0	0	0	108.7	T33	T33-S35 PolarHBondContact O-N 3.38Å; T33-S35 VanDerWaalsContact O-N 3.12Å
36	G	58.5	Low	70.1	Confident	48 Å²	48	94 Å²	94	50%	0.495	57%	0.573	S	S	.	*	S	Bend	trans	84	151.4	171.3	0	0	0	0	0	116.8	S38 S39	G36-S38 PolarHBondContact O-N 2.59Å; G36-S39 VanDerWaalsContact O-CB 3.26Å; G36-S39 WeakPolarHBondContact O-CB 3.3Å; G36-S39 PolarHBondContact O-N 2.9Å; G36-S39 PolarHBondContact O-OG 3.02Å
37	S	61.8	Low	72.1	Confident	108 Å²	108	89.6 Å²	89.6	76%	0.755	55%	0.554	S	S	*	*	H	α-helix	trans	-52.7	-21.7	178.5	53.2	0	0	0	0	115.3	S39 V40 A41	S37-S39 VanDerWaalsContact C-N 3.28Å; S37-S39 PolarHBondContact O-N 3.45Å; S37-V40 PolarHBondContact O-N 3.06Å; S37-A41 PolarHBondContact O-N 3.42Å
38	S	68.6	Low	74.3	Confident	84 Å²	84	94.4 Å²	94.4	59%	0.587	57%	0.568	S	S	*	*	H	α-helix	trans	-61.5	-32.9	170.8	52.8	0	0	0	0	112.9	G36 V40 A41 A42	G36-S38 PolarHBondContact O-N 2.59Å; S38-V40 VanDerWaalsContact C-N 3.33Å; S38-V40 PolarHBondContact O-N 3.17Å; S38-A41 PolarHBondContact O-N 2.88Å; S38-A42 PolarHBondContact O-N 3.32Å; S38-A42 VanDerWaalsContact O-N 3.1Å
39	S	82.3	Confident	76.5	Confident	7 Å²	7	93 Å²	93	5%	0.049	55%	0.551	C	S	.	*	H	α-helix	trans	-61.5	-39.8	173.7	65.2	0	0	0	0	112.2	G36 S37 A42 M43	G36-S39 VanDerWaalsContact O-CB 3.26Å; G36-S39 WeakPolarHBondContact O-CB 3.3Å; G36-S39 PolarHBondContact O-N 2.9Å; G36-S39 PolarHBondContact O-OG 3.02Å; S37-S39 VanDerWaalsContact C-N 3.28Å; S37-S39 PolarHBondContact O-N 3.45Å; S39-A42 PolarHBondContact O-N 3.1Å; S39-M43 VanDerWaalsContact O-CG 3.3Å; S39-M43 WeakPolarHBondContact O-CG 3.26Å; S39-M43 PolarHBondContact O-N 3.47Å
40	V	87.1	Confident	78.7	Confident	68 Å²	68	94 Å²	94	41%	0.412	55%	0.545	S	S	.	.	H	α-helix	trans	-69.2	-39.6	-178.8	-178.9	0	0	0	0	111.2	S37 S38 M43 K44	S37-V40 PolarHBondContact O-N 3.06Å; S38-V40 VanDerWaalsContact C-N 3.33Å; S38-V40 PolarHBondContact O-N 3.17Å; V40-M43 HydrophobicContact CB-CE 4.31Å; V40-M43 HydrophobicContact CG2-CE 3.97Å; V40-M43 PolarHBondContact O-N 3.24Å; V40-K44 WeakPolarHBondContact O-CG 3.38Å; V40-K44 PolarHBondContact O-N 3.42Å
41	A	89.3	Confident	80.7	Confident	55 Å²	55	93 Å²	93	46%	0.455	54%	0.536	S	S	.	.	H	α-helix	trans	-64.2	-41.3	174.2	0	0	0	0	0	111.8	S37 S38 K44 K45	S37-A41 PolarHBondContact O-N 3.42Å; S38-A41 PolarHBondContact O-N 2.88Å; A41-K44 PolarHBondContact O-N 2.9Å; A41-K45 PolarHBondContact O-N 3.17Å
42	A	91.4	Very high	82.6	Confident	40 Å²	40	94 Å²	94	33%	0.331	53%	0.528	S	S	.	.	H	α-helix	trans	-63.4	-45.2	174.7	0	0	0	0	0	111.8	S38 S39 K44 K45 V46	S38-A42 PolarHBondContact O-N 3.32Å; S38-A42 VanDerWaalsContact O-N 3.1Å; S39-A42 PolarHBondContact O-N 3.1Å; A42-K44 VanDerWaalsContact C-N 3.34Å; A42-K44 PolarHBondContact O-N 2.97Å; A42-K45 WeakPolarHBondContact O-CB 3.25Å; A42-K45 PolarHBondContact O-N 3.43Å; A42-V46 PolarHBondContact O-N 3.41Å
43	M	93.7	Very high	84.5	Confident	79 Å²	79	93 Å²	93	39%	0.389	53%	0.525	S	S	.	.	H	α-helix	trans	-60.8	-41.6	176.9	-73.7	-172.9	-63.4	0	0	112.3	I34 S39 V40 K45 V46 V47	I34-M43 HydrophobicContact CD1-SD 4.45Å; S39-M43 VanDerWaalsContact O-CG 3.3Å; S39-M43 WeakPolarHBondContact O-CG 3.26Å; S39-M43 PolarHBondContact O-N 3.47Å; V40-M43 HydrophobicContact CB-CE 4.31Å; V40-M43 HydrophobicContact CG2-CE 3.97Å; V40-M43 PolarHBondContact O-N 3.24Å; M43-K45 VanDerWaalsContact C-N 3.3Å; M43-K45 PolarHBondContact O-N 3.3Å; M43-V46 PolarHBondContact O-N 3.4Å; M43-V47 WeakPolarHBondContact O-CG2 3.3Å; M43-V47 PolarHBondContact O-N 3.43Å
