A0A096NXZ2_PAPAN Loading...

Parathymosin

AlphaFold DB (H9FXQ3), UniProt , Accession A0A096NXZ2, Species PAPAN (Papio anubis, Olive baboon), Gene n/a, Length 102 aa.

						>A0A096NXZ2_PAPAN|A0A096NXZ2
MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.8	Low	70.4	Confident	224 Å²	224	115.3 Å²	115.3	100%	1.103	64%	0.638	S	S	*	*				0	111.9	0	-62	-75.7	-147.1	0	0	106.3
2	S	69.8	Low	70.9	Confident	85 Å²	85	115.7 Å²	115.7	59%	0.594	64%	0.637	S	S	*	*			trans	-73	140	176.5	-78.1	0	0	0	0	109.4	K4 S5	S2-K4 PolarHBondContact O-N 3.46Å; S2-S5 PolarHBondContact N-OG 3.16Å; S2-S5 PolarHBondContact O-N 3.09Å; S2-S5 PolarHBondContact O-OG 3.34Å
3	E	67.1	Low	71.3	Confident	173 Å²	173	111.8 Å²	111.8	81%	0.808	62%	0.624	S	S	*	*	H	α-helix	trans	-57.7	-32.4	177.4	-68.7	156.5	106	0	0	111.5	S5 V6 E7	E3-S5 VanDerWaalsContact C-N 3.31Å; E3-S5 PolarHBondContact O-N 2.78Å; E3-V6 PolarHBondContact O-N 2.84Å; E3-V6 VanDerWaalsContact O-N 3.08Å; E3-E7 PolarHBondContact O-N 3.2Å; E3-E7 VanDerWaalsContact O-N 3.09Å
4	K	66.2	Low	72.2	Confident	183 Å²	183	108.4 Å²	108.4	80%	0.796	62%	0.616	S	S	*	*	H	α-helix	trans	-57.7	-33.8	171.4	-99.6	148.1	174.7	162.4	0	115.2	S2 A8	S2-K4 PolarHBondContact O-N 3.46Å; K4-A8 PolarHBondContact O-N 2.94Å
5	S	70.6	Confident	72.9	Confident	65 Å²	65	109.3 Å²	109.3	46%	0.455	61%	0.611	S	S	.	*	H	α-helix	trans	-76.8	-26.1	176.3	36.5	0	0	0	0	112.8	S2 E3 A9	S2-S5 PolarHBondContact N-OG 3.16Å; S2-S5 PolarHBondContact O-N 3.09Å; S2-S5 PolarHBondContact O-OG 3.34Å; E3-S5 VanDerWaalsContact C-N 3.31Å; E3-S5 PolarHBondContact O-N 2.78Å; S5-A9 WeakPolarHBondContact O-CB 3.22Å; S5-A9 PolarHBondContact O-N 3.5Å
6	V	73.4	Confident	73.7	Confident	94 Å²	94	107 Å²	107	57%	0.57	60%	0.597	S	S	*	*	H	α-helix	trans	-74.5	-40.4	175.4	179.5	0	0	0	0	110.2	E3 A9 A10	E3-V6 PolarHBondContact O-N 2.84Å; E3-V6 VanDerWaalsContact O-N 3.08Å; V6-A9 PolarHBondContact O-N 3.02Å; V6-A10 PolarHBondContact O-N 2.96Å
7	E	70.4	Confident	73.9	Confident	154 Å²	154	107.4 Å²	107.4	72%	0.72	60%	0.597	S	S	*	*	H	α-helix	trans	-66.2	-42.8	177.5	-163.8	152.5	110.7	0	0	112.3	E3 A9 A10 E11	E3-E7 PolarHBondContact O-N 3.2Å; E3-E7 VanDerWaalsContact O-N 3.09Å; E7-A9 PolarHBondContact O-N 2.95Å; E7-A10 PolarHBondContact O-N 2.97Å; E7-E11 PolarHBondContact O-N 2.87Å
8	A	77.4	Confident	74.6	Confident	53 Å²	53	110.1 Å²	110.1	44%	0.438	60%	0.601	S	S	.	*	H	α-helix	trans	-63.8	-38.1	174.2	0	0	0	0	0	112.9	K4 E11 L12	K4-A8 PolarHBondContact O-N 2.94Å; A8-E11 PolarHBondContact O-N 3.49Å; A8-L12 WeakPolarHBondContact O-CB 3.12Å; A8-L12 WeakPolarHBondContact O-CG 3.22Å; A8-L12 PolarHBondContact O-N 3.39Å
9	A	70.3	Confident	74.7	Confident	57 Å²	57	110.6 Å²	110.6	47%	0.471	60%	0.599	S	S	.	*	H	α-helix	trans	-68.1	-35.9	176.5	0	0	0	0	0	112.3	S5 V6 E7 S13	S5-A9 WeakPolarHBondContact O-CB 3.22Å; S5-A9 PolarHBondContact O-N 3.5Å; V6-A9 PolarHBondContact O-N 3.02Å; E7-A9 PolarHBondContact O-N 2.95Å; A9-S13 WeakPolarHBondContact O-CB 3.14Å; A9-S13 PolarHBondContact O-N 2.95Å
10	A	78.6	Confident	74.7	Confident	62 Å²	62	111.1 Å²	111.1	51%	0.512	60%	0.595	S	S	.	*	H	α-helix	trans	-67.5	-42.8	175.2	0	0	0	0	0	111.8	V6 E7 S13 A14	V6-A10 PolarHBondContact O-N 2.96Å; E7-A10 PolarHBondContact O-N 2.97Å; A10-S13 PolarHBondContact O-N 3.2Å; A10-A14 PolarHBondContact O-N 3.09Å
11	E	71.8	Confident	75	Confident	118 Å²	118	113 Å²	113	55%	0.551	60%	0.598	S	S	*	*	H	α-helix	trans	-67.5	-39.5	177.8	-171.4	170.3	110.4	0	0	112.5	E7 A8 A14 K15	E7-E11 PolarHBondContact O-N 2.87Å; A8-E11 PolarHBondContact O-N 3.49Å; E11-A14 PolarHBondContact O-N 3.29Å; E11-K15 HydrophobicContact CG-CD 4.49Å; E11-K15 WeakPolarHBondContact O-CG 3.49Å; E11-K15 PolarHBondContact O-N 2.61Å; E11-K15 IonicContact OE1-NZ 2.67Å; E11-K15 PolarHBondContact OE1-NZ 3.48Å