44	K	94.4	Very high	86.4	Confident	137 Å²	137	91.1 Å²	91.1	60%	0.596	52%	0.523	S	S	*	.	H	α-helix	trans	-58.5	-42.5	175.4	-75.9	176.7	178.4	-175.4	0	111.9	V40 A41 A42 V47 Q48	V40-K44 WeakPolarHBondContact O-CG 3.38Å; V40-K44 PolarHBondContact O-N 3.42Å; A41-K44 PolarHBondContact O-N 2.9Å; A42-K44 VanDerWaalsContact C-N 3.34Å; A42-K44 PolarHBondContact O-N 2.97Å; K44-V47 PolarHBondContact O-N 3.25Å; K44-Q48 VanDerWaalsContact O-CG 3.32Å; K44-Q48 WeakPolarHBondContact O-CG 3.47Å; K44-Q48 PolarHBondContact O-N 2.95Å
45	K	95.6	Very high	88	Confident	155 Å²	155	87.6 Å²	87.6	67%	0.674	52%	0.518	S	S	*	.	H	α-helix	trans	-62.6	-42.8	175.7	-70.1	-176	178.8	-175.7	0	111.9	A41 A42 M43 Q48 Q49	A41-K45 PolarHBondContact O-N 3.17Å; A42-K45 WeakPolarHBondContact O-CB 3.25Å; A42-K45 PolarHBondContact O-N 3.43Å; M43-K45 VanDerWaalsContact C-N 3.3Å; M43-K45 PolarHBondContact O-N 3.3Å; K45-Q48 PolarHBondContact O-N 3.48Å; K45-Q49 WeakPolarHBondContact O-CB 3.33Å; K45-Q49 PolarHBondContact O-N 3.37Å
46	V	96.4	Very high	90	Very high	80 Å²	80	88.3 Å²	88.3	49%	0.485	51%	0.513	S	S	.	.	H	α-helix	trans	-62.7	-43.8	176.3	174.7	0	0	0	0	111.1	A42 M43 Q48 Q49 L50	A42-V46 PolarHBondContact O-N 3.41Å; M43-V46 PolarHBondContact O-N 3.4Å; V46-Q48 PolarHBondContact O-N 2.98Å; V46-Q49 WeakPolarHBondContact O-CB 3.31Å; V46-Q49 PolarHBondContact O-N 2.95Å; V46-L50 HydrophobicContact CG1-CD1 3.95Å; V46-L50 HydrophobicContact CG1-CG 4.3Å; V46-L50 VanDerWaalsContact O-CG 3.31Å; V46-L50 WeakPolarHBondContact O-CG 3.48Å; V46-L50 PolarHBondContact O-N 3.22Å
47	V	97.3	Very high	91.8	Very high	72 Å²	72	93.9 Å²	93.9	44%	0.436	53%	0.532	S	S	.	.	H	α-helix	trans	-62.5	-44.3	177.5	172.1	0	0	0	0	111.3	M43 K44 Q49 L50 Q51	M43-V47 WeakPolarHBondContact O-CG2 3.3Å; M43-V47 PolarHBondContact O-N 3.43Å; K44-V47 PolarHBondContact O-N 3.25Å; V47-Q49 VanDerWaalsContact C-N 3.3Å; V47-Q49 PolarHBondContact O-N 3.35Å; V47-L50 PolarHBondContact O-N 3.45Å; V47-Q51 HydrophobicContact CG1-CG 4.44Å; V47-Q51 VanDerWaalsContact O-CG 3.3Å; V47-Q51 WeakPolarHBondContact O-CG 3.4Å; V47-Q51 PolarHBondContact O-N 2.96Å
48	Q	97.4	Very high	93.4	Very high	129 Å²	129	94.4 Å²	94.4	60%	0.603	54%	0.536	S	S	*	.	H	α-helix	trans	-59.7	-42.1	175.8	-74.2	177.4	-34.5	0	0	111.7	K44 K45 V46 Q51 L52	K44-Q48 VanDerWaalsContact O-CG 3.32Å; K44-Q48 WeakPolarHBondContact O-CG 3.47Å; K44-Q48 PolarHBondContact O-N 2.95Å; K45-Q48 PolarHBondContact O-N 3.48Å; V46-Q48 PolarHBondContact O-N 2.98Å; Q48-Q51 PolarHBondContact O-N 3.38Å; Q48-L52 PolarHBondContact O-N 2.92Å; Q48-L52 VanDerWaalsContact O-N 3.12Å
49	Q	97.8	Very high	94.7	Very high	91 Å²	91	95.6 Å²	95.6	43%	0.425	54%	0.539	S	S	.	.	H	α-helix	trans	-63.3	-46.5	176	-177.4	60.3	31.4	0	0	112	K45 V46 V47 Q51 L52 E53	K45-Q49 WeakPolarHBondContact O-CB 3.33Å; K45-Q49 PolarHBondContact O-N 3.37Å; V46-Q49 WeakPolarHBondContact O-CB 3.31Å; V46-Q49 PolarHBondContact O-N 2.95Å; V47-Q49 VanDerWaalsContact C-N 3.3Å; V47-Q49 PolarHBondContact O-N 3.35Å; Q49-Q51 VanDerWaalsContact C-N 3.31Å; Q49-Q51 PolarHBondContact O-N 2.9Å; Q49-L52 WeakPolarHBondContact O-CB 3.5Å; Q49-L52 PolarHBondContact O-N 3.18Å; Q49-E53 WeakPolarHBondContact CG-OE1 3.46Å; Q49-E53 PolarHBondContact NE2-OE1 3.22Å; Q49-E53 PolarHBondContact O-N 3.39Å