12	L	76	Confident	75.7	Confident	120 Å²	120	108.4 Å²	108.4	63%	0.628	57%	0.574	S	S	*	*	H	α-helix	trans	-64.5	-41.2	172.9	-77.2	166	0	0	0	112	A8 A14 K15 D16	A8-L12 WeakPolarHBondContact O-CB 3.12Å; A8-L12 WeakPolarHBondContact O-CG 3.22Å; A8-L12 PolarHBondContact O-N 3.39Å; L12-A14 PolarHBondContact O-N 3.17Å; L12-K15 PolarHBondContact O-N 3.08Å; L12-D16 WeakPolarHBondContact O-CB 3.37Å; L12-D16 PolarHBondContact O-N 3.3Å
13	S	76.8	Confident	75.9	Confident	66 Å²	66	109.6 Å²	109.6	46%	0.462	57%	0.569	S	S	.	*	H	α-helix	trans	-63	-40.3	177	-177	0	0	0	0	112.3	A9 A10 D16 L17	A9-S13 WeakPolarHBondContact O-CB 3.14Å; A9-S13 PolarHBondContact O-N 2.95Å; A10-S13 PolarHBondContact O-N 3.2Å; S13-D16 PolarHBondContact O-N 3.02Å; S13-L17 WeakPolarHBondContact O-CB 3.33Å; S13-L17 VanDerWaalsContact O-CG 3.31Å; S13-L17 WeakPolarHBondContact O-CG 3.42Å; S13-L17 PolarHBondContact O-N 3.36Å
14	A	83.8	Confident	76.2	Confident	63 Å²	63	106.1 Å²	106.1	52%	0.521	56%	0.559	S	S	.	*	H	α-helix	trans	-65.6	-40.6	177.2	0	0	0	0	0	112.5	A10 E11 L12 K18	A10-A14 PolarHBondContact O-N 3.09Å; E11-A14 PolarHBondContact O-N 3.29Å; L12-A14 PolarHBondContact O-N 3.17Å; A14-K18 PolarHBondContact O-N 3.19Å
15	K	82.8	Confident	76.2	Confident	123 Å²	123	103.3 Å²	103.3	54%	0.535	55%	0.549	S	S	.	.	H	α-helix	trans	-65.4	-44.4	175.4	-69.6	171.9	-173.5	167.2	0	111.3	E11 L12 L17 K18 E19	E11-K15 HydrophobicContact CG-CD 4.49Å; E11-K15 WeakPolarHBondContact O-CG 3.49Å; E11-K15 PolarHBondContact O-N 2.61Å; E11-K15 IonicContact OE1-NZ 2.67Å; E11-K15 PolarHBondContact OE1-NZ 3.48Å; L12-K15 PolarHBondContact O-N 3.08Å; K15-L17 PolarHBondContact O-N 3.29Å; K15-K18 PolarHBondContact O-N 2.71Å; K15-E19 PolarHBondContact O-N 3.01Å
16	D	85.1	Confident	75.6	Confident	72 Å²	72	106.6 Å²	106.6	39%	0.385	56%	0.557	S	S	.	*	H	α-helix	trans	-63.4	-37.8	179.1	-168.1	-93.9	0	0	0	112.6	L12 S13 K20	L12-D16 WeakPolarHBondContact O-CB 3.37Å; L12-D16 PolarHBondContact O-N 3.3Å; S13-D16 PolarHBondContact O-N 3.02Å; D16-K20 VanDerWaalsContact O-CB 3.32Å; D16-K20 WeakPolarHBondContact O-CB 3.42Å; D16-K20 WeakPolarHBondContact O-CG 3.45Å; D16-K20 PolarHBondContact O-N 3.49Å; D16-K20 WeakPolarHBondContact OD1-CD 3.19Å; D16-K20 WeakPolarHBondContact OD1-CE 3.34Å; D16-K20 IonicContact OD1-NZ 2.81Å; D16-K20 PolarHBondContact OD1-NZ 3.45Å
17	L	78.1	Confident	75.1	Confident	113 Å²	113	108.6 Å²	108.6	59%	0.592	56%	0.558	S	S	*	*	H	α-helix	trans	-66.5	-38.4	174.5	-75.7	170.3	0	0	0	112.7	S13 K15 K21	S13-L17 WeakPolarHBondContact O-CB 3.33Å; S13-L17 VanDerWaalsContact O-CG 3.31Å; S13-L17 WeakPolarHBondContact O-CG 3.42Å; S13-L17 PolarHBondContact O-N 3.36Å; K15-L17 PolarHBondContact O-N 3.29Å; L17-K21 WeakPolarHBondContact O-CB 3.31Å; L17-K21 PolarHBondContact O-N 2.84Å; L17-K21 VanDerWaalsContact O-N 3.11Å
18	K	86.3	Confident	74.6	Confident	156 Å²	156	103.5 Å²	103.5	68%	0.678	54%	0.542	S	S	*	.	H	α-helix	trans	-65.7	-48.6	176.6	-171	-175.3	176.7	-168.9	0	110.7	A14 K15 K20 K21 E22	A14-K18 PolarHBondContact O-N 3.19Å; K15-K18 PolarHBondContact O-N 2.71Å; K18-K20 PolarHBondContact O-N 2.96Å; K18-K21 WeakPolarHBondContact O-CB 3.21Å; K18-K21 PolarHBondContact O-N 2.67Å; K18-K21 VanDerWaalsContact O-N 3.17Å; K18-E22 PolarHBondContact O-N 3.35Å; K18-E22 VanDerWaalsContact O-N 3.09Å
19	E	76.8	Confident	73.6	Confident	120 Å²	120	103.8 Å²	103.8	56%	0.561	54%	0.541	S	S	*	.	H	α-helix	trans	-61.3	-43.1	177.9	-171	-172.4	109.9	0	0	111.8	K15 K21 E22 K23	K15-E19 PolarHBondContact O-N 3.01Å; E19-K21 VanDerWaalsContact C-N 3.29Å; E19-K21 PolarHBondContact O-N 2.96Å; E19-E22 PolarHBondContact O-N 3.36Å; E19-K23 VanDerWaalsContact O-CB 3.31Å; E19-K23 WeakPolarHBondContact O-CB 3.32Å; E19-K23 PolarHBondContact O-N 2.81Å
20	K	73.5	Confident	73.1	Confident	120 Å²	120	109.9 Å²	109.9	52%	0.522	55%	0.552	S	S	.	*	H	α-helix	trans	-61.1	-37.1	175.3	-82.8	174.4	174.4	154.8	0	112.9	D16 K18 V24	D16-K20 VanDerWaalsContact O-CB 3.32Å; D16-K20 WeakPolarHBondContact O-CB 3.42Å; D16-K20 WeakPolarHBondContact O-CG 3.45Å; D16-K20 PolarHBondContact O-N 3.49Å; D16-K20 WeakPolarHBondContact OD1-CD 3.19Å; D16-K20 WeakPolarHBondContact OD1-CE 3.34Å; D16-K20 IonicContact OD1-NZ 2.81Å; D16-K20 PolarHBondContact OD1-NZ 3.45Å; K18-K20 PolarHBondContact O-N 2.96Å; K20-V24 WeakPolarHBondContact O-CB 3.41Å; K20-V24 WeakPolarHBondContact O-CG2 3.31Å; K20-V24 PolarHBondContact O-N 2.98Å; K20-V24 VanDerWaalsContact O-N 3.1Å
21	K	80.8	Confident	72.1	Confident	151 Å²	151	115 Å²	115	66%	0.657	56%	0.562	S	S	*	*	H	α-helix	trans	-68	-47.2	178.7	-170.5	-175	173.9	-167.2	0	111.1	L17 K18 E19 K23 V24 E25	L17-K21 WeakPolarHBondContact O-CB 3.31Å; L17-K21 PolarHBondContact O-N 2.84Å; L17-K21 VanDerWaalsContact O-N 3.11Å; K18-K21 WeakPolarHBondContact O-CB 3.21Å; K18-K21 PolarHBondContact O-N 2.67Å; K18-K21 VanDerWaalsContact O-N 3.17Å; E19-K21 VanDerWaalsContact C-N 3.29Å; E19-K21 PolarHBondContact O-N 2.96Å; K21-K23 VanDerWaalsContact C-N 3.34Å; K21-K23 PolarHBondContact O-N 3.18Å; K21-V24 PolarHBondContact O-N 3.45Å; K21-V24 VanDerWaalsContact O-N 3.16Å; K21-E25 PolarHBondContact O-N 3.44Å
22	E	73.4	Confident	71.3	Confident	128 Å²	128	116.1 Å²	116.1	60%	0.598	57%	0.567	S	S	*	*	H	α-helix	trans	-59.4	-44.8	176.7	-170.4	179.3	99.6	0	0	111.4	K18 E19 V24 E25 E26	K18-E22 PolarHBondContact O-N 3.35Å; K18-E22 VanDerWaalsContact O-N 3.09Å; E19-E22 PolarHBondContact O-N 3.36Å; E22-V24 VanDerWaalsContact C-N 3.27Å; E22-V24 PolarHBondContact O-N 2.94Å; E22-E25 PolarHBondContact O-N 3Å; E22-E26 PolarHBondContact O-N 3.03Å
23	K	74	Confident	70.3	Confident	111 Å²	111	118.3 Å²	118.3	48%	0.483	57%	0.568	S	S	.	*	H	α-helix	trans	-66.8	-25	177.2	-165.9	157.5	-169.5	157.7	0	114.2	E19 K21 K27	E19-K23 VanDerWaalsContact O-CB 3.31Å; E19-K23 WeakPolarHBondContact O-CB 3.32Å; E19-K23 PolarHBondContact O-N 2.81Å; K21-K23 VanDerWaalsContact C-N 3.34Å; K21-K23 PolarHBondContact O-N 3.18Å; K23-K27 WeakPolarHBondContact O-CD 3.2Å; K23-K27 WeakPolarHBondContact O-CG 3.41Å; K23-K27 PolarHBondContact O-N 3.24Å
24	V	74.9	Confident	69.3	Low	100 Å²	100	122.6 Å²	122.6	61%	0.606	58%	0.578	S	S	*	*	H	α-helix	trans	-77.5	-40.5	173.5	165	0	0	0	0	110.4	K20 K21 E22 K27 A28	K20-V24 WeakPolarHBondContact O-CB 3.41Å; K20-V24 WeakPolarHBondContact O-CG2 3.31Å; K20-V24 PolarHBondContact O-N 2.98Å; K20-V24 VanDerWaalsContact O-N 3.1Å; K21-V24 PolarHBondContact O-N 3.45Å; K21-V24 VanDerWaalsContact O-N 3.16Å; E22-V24 VanDerWaalsContact C-N 3.27Å; E22-V24 PolarHBondContact O-N 2.94Å; V24-K27 PolarHBondContact O-N 2.98Å; V24-A28 WeakPolarHBondContact O-CB 3.34Å; V24-A28 PolarHBondContact O-N 3.47Å
25	E	66.3	Low	68	Low	124 Å²	124	125.7 Å²	125.7	58%	0.579	58%	0.579	S	S	*	*	H	α-helix	trans	-64.8	-46.8	177.3	-160	168.7	101.3	0	0	111.2	K21 E22 K27 A28 S29	K21-E25 PolarHBondContact O-N 3.44Å; E22-E25 PolarHBondContact O-N 3Å; E25-K27 VanDerWaalsContact C-N 3.31Å; E25-K27 PolarHBondContact O-N 3.1Å; E25-A28 WeakPolarHBondContact O-CB 3.49Å; E25-A28 PolarHBondContact O-N 3.44Å; E25-A28 VanDerWaalsContact O-N 3.07Å; E25-S29 PolarHBondContact O-N 2.74Å; E25-S29 PolarHBondContact O-OG 3.39Å