50	L	97.7	Very high	95.5	Very high	100 Å²	100	103 Å²	103	52%	0.524	57%	0.57	S	S	.	*	H	α-helix	trans	-64.2	-36.1	179.2	-69.6	173.4	0	0	0	112.3	V46 V47 L52 E53 A54	V46-L50 HydrophobicContact CG1-CD1 3.95Å; V46-L50 HydrophobicContact CG1-CG 4.3Å; V46-L50 VanDerWaalsContact O-CG 3.31Å; V46-L50 WeakPolarHBondContact O-CG 3.48Å; V46-L50 PolarHBondContact O-N 3.22Å; V47-L50 PolarHBondContact O-N 3.45Å; L50-L52 VanDerWaalsContact C-N 3.34Å; L50-E53 PolarHBondContact O-N 3.08Å; L50-A54 VanDerWaalsContact O-CB 3.25Å; L50-A54 WeakPolarHBondContact O-CB 3.47Å; L50-A54 PolarHBondContact O-N 2.9Å
51	Q	97.8	Very high	96	Very high	131 Å²	131	105.7 Å²	105.7	61%	0.612	59%	0.587	S	S	*	*	H	α-helix	trans	-64.7	-39.4	174.4	-74.1	173.6	2.4	0	0	111.9	V47 Q48 Q49 G55	V47-Q51 HydrophobicContact CG1-CG 4.44Å; V47-Q51 VanDerWaalsContact O-CG 3.3Å; V47-Q51 WeakPolarHBondContact O-CG 3.4Å; V47-Q51 PolarHBondContact O-N 2.96Å; Q48-Q51 PolarHBondContact O-N 3.38Å; Q49-Q51 VanDerWaalsContact C-N 3.31Å; Q49-Q51 PolarHBondContact O-N 2.9Å; Q51-G55 PolarHBondContact O-N 3.37Å
52	L	97.6	Very high	96.4	Very high	111 Å²	111	107.2 Å²	107.2	58%	0.581	59%	0.594	S	S	*	*	H	α-helix	trans	-63.3	-47.5	174.3	179.3	68	0	0	0	111.2	Q48 Q49 L50 G55	Q48-L52 PolarHBondContact O-N 2.92Å; Q48-L52 VanDerWaalsContact O-N 3.12Å; Q49-L52 WeakPolarHBondContact O-CB 3.5Å; Q49-L52 PolarHBondContact O-N 3.18Å; L50-L52 VanDerWaalsContact C-N 3.34Å; L52-G55 PolarHBondContact O-N 3.42Å; L52-G55 VanDerWaalsContact O-N 3.17Å
53	E	96.4	Very high	96.8	Very high	100 Å²	100	110 Å²	110	47%	0.467	60%	0.6	S	S	.	*	H	α-helix	trans	-65.9	-39.1	-179.8	-72.2	175.4	-164.4	0	0	112.6	Q49 L50 G55 L56	Q49-E53 WeakPolarHBondContact CG-OE1 3.46Å; Q49-E53 PolarHBondContact NE2-OE1 3.22Å; Q49-E53 PolarHBondContact O-N 3.39Å; L50-E53 PolarHBondContact O-N 3.08Å; E53-G55 PolarHBondContact O-N 3.03Å; E53-L56 WeakPolarHBondContact O-CB 3.34Å; E53-L56 WeakPolarHBondContact O-CG 3.32Å; E53-L56 PolarHBondContact O-N 3.21Å; E53-L56 VanDerWaalsContact O-N 3.12Å
54	A	96.5	Very high	97	Very high	88 Å²	88	107.9 Å²	107.9	73%	0.727	60%	0.595	S	S	*	*	H	α-helix	trans	-65.4	-23.2	175.2	0	0	0	0	0	112.8	L50 L56	L50-A54 VanDerWaalsContact O-CB 3.25Å; L50-A54 WeakPolarHBondContact O-CB 3.47Å; L50-A54 PolarHBondContact O-N 2.9Å; A54-L56 VanDerWaalsContact C-N 3.3Å
55	G	96	Very high	97.2	Very high	55 Å²	55	104 Å²	104	57%	0.567	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.7	-3.7	174.8	0	0	0	0	0	114.5	Q51 L52 E53	Q51-G55 PolarHBondContact O-N 3.37Å; L52-G55 PolarHBondContact O-N 3.42Å; L52-G55 VanDerWaalsContact O-N 3.17Å; E53-G55 PolarHBondContact O-N 3.03Å
56	L	96.1	Very high	97.3	Very high	116 Å²	116	99 Å²	99	61%	0.607	58%	0.576	S	S	*	*	S	Bend	trans	-76.5	131.7	179.8	-61	-177.6	0	0	0	111.5	E53 A54 S58	E53-L56 WeakPolarHBondContact O-CB 3.34Å; E53-L56 WeakPolarHBondContact O-CG 3.32Å; E53-L56 PolarHBondContact O-N 3.21Å; E53-L56 VanDerWaalsContact O-N 3.12Å; A54-L56 VanDerWaalsContact C-N 3.3Å; L56-S58 PolarHBondContact O-N 3.12Å
57	N	96.2	Very high	97.4	Very high	166 Å²	166	99.1 Å²	99.1	89%	0.888	57%	0.574	S	S	*	*			trans	-74.3	111.4	176.6	-66	-51.3	0	0	0	110.3
58	S	94.9	Very high	97.4	Very high	119 Å²	119	101.4 Å²	101.4	83%	0.832	58%	0.583	S	S	*	*	P	Polyproline II helix	trans	-84.6	136.2	174.7	-65.5	0	0	0	0	111.1	L56	L56-S58 PolarHBondContact O-N 3.12Å