26	E	57.7	Low	66.5	Low	133 Å²	133	126.6 Å²	126.6	62%	0.621	59%	0.586	S	S	*	*	H	α-helix	trans	-58.4	-41.3	176.2	-172.9	-168.8	92.2	0	0	112.5	E22 R30	E22-E26 PolarHBondContact O-N 3.03Å; E26-R30 WeakPolarHBondContact O-CB 3.25Å; E26-R30 PolarHBondContact O-N 3.2Å
27	K	62	Low	64.9	Low	136 Å²	136	127.6 Å²	127.6	59%	0.591	59%	0.594	S	S	*	*	H	α-helix	trans	-70.3	-31.6	177.4	-74	177.6	-176.3	-179.3	0	112.9	K23 V24 E25 K31	K23-K27 WeakPolarHBondContact O-CD 3.2Å; K23-K27 WeakPolarHBondContact O-CG 3.41Å; K23-K27 PolarHBondContact O-N 3.24Å; V24-K27 PolarHBondContact O-N 2.98Å; E25-K27 VanDerWaalsContact C-N 3.31Å; E25-K27 PolarHBondContact O-N 3.1Å; K27-K31 PolarHBondContact O-N 3.43Å
28	A	60.3	Low	63.5	Low	48 Å²	48	126.2 Å²	126.2	40%	0.397	59%	0.59	S	S	.	*	H	α-helix	trans	-70.3	-49.1	175	0	0	0	0	0	110.4	V24 E25 R30 K31 E32	V24-A28 WeakPolarHBondContact O-CB 3.34Å; V24-A28 PolarHBondContact O-N 3.47Å; E25-A28 WeakPolarHBondContact O-CB 3.49Å; E25-A28 PolarHBondContact O-N 3.44Å; E25-A28 VanDerWaalsContact O-N 3.07Å; A28-R30 VanDerWaalsContact C-N 3.3Å; A28-R30 PolarHBondContact O-N 3.36Å; A28-K31 WeakPolarHBondContact O-CB 3.5Å; A28-K31 PolarHBondContact O-N 3.09Å; A28-E32 PolarHBondContact O-N 3.02Å
29	S	57.1	Low	61.9	Low	58 Å²	58	124.3 Å²	124.3	41%	0.406	58%	0.584	S	S	.	*	H	α-helix	trans	-63	-32.4	177.9	-59.1	0	0	0	0	112.9	E25 K31 R33	E25-S29 PolarHBondContact O-N 2.74Å; E25-S29 PolarHBondContact O-OG 3.39Å; S29-K31 VanDerWaalsContact C-N 3.31Å; S29-K31 PolarHBondContact O-N 2.96Å; S29-R33 VanDerWaalsContact O-CG 3.24Å; S29-R33 WeakPolarHBondContact O-CG 3.48Å; S29-R33 PolarHBondContact O-N 3.46Å; S29-R33 PolarHBondContact O-NE 3.45Å
30	R	58.9	Low	60.8	Low	186 Å²	186	126 Å²	126	70%	0.702	59%	0.592	S	S	*	*	H	α-helix	trans	-67	-29.8	173.2	-170.2	175.2	-129.4	-163.8	4.4	113.3	E26 A28 K34	E26-R30 WeakPolarHBondContact O-CB 3.25Å; E26-R30 PolarHBondContact O-N 3.2Å; A28-R30 VanDerWaalsContact C-N 3.3Å; A28-R30 PolarHBondContact O-N 3.36Å; R30-K34 PolarHBondContact O-N 3.17Å
31	K	58.5	Low	59.7	Low	168 Å²	168	128.4 Å²	128.4	73%	0.73	61%	0.605	S	S	*	*	H	α-helix	trans	-79.5	-36.3	-178.9	-169.3	178.9	177.2	-174.5	0	112	K27 A28 S29 K35	K27-K31 PolarHBondContact O-N 3.43Å; A28-K31 WeakPolarHBondContact O-CB 3.5Å; A28-K31 PolarHBondContact O-N 3.09Å; S29-K31 VanDerWaalsContact C-N 3.31Å; S29-K31 PolarHBondContact O-N 2.96Å; K31-K35 PolarHBondContact O-N 2.92Å
32	E	54.9	Low	58.4	Low	142 Å²	142	129.4 Å²	129.4	66%	0.664	61%	0.612	S	S	*	*	H	α-helix	trans	-70.2	-44.3	177	-70.8	-175.9	103.7	0	0	111.6	A28 K34 K35 E36	A28-E32 PolarHBondContact O-N 3.02Å; E32-K34 PolarHBondContact O-N 3.48Å; E32-K35 PolarHBondContact O-N 3.03Å; E32-E36 PolarHBondContact O-N 3.17Å
33	R	55.3	Low	57.5	Low	167 Å²	167	130 Å²	130	63%	0.63	62%	0.619	S	S	*	*	H	α-helix	trans	-59.6	-30	174.7	-65.8	-172.1	-61.8	158.2	-6.4	114	S29 V37	S29-R33 VanDerWaalsContact O-CG 3.24Å; S29-R33 WeakPolarHBondContact O-CG 3.48Å; S29-R33 PolarHBondContact O-N 3.46Å; S29-R33 PolarHBondContact O-NE 3.45Å; R33-V37 VanDerWaalsContact O-CG2 3.26Å; R33-V37 WeakPolarHBondContact O-CG2 3.22Å; R33-V37 PolarHBondContact O-N 3.16Å
34	K	54.9	Low	56.8	Low	156 Å²	156	128.1 Å²	128.1	68%	0.678	63%	0.631	S	S	*	*	H	α-helix	trans	-78.8	-23.6	175.7	-170.8	172	179.9	178.7	0	112.9	R30 E32 V38	R30-K34 PolarHBondContact O-N 3.17Å; E32-K34 PolarHBondContact O-N 3.48Å; K34-V38 WeakPolarHBondContact O-CB 3.44Å; K34-V38 WeakPolarHBondContact O-CG2 3.48Å; K34-V38 PolarHBondContact O-N 3.3Å