59	V	97.1	Very high	97.5	Very high	108 Å²	108	102 Å²	102	66%	0.655	58%	0.584	S	S	*	*	P	Polyproline II helix	trans	-86.3	155.9	168.3	-63.6	0	0	0	0	110.5	V61 A64	V59-V61 PolarHBondContact O-N 3.17Å; V59-A64 HydrophobicContact CG2-CB 4.19Å
60	K	98.2	Very high	97.5	Very high	162 Å²	162	103.4 Å²	103.4	70%	0.704	59%	0.59	S	S	*	*	P	Polyproline II helix	trans	-62.2	134.9	174.6	-69	179.2	-178.6	170.1	0	109.7	S62 Q63 A64	K60-S62 PolarHBondContact O-N 3.43Å; K60-Q63 HydrophobicContact CB-CB 4.19Å; K60-Q63 WeakPolarHBondContact O-CA 3.33Å; K60-Q63 WeakPolarHBondContact O-CB 3.39Å; K60-Q63 PolarHBondContact O-N 3.45Å; K60-A64 PolarHBondContact O-N 3.29Å
61	V	98.3	Very high	97.5	Very high	126 Å²	126	104.9 Å²	104.9	76%	0.764	59%	0.593	S	S	*	*	H	α-helix	trans	-56.1	-38.8	176.6	178	0	0	0	0	111.3	V59 Q63 A64 A65	V59-V61 PolarHBondContact O-N 3.17Å; V61-Q63 VanDerWaalsContact C-N 3.29Å; V61-Q63 PolarHBondContact O-N 2.78Å; V61-A64 PolarHBondContact O-N 3.23Å; V61-A65 WeakPolarHBondContact O-CB 3.49Å; V61-A65 PolarHBondContact O-N 2.89Å
62	S	98.3	Very high	97.5	Very high	87 Å²	87	102.4 Å²	102.4	61%	0.608	59%	0.589	S	S	*	*	H	α-helix	trans	-61.7	-36.2	175.8	60.2	0	0	0	0	113	K60 A66	K60-S62 PolarHBondContact O-N 3.43Å; S62-A66 WeakPolarHBondContact O-CB 3.44Å; S62-A66 PolarHBondContact O-N 3.12Å; S62-A66 VanDerWaalsContact O-N 3.08Å
63	Q	98.3	Very high	97.5	Very high	98 Å²	98	102.6 Å²	102.6	46%	0.458	59%	0.59	S	S	.	*	H	α-helix	trans	-69.5	-51.1	176.2	-176.6	60.9	50.1	0	0	110.4	K60 V61 A65 A66 D67	K60-Q63 HydrophobicContact CB-CB 4.19Å; K60-Q63 WeakPolarHBondContact O-CA 3.33Å; K60-Q63 WeakPolarHBondContact O-CB 3.39Å; K60-Q63 PolarHBondContact O-N 3.45Å; V61-Q63 VanDerWaalsContact C-N 3.29Å; V61-Q63 PolarHBondContact O-N 2.78Å; Q63-A65 PolarHBondContact O-N 3.34Å; Q63-A66 WeakPolarHBondContact O-CB 3.37Å; Q63-A66 PolarHBondContact O-N 2.97Å; Q63-D67 PolarHBondContact NE2-OD1 3.35Å; Q63-D67 PolarHBondContact NE2-OD2 2.8Å; Q63-D67 VanDerWaalsContact O-CG 3.28Å; Q63-D67 PolarHBondContact O-N 3.25Å
64	A	98.3	Very high	97.5	Very high	35 Å²	35	103.5 Å²	103.5	29%	0.289	59%	0.594	S	S	.	*	H	α-helix	trans	-56.4	-40.4	177.4	0	0	0	0	0	111.9	V59 K60 V61 D67 L68	V59-A64 HydrophobicContact CG2-CB 4.19Å; K60-A64 PolarHBondContact O-N 3.29Å; V61-A64 PolarHBondContact O-N 3.23Å; A64-D67 PolarHBondContact O-N 2.96Å; A64-L68 WeakPolarHBondContact O-CB 3.25Å; A64-L68 VanDerWaalsContact O-CG 3.25Å; A64-L68 WeakPolarHBondContact O-CG 3.43Å; A64-L68 PolarHBondContact O-N 2.89Å
65	A	98.4	Very high	97.5	Very high	54 Å²	54	102.4 Å²	102.4	45%	0.446	58%	0.576	S	S	.	*	H	α-helix	trans	-65.5	-39.9	175.9	0	0	0	0	0	112.8	V61 Q63 K69	V61-A65 WeakPolarHBondContact O-CB 3.49Å; V61-A65 PolarHBondContact O-N 2.89Å; Q63-A65 PolarHBondContact O-N 3.34Å; A65-K69 WeakPolarHBondContact O-CB 3.36Å; A65-K69 PolarHBondContact O-N 3.02Å
66	A	98.4	Very high	97.5	Very high	50 Å²	50	101 Å²	101	41%	0.413	56%	0.559	S	S	.	*	H	α-helix	trans	-64.6	-43.4	175.6	0	0	0	0	0	111.4	S62 Q63 K69 Q70	S62-A66 WeakPolarHBondContact O-CB 3.44Å; S62-A66 PolarHBondContact O-N 3.12Å; S62-A66 VanDerWaalsContact O-N 3.08Å; Q63-A66 WeakPolarHBondContact O-CB 3.37Å; Q63-A66 PolarHBondContact O-N 2.97Å; A66-K69 PolarHBondContact O-N 3.43Å; A66-Q70 WeakPolarHBondContact O-CB 3.37Å; A66-Q70 PolarHBondContact O-N 2.91Å
67	D	98.2	Very high	97.3	Very high	84 Å²	84	102.3 Å²	102.3	45%	0.449	56%	0.562	S	S	.	*	H	α-helix	trans	-63.9	-45.3	178.9	-63.2	-24.3	0	0	0	111.1	Q63 A64 Q70 F71	Q63-D67 PolarHBondContact NE2-OD1 3.35Å; Q63-D67 PolarHBondContact NE2-OD2 2.8Å; Q63-D67 VanDerWaalsContact O-CG 3.28Å; Q63-D67 PolarHBondContact O-N 3.25Å; A64-D67 PolarHBondContact O-N 2.96Å; D67-Q70 PolarHBondContact O-N 3Å; D67-F71 WeakPolarHBondContact O-CB 3.45Å; D67-F71 PolarHBondContact O-N 2.94Å
68	L	98.5	Very high	97.2	Very high	119 Å²	119	101.7 Å²	101.7	62%	0.623	55%	0.553	S	S	*	*	H	α-helix	trans	-60.2	-47	174.8	-73.2	172.5	0	0	0	111.7	A64 Q70 F71 C72	A64-L68 WeakPolarHBondContact O-CB 3.25Å; A64-L68 VanDerWaalsContact O-CG 3.25Å; A64-L68 WeakPolarHBondContact O-CG 3.43Å; A64-L68 PolarHBondContact O-N 2.89Å; L68-Q70 VanDerWaalsContact C-N 3.31Å; L68-Q70 PolarHBondContact O-N 3.28Å; L68-F71 PolarHBondContact O-N 2.99Å; L68-C72 PolarHBondContact O-N 3.33Å; L68-C72 PolarHBondContact O-SG 3.47Å
69	K	97.9	Very high	97.1	Very high	143 Å²	143	98.8 Å²	98.8	62%	0.622	53%	0.528	S	S	*	.	H	α-helix	trans	-58.5	-45.8	176.6	176.5	-178.6	174.1	-177.3	0	111	A65 A66 C72 L73	A65-K69 WeakPolarHBondContact O-CB 3.36Å; A65-K69 PolarHBondContact O-N 3.02Å; A66-K69 PolarHBondContact O-N 3.43Å; K69-C72 PolarHBondContact O-N 2.92Å; K69-L73 HydrophobicContact CG-CD1 4.05Å; K69-L73 HydrophobicContact CG-CG 4.41Å; K69-L73 WeakPolarHBondContact O-CG 3.49Å; K69-L73 PolarHBondContact O-N 3.47Å
70	Q	98.4	Very high	96.9	Very high	119 Å²	119	96.9 Å²	96.9	56%	0.556	52%	0.518	S	S	*	.	H	α-helix	trans	-64.1	-42.9	-178.5	-177.1	155.1	-70.3	0	0	111.5	A66 D67 L68 C72 L73 Q74	A66-Q70 WeakPolarHBondContact O-CB 3.37Å; A66-Q70 PolarHBondContact O-N 2.91Å; D67-Q70 PolarHBondContact O-N 3Å; L68-Q70 VanDerWaalsContact C-N 3.31Å; L68-Q70 PolarHBondContact O-N 3.28Å; Q70-C72 VanDerWaalsContact C-N 3.35Å; Q70-C72 PolarHBondContact O-N 3.41Å; Q70-L73 PolarHBondContact O-N 3.29Å; Q70-Q74 VanDerWaalsContact O-CG 3.3Å; Q70-Q74 WeakPolarHBondContact O-CG 3.3Å; Q70-Q74 PolarHBondContact O-N 3.28Å
71	F	98.3	Very high	96.6	Very high	131 Å²	131	96.6 Å²	96.6	58%	0.575	52%	0.524	S	S	*	.	H	α-helix	trans	-57.5	-47.8	173.3	178.7	-94	0	0	0	111.5	D67 L68 L73 Q74 N75	D67-F71 WeakPolarHBondContact O-CB 3.45Å; D67-F71 PolarHBondContact O-N 2.94Å; L68-F71 PolarHBondContact O-N 2.99Å; F71-L73 PolarHBondContact O-N 3.38Å; F71-Q74 PolarHBondContact O-N 3.44Å; F71-N75 WeakPolarHBondContact CE2-ND2 3.36Å; F71-N75 PolarHBondContact O-N 3.32Å; F71-N75 VanDerWaalsContact O-N 3.12Å; F71-N75 PolarHBondContact O-ND2 2.83Å
72	C	97.9	Very high	96.4	Very high	79 Å²	79	96.5 Å²	96.5	53%	0.534	52%	0.518	S	S	.	.	H	α-helix	trans	-60.3	-44.5	177.7	-67.3	0	0	0	0	112	L68 K69 Q70 Q74 N75 A76	L68-C72 PolarHBondContact O-N 3.33Å; L68-C72 PolarHBondContact O-SG 3.47Å; K69-C72 PolarHBondContact O-N 2.92Å; Q70-C72 VanDerWaalsContact C-N 3.35Å; Q70-C72 PolarHBondContact O-N 3.41Å; C72-Q74 PolarHBondContact O-N 2.81Å; C72-N75 PolarHBondContact O-N 3.12Å; C72-A76 WeakPolarHBondContact O-CA 3.46Å; C72-A76 VanDerWaalsContact O-CB 3.28Å; C72-A76 WeakPolarHBondContact O-CB 3.46Å; C72-A76 PolarHBondContact O-N 3.31Å