35	K	55.7	Low	56.1	Low	127 Å²	127	128 Å²	128	55%	0.552	64%	0.64	S	S	*	*	H	α-helix	trans	-82.4	-40.7	176.7	-169.5	179	178.7	-73.4	0	111	K31 E32 V38 E39	K31-K35 PolarHBondContact O-N 2.92Å; E32-K35 PolarHBondContact O-N 3.03Å; K35-V38 PolarHBondContact O-N 3.11Å; K35-E39 IonicContact NZ-OE1 3.92Å; K35-E39 IonicContact NZ-OE2 2.65Å; K35-E39 PolarHBondContact NZ-OE2 2.73Å; K35-E39 PolarHBondContact O-N 3.17Å
36	E	51.6	Low	55.4	Low	143 Å²	143	130.3 Å²	130.3	67%	0.668	65%	0.651	S	S	*	*	H	α-helix	trans	-62	-50.3	176.6	-169.5	176.1	91.9	0	0	111.7	E32 V38 E39 E40	E32-E36 PolarHBondContact O-N 3.17Å; E36-V38 PolarHBondContact O-N 3.48Å; E36-E39 PolarHBondContact O-N 3.02Å; E36-E40 PolarHBondContact O-N 3.29Å
37	V	51.6	Low	54.9	Low	92 Å²	92	132.1 Å²	132.1	56%	0.558	66%	0.66	S	S	*	*	H	α-helix	trans	-60.5	-31.2	175.4	171.9	0	0	0	0	112.8	R33 E41	R33-V37 VanDerWaalsContact O-CG2 3.26Å; R33-V37 WeakPolarHBondContact O-CG2 3.22Å; R33-V37 PolarHBondContact O-N 3.16Å; V37-E41 PolarHBondContact O-N 3.49Å
38	V	49.5	Very low	54.5	Low	85 Å²	85	134.4 Å²	134.4	52%	0.515	67%	0.673	S	S	.	*	H	α-helix	trans	-77.2	-32.7	178.8	157.2	0	0	0	0	112.8	K34 K35 E36	K34-V38 WeakPolarHBondContact O-CB 3.44Å; K34-V38 WeakPolarHBondContact O-CG2 3.48Å; K34-V38 PolarHBondContact O-N 3.3Å; K35-V38 PolarHBondContact O-N 3.11Å; E36-V38 PolarHBondContact O-N 3.48Å
39	E	53.1	Low	54	Low	115 Å²	115	140.8 Å²	140.8	54%	0.537	69%	0.694	S	S	.	*	H	α-helix	trans	-75.5	-30.1	176.6	-77.3	-175.5	102.8	0	0	112.2	K35 E36	K35-E39 IonicContact NZ-OE1 3.92Å; K35-E39 IonicContact NZ-OE2 2.65Å; K35-E39 PolarHBondContact NZ-OE2 2.73Å; K35-E39 PolarHBondContact O-N 3.17Å; E36-E39 PolarHBondContact O-N 3.02Å
40	E	52.2	Low	53.6	Low	157 Å²	157	146.4 Å²	146.4	73%	0.734	71%	0.714	S	S	*	*	H	α-helix	trans	-73.1	-37	176.9	-166.1	175.1	89.7	0	0	112.6	E36 E42	E36-E40 PolarHBondContact O-N 3.29Å; E40-E42 PolarHBondContact O-N 3.48Å
41	E	51.3	Low	53.3	Low	169 Å²	169	147 Å²	147	79%	0.79	73%	0.725	S	S	*	*	H	α-helix	trans	-69.4	-28.1	179.6	-165.5	179.5	97.1	0	0	113.3	V37	V37-E41 PolarHBondContact O-N 3.49Å
42	E	53.3	Low	52.8	Low	173 Å²	173	144.4 Å²	144.4	81%	0.808	72%	0.723	S	S	*	*	H	α-helix	trans	-83	-18.2	-178	-163	-179.2	104.1	0	0	113.7	E40	E40-E42 PolarHBondContact O-N 3.48Å
43	N	54.6	Low	52.8	Low	140 Å²	140	142.2 Å²	142.2	75%	0.749	73%	0.729	S	S	*	*	S	Bend	trans	-103.7	3.9	-176.3	-106.5	-79.7	0	0	0	115.2
44	G	58.6	Low	52.8	Low	71 Å²	71	143.1 Å²	143.1	73%	0.732	74%	0.741	S	S	*	*	S	Bend	trans	-94.9	11.2	-171.2	0	0	0	0	0	117.3
45	A	61	Low	53	Low	97 Å²	97	143 Å²	143	80%	0.802	75%	0.747	S	S	*	*			trans	-132.9	33.8	-166.1	0	0	0	0	0	116.8
46	E	50.4	Low	52.9	Low	173 Å²	173	140.3 Å²	140.3	81%	0.808	76%	0.756	S	S	*	*			trans	-144.9	127.1	164.6	-104.8	-176.8	48.3	0	0	105.6
47	E	48	Very low	53.3	Low	172 Å²	172	142.5 Å²	142.5	80%	0.804	77%	0.766	S	S	*	*			cis	-148.5	145.8	15.2	-62.4	-158.7	111.6	0	0	108.6
48	E	53	Low	53.6	Low	184 Å²	184	147.2 Å²	147.2	86%	0.86	78%	0.782	S	S	*	*			trans	-72.7	150.9	161.9	-145.9	-168.7	163	0	0	108.6
49	E	51.3	Low	54	Low	182 Å²	182	151.7 Å²	151.7	85%	0.85	80%	0.797	S	S	*	*			trans	102.7	86.1	168.7	-48.3	-151	-167.2	0	0	118.3
50	E	47.8	Very low	54.2	Low	175 Å²	175	153.7 Å²	153.7	82%	0.818	81%	0.812	S	S	*	*				-152.6	119.6	127.5	-136.8	-179	157.8	0	0	110.4	T52	E50-T52 PolarHBondContact O-N 3.3Å
51	E	52.5	Low	54.7	Low	199 Å²	199	154.7 Å²	154.7	93%	0.93	82%	0.817	S	S	*	*			trans	-70.2	113.3	166.5	-72.2	-157.4	145.4	0	0	109.7
52	T	48.3	Very low	55.3	Low	113 Å²	113	148.8 Å²	148.8	69%	0.693	80%	0.801	S	S	*	*			trans	-139.3	107.9	164.1	60.7	0	0	0	0	112.3	E50	E50-T52 PolarHBondContact O-N 3.3Å
53	A	55.3	Low	55.6	Low	97 Å²	97	149.3 Å²	149.3	80%	0.802	80%	0.803	S	S	*	*			trans	48.8	116	142.5	0	0	0	0	0	121.4