73	L	96.5	Very high	96.1	Very high	116 Å²	116	95.6 Å²	95.6	61%	0.607	51%	0.509	S	S	*	.	H	α-helix	trans	-64.6	-39.5	-179.8	-70.9	174.8	0	0	0	112.8	K69 Q70 F71 N75	K69-L73 HydrophobicContact CG-CD1 4.05Å; K69-L73 HydrophobicContact CG-CG 4.41Å; K69-L73 WeakPolarHBondContact O-CG 3.49Å; K69-L73 PolarHBondContact O-N 3.47Å; Q70-L73 PolarHBondContact O-N 3.29Å; F71-L73 PolarHBondContact O-N 3.38Å; L73-N75 VanDerWaalsContact C-N 3.32Å
74	Q	97.3	Very high	95.7	Very high	119 Å²	119	93.1 Å²	93.1	56%	0.556	51%	0.51	S	S	*	.	H	α-helix	trans	-65.6	-36.7	177.6	-71.7	174	7.9	0	0	111.9	Q70 F71 C72	Q70-Q74 VanDerWaalsContact O-CG 3.3Å; Q70-Q74 WeakPolarHBondContact O-CG 3.3Å; Q70-Q74 PolarHBondContact O-N 3.28Å; F71-Q74 PolarHBondContact O-N 3.44Å; C72-Q74 PolarHBondContact O-N 2.81Å
75	N	96.7	Very high	95.2	Very high	65 Å²	65	94.9 Å²	94.9	35%	0.348	52%	0.517	S	S	.	.	H	α-helix	trans	-94	-12.9	-176.1	-68.1	-83.1	0	0	0	113.7	F71 C72 L73 Q77 H78 D79	F71-N75 WeakPolarHBondContact CE2-ND2 3.36Å; F71-N75 PolarHBondContact O-N 3.32Å; F71-N75 VanDerWaalsContact O-N 3.12Å; F71-N75 PolarHBondContact O-ND2 2.83Å; C72-N75 PolarHBondContact O-N 3.12Å; L73-N75 VanDerWaalsContact C-N 3.32Å; N75-Q77 PolarHBondContact O-N 3.03Å; N75-Q77 VanDerWaalsContact O-N 3.15Å; N75-H78 WeakPolarHBondContact O-CA 3.28Å; N75-H78 PolarHBondContact O-N 3.34Å; N75-D79 PolarHBondContact O-N 3.19Å
76	A	95.5	Very high	94.6	Very high	24 Å²	24	95.1 Å²	95.1	20%	0.198	52%	0.516	C	S	.	.	G	3₁₀ helix	trans	-55.8	-37.4	-175.5	0	0	0	0	0	113	C72 H78 D79 L82 T83	C72-A76 WeakPolarHBondContact O-CA 3.46Å; C72-A76 VanDerWaalsContact O-CB 3.28Å; C72-A76 WeakPolarHBondContact O-CB 3.46Å; C72-A76 PolarHBondContact O-N 3.31Å; A76-H78 PolarHBondContact O-N 3.15Å; A76-D79 PolarHBondContact O-N 3.39Å; A76-L82 HydrophobicContact CB-CD1 4.25Å; A76-T83 WeakPolarHBondContact O-CG2 3.29Å
77	Q	92.4	Very high	93.8	Very high	145 Å²	145	96 Å²	96	68%	0.678	52%	0.518	S	S	*	.	G	3₁₀ helix	trans	-70.9	-21.8	179	-62.4	-59.3	-57.4	0	0	113.3	N75	N75-Q77 PolarHBondContact O-N 3.03Å; N75-Q77 VanDerWaalsContact O-N 3.15Å
78	H	92.6	Very high	93	Very high	153 Å²	153	97.2 Å²	97.2	71%	0.708	53%	0.534	S	S	*	.	G	3₁₀ helix	trans	-94.6	-6.3	178.8	-62.3	-62.9	0	0	0	112.8	N75 A76 P80	N75-H78 WeakPolarHBondContact O-CA 3.28Å; N75-H78 PolarHBondContact O-N 3.34Å; A76-H78 PolarHBondContact O-N 3.15Å; H78-P80 WeakPolarHBondContact O-CD 3.49Å
79	D	94.8	Very high	92.4	Very high	57 Å²	57	96.3 Å²	96.3	31%	0.305	53%	0.534	S	S	.	.			trans	-86.1	109	175.2	-172.6	-17.5	0	0	0	109.9	N75 A76 L81 L82 T83	N75-D79 PolarHBondContact O-N 3.19Å; A76-D79 PolarHBondContact O-N 3.39Å; D79-L81 PolarHBondContact O-N 2.9Å; D79-L81 VanDerWaalsContact OD1-CB 3.29Å; D79-L81 WeakPolarHBondContact OD1-CB 3.48Å; D79-L81 PolarHBondContact OD1-N 3.15Å; D79-L82 HydrophobicContact CB-CB 4.1Å; D79-L82 HydrophobicContact CB-CD1 3.99Å; D79-L82 HydrophobicContact CB-CG 4.02Å; D79-L82 PolarHBondContact O-N 3Å; D79-L82 VanDerWaalsContact O-N 3.15Å; D79-L82 WeakPolarHBondContact OD2-CG 3.12Å; D79-T83 PolarHBondContact O-N 3.17Å; D79-T83 PolarHBondContact O-OG1 2.87Å
80	P	92.3	Very high	92	Very high	68 Å²	68	92.2 Å²	92.2	44%	0.442	52%	0.518	S	S	.	.	H	α-helix	trans	-60.6	-23	178.6	-26.4	40.1	0	0	0	113.7	H78 G84 V85	H78-P80 WeakPolarHBondContact O-CD 3.49Å; P80-G84 CarbonylContact O-C 3.41Å; P80-G84 WeakPolarHBondContact O-CA 3.22Å; P80-G84 PolarHBondContact O-N 2.85Å; P80-V85 HydrophobicContact CB-CG1 3.64Å; P80-V85 HydrophobicContact CG-CG1 4.48Å