54	E	54.9	Low	55.7	Low	186 Å²	186	150.7 Å²	150.7	87%	0.869	81%	0.805	S	S	*	*				44.1	121.6	119.2	-148.9	-158.3	90.4	0	0	120.2
55	D	58.4	Low	55.6	Low	152 Å²	152	154.8 Å²	154.8	81%	0.813	81%	0.806	S	S	*	*			trans	75	119.7	148.9	-150	54.2	0	0	0	119.5
56	G	54.5	Low	55.7	Low	71 Å²	71	156.3 Å²	156.3	73%	0.732	80%	0.8	S	S	*	*			trans	173.2	55.2	175	0	0	0	0	0	111	E58	G56-E58 PolarHBondContact O-N 3.45Å
57	E	58.8	Low	56.1	Low	189 Å²	189	155.9 Å²	155.9	88%	0.883	80%	0.798	S	S	*	*			trans	-64.2	108.3	156.4	-64.4	-166	132.5	0	0	107.2
58	E	59.3	Low	56.6	Low	192 Å²	192	155.4 Å²	155.4	90%	0.897	80%	0.796	S	S	*	*			trans	-136.2	133.4	148.7	-71.9	-150.2	159.2	0	0	109	G56 D60	G56-E58 PolarHBondContact O-N 3.45Å; E58-D60 PolarHBondContact O-N 3.28Å
59	E	57.8	Low	56.8	Low	178 Å²	178	154.8 Å²	154.8	83%	0.832	79%	0.793	S	S	*	*			trans	-61.1	122	-168.1	-63.7	173.1	117.2	0	0	111.7	E61	E59-E61 PolarHBondContact O-N 3.25Å
60	D	57.1	Low	57	Low	158 Å²	158	154.5 Å²	154.5	85%	0.845	79%	0.792	S	S	*	*			trans	-74.5	77.7	163.7	-171.6	74.6	0	0	0	108.4	E58	E58-D60 PolarHBondContact O-N 3.28Å
61	E	63.4	Low	57.4	Low	178 Å²	178	153.6 Å²	153.6	83%	0.832	79%	0.787	S	S	*	*			trans	-98.9	74.3	162	-76	-166.9	130	0	0	108.7	E59	E59-E61 PolarHBondContact O-N 3.25Å
62	G	62.6	Low	57.6	Low	45 Å²	45	152.1 Å²	152.1	46%	0.464	78%	0.781	S	S	.	*			trans	-125.1	56.1	170.2	0	0	0	0	0	110.6	E64	G62-E64 VanDerWaalsContact C-N 3.3Å; G62-E64 PolarHBondContact O-N 2.92Å
63	E	60	Low	58	Low	183 Å²	183	153.7 Å²	153.7	86%	0.855	79%	0.785	S	S	*	*			trans	-73.7	92.1	168.6	-166.8	146.5	106	0	0	108.1	E65	E63-E65 PolarHBondContact O-N 3.07Å; E63-E65 VanDerWaalsContact O-N 3.16Å
64	E	56.8	Low	58.2	Low	170 Å²	170	155 Å²	155	79%	0.794	78%	0.778	S	S	*	*			trans	-62.2	99.1	170	-62.8	-79	159.7	0	0	109.5	G62 D66	G62-E64 VanDerWaalsContact C-N 3.3Å; G62-E64 PolarHBondContact O-N 2.92Å; E64-D66 VanDerWaalsContact C-N 3.32Å; E64-D66 PolarHBondContact O-N 3.5Å
65	E	57.6	Low	58.3	Low	157 Å²	157	155.1 Å²	155.1	73%	0.734	78%	0.779	S	S	*	*			trans	-88.5	77	155.8	-72.8	-168.5	165	0	0	108.4	E63 E67	E63-E65 PolarHBondContact O-N 3.07Å; E63-E65 VanDerWaalsContact O-N 3.16Å; E65-E67 VanDerWaalsContact C-N 3.27Å; E65-E67 PolarHBondContact O-N 3.32Å
66	D	63.1	Low	58.6	Low	129 Å²	129	149.4 Å²	149.4	69%	0.69	76%	0.755	S	S	*	*			trans	-78	85	157	-166.1	25.7	0	0	0	106.5	E64 E68	E64-D66 VanDerWaalsContact C-N 3.32Å; E64-D66 PolarHBondContact O-N 3.5Å; D66-E68 PolarHBondContact O-N 2.97Å
67	E	58.1	Low	59.1	Low	164 Å²	164	152.4 Å²	152.4	77%	0.766	76%	0.762	S	S	*	*			trans	-65.9	90.6	167.7	-75.6	-174.7	152.1	0	0	107.6	E65 E69	E65-E67 VanDerWaalsContact C-N 3.27Å; E65-E67 PolarHBondContact O-N 3.32Å; E67-E69 PolarHBondContact O-N 3.19Å
68	E	59.2	Low	59.2	Low	161 Å²	161	146.3 Å²	146.3	75%	0.752	74%	0.744	S	S	*	*			trans	-45.9	115.9	169.8	-64.2	-161	172.7	0	0	109.3	D66 E70	D66-E68 PolarHBondContact O-N 2.97Å; E68-E70 VanDerWaalsContact C-N 3.35Å; E68-E70 PolarHBondContact O-N 3.2Å
69	E	56.4	Low	59.1	Low	171 Å²	171	146.1 Å²	146.1	80%	0.799	75%	0.748	S	S	*	*			trans	-60.6	101	163.2	-68.1	-166.9	158.8	0	0	107.2	E67 E71	E67-E69 PolarHBondContact O-N 3.19Å; E69-E71 PolarHBondContact O-N 3Å
70	E	54.8	Low	59.5	Low	176 Å²	176	146 Å²	146	82%	0.822	75%	0.745	S	S	*	*			trans	-65.1	77.5	162.1	-69.1	-160.3	172.2	0	0	108.5	E68 E72	E68-E70 VanDerWaalsContact C-N 3.35Å; E68-E70 PolarHBondContact O-N 3.2Å; E70-E72 PolarHBondContact O-N 2.98Å
71	E	56.3	Low	59.7	Low	156 Å²	156	150.1 Å²	150.1	73%	0.729	75%	0.749	S	S	*	*			trans	-67.6	88.4	150.1	-72.1	-74.9	162.5	0	0	105.7	E69 D73	E69-E71 PolarHBondContact O-N 3Å; E71-D73 PolarHBondContact O-N 3.38Å