81	L	92.5	Very high	91.4	Very high	157 Å²	157	92 Å²	92	82%	0.822	53%	0.528	S	S	*	.	H	α-helix	trans	-81.8	-27.6	-179.3	-56.1	-179.4	0	0	0	111.8	D79	D79-L81 PolarHBondContact O-N 2.9Å; D79-L81 VanDerWaalsContact OD1-CB 3.29Å; D79-L81 WeakPolarHBondContact OD1-CB 3.48Å; D79-L81 PolarHBondContact OD1-N 3.15Å
82	L	93.3	Very high	91	Very high	123 Å²	123	94.6 Å²	94.6	64%	0.644	54%	0.539	S	S	*	.	H	α-helix	trans	-87.2	-42	176.7	-65.1	-179.2	0	0	0	112.3	A76 D79	A76-L82 HydrophobicContact CB-CD1 4.25Å; D79-L82 HydrophobicContact CB-CB 4.1Å; D79-L82 HydrophobicContact CB-CD1 3.99Å; D79-L82 HydrophobicContact CB-CG 4.02Å; D79-L82 PolarHBondContact O-N 3Å; D79-L82 VanDerWaalsContact O-N 3.15Å; D79-L82 WeakPolarHBondContact OD2-CG 3.12Å
83	T	92.1	Very high	90.3	Very high	68 Å²	68	94.8 Å²	94.8	42%	0.417	53%	0.528	S	S	.	.	H	α-helix	trans	-85.8	-19.3	-179.6	50.6	0	0	0	0	113.5	A76 D79	A76-T83 WeakPolarHBondContact O-CG2 3.29Å; D79-T83 PolarHBondContact O-N 3.17Å; D79-T83 PolarHBondContact O-OG1 2.87Å
84	G	88.8	Confident	89.6	Confident	47 Å²	47	94.1 Å²	94.1	49%	0.485	53%	0.531	S	S	.	.			trans	73.3	156.9	-167.7	0	0	0	0	0	111.6	P80	P80-G84 CarbonylContact O-C 3.41Å; P80-G84 WeakPolarHBondContact O-CA 3.22Å; P80-G84 PolarHBondContact O-N 2.85Å
85	V	88.9	Confident	88.7	Confident	71 Å²	71	97.4 Å²	97.4	43%	0.43	55%	0.546	S	S	.	.			trans	-123.6	146.1	175	-76.9	0	0	0	0	110.8	P80 N90	P80-V85 HydrophobicContact CB-CG1 3.64Å; P80-V85 HydrophobicContact CG-CG1 4.48Å; V85-N90 HydrophobicContact CG2-CB 3.81Å
86	S	85.1	Confident	87.5	Confident	60 Å²	60	102.2 Å²	102.2	42%	0.42	56%	0.564	S	S	.	*			trans	-63.4	153.8	172.8	90.9	0	0	0	0	110.3	S88 T89 N90	S86-S88 PolarHBondContact O-N 3.12Å; S86-S88 VanDerWaalsContact O-N 3.12Å; S86-S88 PolarHBondContact OG-N 3.46Å; S86-S88 PolarHBondContact OG-OG 3.13Å; S86-T89 PolarHBondContact O-N 2.93Å; S86-T89 VanDerWaalsContact O-N 3.13Å; S86-T89 PolarHBondContact OG-N 3.16Å; S86-T89 PolarHBondContact OG-OG1 2.9Å; S86-N90 PolarHBondContact O-N 3.4Å; S86-N90 VanDerWaalsContact O-N 3.16Å
87	S	81.7	Confident	86.5	Confident	67 Å²	67	107.3 Å²	107.3	47%	0.469	59%	0.593	S	S	.	*	T	Hydrogen-bonded Turn	trans	-51.6	-34.5	177	-104	0	0	0	0	113.6	R93	S87-R93 WeakPolarHBondContact O-CD 3.06Å; S87-R93 WeakPolarHBondContact O-CG 3.34Å; S87-R93 PolarHBondContact O-NE 3Å; S87-R93 PolarHBondContact OG-NE 3.2Å; S87-R93 PolarHBondContact OG-NH2 3.34Å
88	S	82.3	Confident	85.3	Confident	111 Å²	111	105.3 Å²	105.3	78%	0.776	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.8	-27.1	-177.5	50.6	0	0	0	0	113.4	S86	S86-S88 PolarHBondContact O-N 3.12Å; S86-S88 VanDerWaalsContact O-N 3.12Å; S86-S88 PolarHBondContact OG-N 3.46Å; S86-S88 PolarHBondContact OG-OG 3.13Å
89	T	85.5	Confident	84.1	Confident	100 Å²	100	102.6 Å²	102.6	61%	0.613	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90	-10.8	179.1	-5.1	0	0	0	0	113	S86 P91	S86-T89 PolarHBondContact O-N 2.93Å; S86-T89 VanDerWaalsContact O-N 3.13Å; S86-T89 PolarHBondContact OG-N 3.16Å; S86-T89 PolarHBondContact OG-OG1 2.9Å; T89-P91 WeakPolarHBondContact O-CD 3.4Å
90	N	88.9	Confident	82.7	Confident	56 Å²	56	109.1 Å²	109.1	30%	0.299	62%	0.617	S	S	.	*			trans	-82.7	113.8	179.1	-175.7	-5.7	0	0	0	111.3	V85 S86 F92 R93	V85-N90 HydrophobicContact CG2-CB 3.81Å; S86-N90 PolarHBondContact O-N 3.4Å; S86-N90 VanDerWaalsContact O-N 3.16Å; N90-F92 PolarHBondContact O-N 3.25Å; N90-F92 WeakPolarHBondContact OD1-CB 3.28Å; N90-F92 PolarHBondContact OD1-N 2.75Å; N90-R93 HydrophobicContact CB-CB 4.45Å; N90-R93 VanDerWaalsContact O-CB 3.28Å; N90-R93 WeakPolarHBondContact O-CB 3.46Å; N90-R93 PolarHBondContact O-N 3.49Å