72	E	57.8	Low	59.3	Low	169 Å²	169	146.2 Å²	146.2	79%	0.79	75%	0.747	S	S	*	*			trans	-64.5	72.7	165.3	-152	178.8	-155.5	0	0	107.5	E70 D74	E70-E72 PolarHBondContact O-N 2.98Å; E72-D74 PolarHBondContact O-N 2.78Å; E72-D74 VanDerWaalsContact O-N 3.17Å
73	D	56.7	Low	59.3	Low	145 Å²	145	149.1 Å²	149.1	78%	0.775	77%	0.766	S	S	*	*			trans	-64.7	108.8	169.5	-171.4	-120.9	0	0	0	107.4	E71	E71-D73 PolarHBondContact O-N 3.38Å
74	D	58.1	Low	59.1	Low	126 Å²	126	148.9 Å²	148.9	67%	0.674	77%	0.765	S	S	*	*			trans	64.1	75.6	148.2	-140.5	-105.3	0	0	0	114.5	E72 G76	E72-D74 PolarHBondContact O-N 2.78Å; E72-D74 VanDerWaalsContact O-N 3.17Å; D74-G76 PolarHBondContact O-N 3.23Å; D74-G76 VanDerWaalsContact OD1-CA 3.25Å; D74-G76 WeakPolarHBondContact OD1-CA 3.49Å; D74-G76 PolarHBondContact OD1-N 3.28Å
75	E	57.2	Low	59	Low	188 Å²	188	149.5 Å²	149.5	88%	0.879	77%	0.768	S	S	*	*			trans	-60.9	73.4	137.2	-79.7	-156.7	150.5	0	0	108.6
76	G	65.7	Low	58.9	Low	31 Å²	31	149.9 Å²	149.9	32%	0.32	77%	0.77	S	S	.	*			trans	-53.7	150.9	171.8	0	0	0	0	0	109.8	D74 A78	D74-G76 PolarHBondContact O-N 3.23Å; D74-G76 VanDerWaalsContact OD1-CA 3.25Å; D74-G76 WeakPolarHBondContact OD1-CA 3.49Å; D74-G76 PolarHBondContact OD1-N 3.28Å; G76-A78 PolarHBondContact O-N 3.35Å
77	P	64.9	Low	58.8	Low	134 Å²	134	150.3 Å²	150.3	87%	0.87	77%	0.772	S	S	*	*	S	Bend	trans	-53.8	110	-170.5	21.1	-32.8	0	0	0	110.8
78	A	60	Low	59	Low	62 Å²	62	150.9 Å²	150.9	51%	0.512	78%	0.775	S	S	.	*			trans	-1.1	122.9	169.5	0	0	0	0	0	115.2	G76 K80	G76-A78 PolarHBondContact O-N 3.35Å; A78-K80 VanDerWaalsContact C-N 3.32Å; A78-K80 HydrophobicContact CB-CD 4.48Å; A78-K80 HydrophobicContact CB-CG 4.36Å; A78-K80 WeakPolarHBondContact O-CB 3.47Å; A78-K80 WeakPolarHBondContact O-CG 3.24Å; A78-K80 PolarHBondContact O-N 3.19Å
79	L	57.3	Low	59.2	Low	188 Å²	188	147.1 Å²	147.1	98%	0.984	77%	0.771	S	S	*	*			trans	-33.6	89.1	161.9	-65.9	167.2	0	0	0	112.4
80	K	66.7	Low	59.7	Low	176 Å²	176	142.5 Å²	142.5	77%	0.765	75%	0.752	S	S	*	*			trans	-144.8	75.3	176.8	-62.9	-176.1	-168.5	-177.9	0	109.5	A78	A78-K80 VanDerWaalsContact C-N 3.32Å; A78-K80 HydrophobicContact CB-CD 4.48Å; A78-K80 HydrophobicContact CB-CG 4.36Å; A78-K80 WeakPolarHBondContact O-CB 3.47Å; A78-K80 WeakPolarHBondContact O-CG 3.24Å; A78-K80 PolarHBondContact O-N 3.19Å
81	R	60.7	Low	60.1	Low	244 Å²	244	139 Å²	139	92%	0.921	75%	0.745	S	S	*	*			trans	-136.2	87	149.9	-65.2	-166	-166.9	97.5	2	105.6
82	A	55.8	Low	60.4	Low	95 Å²	95	140.3 Å²	140.3	79%	0.785	75%	0.748	S	S	*	*				68.1	109.2	96.5	0	0	0	0	0	110.6	E84	A82-E84 PolarHBondContact O-N 3.2Å
83	A	62.7	Low	60.8	Low	106 Å²	106	141.8 Å²	141.8	88%	0.876	75%	0.746	S	S	*	*			trans	-55.1	120.5	163.2	0	0	0	0	0	109.1
84	E	54.7	Low	61.3	Low	178 Å²	178	142.4 Å²	142.4	83%	0.832	74%	0.744	S	S	*	*			trans	-140.8	109	151.8	-153.9	162.3	106.3	0	0	107.5	A82 E86	A82-E84 PolarHBondContact O-N 3.2Å; E84-E86 PolarHBondContact O-N 3.01Å
85	E	55.8	Low	62	Low	184 Å²	184	145.5 Å²	145.5	86%	0.86	75%	0.752	S	S	*	*			trans	-68.1	111.1	165.5	172.8	-169.2	147.7	0	0	107.5
86	E	55.2	Low	62.5	Low	164 Å²	164	142.5 Å²	142.5	77%	0.766	75%	0.747	S	S	*	*			trans	-123.2	100.2	149	-79.4	-145.9	111.2	0	0	107.7	E84 E88	E84-E86 PolarHBondContact O-N 3.01Å; E86-E88 PolarHBondContact O-N 3.03Å
87	D	61.1	Low	62.7	Low	139 Å²	139	149.6 Å²	149.6	74%	0.743	77%	0.771	S	S	*	*			trans	-61.1	78	157.5	-178.2	-142	0	0	0	107.7	A89	D87-A89 VanDerWaalsContact C-N 3.35Å; D87-A89 PolarHBondContact O-N 3.44Å
88	E	60.9	Low	62.8	Low	175 Å²	175	151 Å²	151	82%	0.818	77%	0.772	S	S	*	*			trans	-70.5	97.9	173.4	-155.3	170	-159.1	0	0	106.5	E86 D90	E86-E88 PolarHBondContact O-N 3.03Å; E88-D90 PolarHBondContact O-N 2.65Å
89	A	64	Low	62.8	Low	82 Å²	82	150.9 Å²	150.9	68%	0.678	78%	0.777	S	S	*	*			trans	-32.4	107.1	-176.1	0	0	0	0	0	112.6	D87 P91	D87-A89 VanDerWaalsContact C-N 3.35Å; D87-A89 PolarHBondContact O-N 3.44Å; A89-P91 WeakPolarHBondContact O-CD 3.47Å
90	D	67.1	Low	62.7	Low	74 Å²	74	146.7 Å²	146.7	40%	0.396	77%	0.769	S	S	.	*			trans	-57.6	110.2	177.7	179	7.6	0	0	0	109.4	E88 K92 R93	E88-D90 PolarHBondContact O-N 2.65Å; D90-K92 PolarHBondContact O-N 2.93Å; D90-K92 WeakPolarHBondContact OD1-CB 3.18Å; D90-K92 WeakPolarHBondContact OD1-CG 3.35Å; D90-K92 PolarHBondContact OD1-N 2.89Å; D90-R93 HydrophobicContact CB-CG 4.24Å; D90-R93 PolarHBondContact O-N 3.06Å
91	P	62.7	Low	62.3	Low	102 Å²	102	144.6 Å²	144.6	66%	0.662	78%	0.777	S	S	*	*	G	3₁₀ helix	trans	-62.4	-16	178.9	25.3	-32.2	0	0	0	111.8	A89 R93 Q94	A89-P91 WeakPolarHBondContact O-CD 3.47Å; P91-R93 PolarHBondContact O-N 3.22Å; P91-Q94 VanDerWaalsContact O-CB 3.22Å; P91-Q94 WeakPolarHBondContact O-CB 3.26Å; P91-Q94 PolarHBondContact O-N 3Å; P91-Q94 VanDerWaalsContact O-N 3.16Å
92	K	64.3	Low	62.2	Low	184 Å²	184	141.2 Å²	141.2	80%	0.8	80%	0.801	S	S	*	*	G	3₁₀ helix	trans	-69.8	-16.2	173.6	-57.1	171	-176	155.6	0	113.3	D90 Q94	D90-K92 PolarHBondContact O-N 2.93Å; D90-K92 WeakPolarHBondContact OD1-CB 3.18Å; D90-K92 WeakPolarHBondContact OD1-CG 3.35Å; D90-K92 PolarHBondContact OD1-N 2.89Å; K92-Q94 PolarHBondContact O-N 3.39Å
93	R	64.2	Low	62.5	Low	201 Å²	201	143.6 Å²	143.6	76%	0.758	80%	0.802	S	S	*	*	G	3₁₀ helix	trans	-81.2	-3.2	172.5	-65.1	-177.6	67	-165.9	-0.1	112.9	D90 P91 K95	D90-R93 HydrophobicContact CB-CG 4.24Å; D90-R93 PolarHBondContact O-N 3.06Å; P91-R93 PolarHBondContact O-N 3.22Å; R93-K95 PolarHBondContact O-N 3.16Å
94	Q	69.1	Low	62.5	Low	157 Å²	157	145.5 Å²	145.5	73%	0.734	80%	0.798	S	S	*	*			trans	-70.6	76.4	172.2	-160.2	178.8	20.4	0	0	109.8	P91 K92 T96	P91-Q94 VanDerWaalsContact O-CB 3.22Å; P91-Q94 WeakPolarHBondContact O-CB 3.26Å; P91-Q94 PolarHBondContact O-N 3Å; P91-Q94 VanDerWaalsContact O-N 3.16Å; K92-Q94 PolarHBondContact O-N 3.39Å; Q94-T96 PolarHBondContact O-N 3.44Å; Q94-T96 VanDerWaalsContact O-N 3.09Å
95	K	70.9	Confident	63	Low	192 Å²	192	143.7 Å²	143.7	84%	0.835	80%	0.796	S	S	*	*			trans	-61.4	111.8	164.5	-81.2	-176.8	174.8	-178.7	0	107.5	R93 E97	R93-K95 PolarHBondContact O-N 3.16Å; K95-E97 PolarHBondContact O-N 3.35Å
96	T	68.5	Low	63.4	Low	125 Å²	125	141.4 Å²	141.4	77%	0.767	79%	0.792	S	S	*	*			trans	-70.6	83.3	163.2	54.4	0	0	0	0	108.3	Q94 N98	Q94-T96 PolarHBondContact O-N 3.44Å; Q94-T96 VanDerWaalsContact O-N 3.09Å; T96-N98 PolarHBondContact O-N 3.01Å
97	E	70.9	Confident	63.9	Low	179 Å²	179	139.9 Å²	139.9	84%	0.836	79%	0.794	S	S	*	*			trans	-85.5	66.2	160.7	-167.7	170.9	83	0	0	108.6	K95 G99	K95-E97 PolarHBondContact O-N 3.35Å; E97-G99 VanDerWaalsContact C-N 3.33Å; E97-G99 PolarHBondContact O-N 3.22Å
98	N	66.9	Low	64.1	Low	164 Å²	164	140 Å²	140	88%	0.877	80%	0.797	S	S	*	*			trans	-85.9	89.3	150.2	-94.3	-55.5	0	0	0	105.7	T96	T96-N98 PolarHBondContact O-N 3.01Å
99	G	60.1	Low	64.3	Low	60 Å²	60	137.5 Å²	137.5	62%	0.619	80%	0.796	S	S	*	*			trans	-140.4	91.7	-176.4	0	0	0	0	0	112	E97	E97-G99 VanDerWaalsContact C-N 3.33Å; E97-G99 PolarHBondContact O-N 3.22Å
100	A	53.9	Low	64.3	Low	99 Å²	99	141.8 Å²	141.8	82%	0.818	81%	0.805	S	S	*	*			trans	79.4	92.3	161.2	0	0	0	0	0	118.3
101	S	59.8	Low	64.1	Low	133 Å²	133	147.4 Å²	147.4	93%	0.93	84%	0.839	S	S	*	*			trans	-64	121.7	131.2	-58.7	0	0	0	0	109.1
102	A	58.2	Low	64.2	Low	173 Å²	173	151.5 Å²	151.5	100%	1.43	86%	0.855	S	S	*	*			trans	-159.8	0	153.5	0	0	0	0	0	109.2

Retrieved 102 of 102 residues in 15.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).