91	P	87.1	Confident	81.3	Confident	116 Å²	116	117 Å²	117	75%	0.753	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.6	-17.7	179.1	28.7	-34.8	0	0	0	113.6	T89 R93	T89-P91 WeakPolarHBondContact O-CD 3.4Å; P91-R93 VanDerWaalsContact C-N 3.32Å
92	F	89	Confident	80.7	Confident	185 Å²	185	115 Å²	115	81%	0.811	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.8	8.5	177.3	-59.6	-77.3	0	0	0	113.3	N90	N90-F92 PolarHBondContact O-N 3.25Å; N90-F92 WeakPolarHBondContact OD1-CB 3.28Å; N90-F92 PolarHBondContact OD1-N 2.75Å
93	R	83.6	Confident	80.1	Confident	83 Å²	83	114.6 Å²	114.6	31%	0.313	65%	0.646	S	S	.	*	P	Polyproline II helix	trans	-67	133.1	-180	-166.4	-146.2	-155.4	-70.4	-19.9	110.8	S87 N90 P91 Q95 K96	S87-R93 WeakPolarHBondContact O-CD 3.06Å; S87-R93 WeakPolarHBondContact O-CG 3.34Å; S87-R93 PolarHBondContact O-NE 3Å; S87-R93 PolarHBondContact OG-NE 3.2Å; S87-R93 PolarHBondContact OG-NH2 3.34Å; N90-R93 HydrophobicContact CB-CB 4.45Å; N90-R93 VanDerWaalsContact O-CB 3.28Å; N90-R93 WeakPolarHBondContact O-CB 3.46Å; N90-R93 PolarHBondContact O-N 3.49Å; P91-R93 VanDerWaalsContact C-N 3.32Å; R93-Q95 PolarHBondContact O-N 3.35Å; R93-K96 VanDerWaalsContact NH1-CG 3.28Å; R93-K96 VanDerWaalsContact NH2-CE 3.28Å
94	P	80.8	Confident	79.4	Confident	102 Å²	102	117.2 Å²	117.2	66%	0.662	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-57.2	132	165.3	-23.8	33.8	0	0	0	110.9	K96	P94-K96 PolarHBondContact O-N 3.3Å
95	Q	78.8	Confident	78.8	Confident	187 Å²	187	121.3 Å²	121.3	87%	0.874	67%	0.669	S	S	*	*	P	Polyproline II helix	trans	-62	128.4	173.5	-70.5	-163	-4.2	0	0	109	R93 V97	R93-Q95 PolarHBondContact O-N 3.35Å; Q95-V97 PolarHBondContact O-N 3.13Å; Q95-V97 VanDerWaalsContact O-N 3.13Å
96	K	72.7	Confident	78.2	Confident	166 Å²	166	124.4 Å²	124.4	72%	0.722	68%	0.684	S	S	*	*			trans	-72.7	106.9	168.8	-64.8	-160.1	178.9	-175.6	0	106.9	R93 P94 C98	R93-K96 VanDerWaalsContact NH1-CG 3.28Å; R93-K96 VanDerWaalsContact NH2-CE 3.28Å; P94-K96 PolarHBondContact O-N 3.3Å; K96-C98 PolarHBondContact O-N 3.24Å
97	V	73.7	Confident	77.7	Confident	132 Å²	132	128.7 Å²	128.7	80%	0.8	70%	0.702	S	S	*	*			trans	-65.5	114.7	163	-69.1	0	0	0	0	106.9	Q95 S99	Q95-V97 PolarHBondContact O-N 3.13Å; Q95-V97 VanDerWaalsContact O-N 3.13Å; V97-S99 PolarHBondContact O-N 3.2Å
98	C	66.5	Low	77.5	Confident	102 Å²	102	133.1 Å²	133.1	69%	0.689	72%	0.719	S	S	*	*			trans	-78.6	102.8	173.7	-153.1	0	0	0	0	106.7	K96 F100	K96-C98 PolarHBondContact O-N 3.24Å; C98-F100 PolarHBondContact O-N 3.38Å
99	S	68.1	Low	77.1	Confident	96 Å²	96	134.8 Å²	134.8	67%	0.671	71%	0.714	S	S	*	*			trans	-81.9	109.8	169.4	45	0	0	0	0	108.5	V97 L101	V97-S99 PolarHBondContact O-N 3.2Å; S99-L101 PolarHBondContact O-N 3.48Å
100	F	65.6	Low	76.4	Confident	194 Å²	194	137.8 Å²	137.8	85%	0.851	72%	0.723	S	S	*	*			trans	-73.1	111.8	164.4	-65.6	-86.3	0	0	0	107.5	C98	C98-F100 PolarHBondContact O-N 3.38Å
101	L	62.1	Low	75.3	Confident	234 Å²	234	145.2 Å²	145.2	100%	1.225	76%	0.761	S	S	*	*			trans	-104.1	0	165.1	-74.2	174.1	0	0	0	108.6	S99	S99-L101 PolarHBondContact O-N 3.48Å

Retrieved 101 of 101 residues in 85.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).