A0A096NY83_PAPAN Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (P63210), UniProt , Accession A0A096NY83, Species PAPAN (Papio anubis, Olive baboon), Gene n/a, Length 74 aa.

						>A0A096NY83_PAPAN|A0A096NY83
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.4	Low	83.4	Confident	229 Å²	229	118.3 Å²	118.3	100%	1.128	63%	0.628	S	S	*	*				0	125.3	0	-81.3	-173.6	-74.6	0	0	107.6
2	P	79.1	Confident	84.3	Confident	103 Å²	103	120.4 Å²	120.4	67%	0.669	63%	0.628	S	S	*	*			trans	-65.2	150	169.6	28.3	-31.1	0	0	0	109.7	I4	P2-I4 HydrophobicContact CB-CG1 4.4Å; P2-I4 HydrophobicContact CG-CD1 4.1Å; P2-I4 HydrophobicContact CG-CG1 3.96Å; P2-I4 PolarHBondContact O-N 2.8Å
3	V	79.3	Confident	85	Confident	154 Å²	154	115.5 Å²	115.5	93%	0.933	60%	0.603	S	S	*	*			trans	-72.1	111.9	166.9	-178.8	0	0	0	0	106.2
4	I	80.3	Confident	85.6	Confident	75 Å²	75	112.6 Å²	112.6	39%	0.385	58%	0.583	S	S	.	*			trans	-107.8	125.6	-179.4	-58.4	169.9	0	0	0	107.3	P2 I6 L9 M17	P2-I4 HydrophobicContact CB-CG1 4.4Å; P2-I4 HydrophobicContact CG-CD1 4.1Å; P2-I4 HydrophobicContact CG-CG1 3.96Å; P2-I4 PolarHBondContact O-N 2.8Å; I4-I6 PolarHBondContact O-N 3.46Å; I4-L9 HydrophobicContact CG2-CD1 3.88Å; I4-L9 HydrophobicContact CG2-CD2 4.21Å; I4-L9 HydrophobicContact CG2-CG 4.23Å; I4-M17 HydrophobicContact CD1-CE 3.85Å; I4-M17 HydrophobicContact CD1-SD 4.48Å
5	N	84.6	Confident	86.2	Confident	84 Å²	84	111.2 Å²	111.2	45%	0.449	58%	0.576	S	S	.	*			trans	-79.9	107.6	166.6	-171.7	4.2	0	0	0	108.7	E7 D8	N5-E7 PolarHBondContact O-N 3.32Å; N5-E7 PolarHBondContact OD1-N 2.65Å; N5-D8 WeakPolarHBondContact CB-OD2 3.4Å; N5-D8 PolarHBondContact ND2-OD2 3.48Å; N5-D8 PolarHBondContact O-N 3.2Å
6	I	81.3	Confident	86.8	Confident	111 Å²	111	110.9 Å²	110.9	57%	0.569	57%	0.569	S	S	*	*	G	3₁₀ helix	trans	-65.1	-26.8	-174.1	-63.6	166.7	0	0	0	111.4	I4 D8 L9 K14	I4-I6 PolarHBondContact O-N 3.46Å; I6-D8 VanDerWaalsContact C-N 3.33Å; I6-D8 PolarHBondContact O-N 2.97Å; I6-L9 PolarHBondContact O-N 3.47Å; I6-K14 VanDerWaalsContact O-CE 3.24Å; I6-K14 WeakPolarHBondContact O-CE 3.35Å
7	E	84.6	Confident	87.2	Confident	167 Å²	167	109.1 Å²	109.1	78%	0.78	56%	0.559	S	S	*	*	G	3₁₀ helix	trans	-70.8	-28.1	-178	-62.7	179.5	174.3	0	0	112.8	N5 L9	N5-E7 PolarHBondContact O-N 3.32Å; N5-E7 PolarHBondContact OD1-N 2.65Å; E7-L9 VanDerWaalsContact C-N 3.3Å; E7-L9 PolarHBondContact O-N 3.44Å
8	D	89.3	Confident	87.6	Confident	129 Å²	129	109.1 Å²	109.1	69%	0.69	56%	0.556	S	S	*	*	G	3₁₀ helix	trans	-83.1	-5.9	-179	-63.2	-35.6	0	0	0	113.2	N5 I6	N5-D8 WeakPolarHBondContact CB-OD2 3.4Å; N5-D8 PolarHBondContact ND2-OD2 3.48Å; N5-D8 PolarHBondContact O-N 3.2Å; I6-D8 VanDerWaalsContact C-N 3.33Å; I6-D8 PolarHBondContact O-N 2.97Å
9	L	86.7	Confident	88.1	Confident	42 Å²	42	107.1 Å²	107.1	22%	0.22	55%	0.549	C	S	.	.	S	Bend	trans	-81.7	142.7	-176.3	-65	175.2	0	0	0	112.2	I4 I6 E7 D13 K14 M17	I4-L9 HydrophobicContact CG2-CD1 3.88Å; I4-L9 HydrophobicContact CG2-CD2 4.21Å; I4-L9 HydrophobicContact CG2-CG 4.23Å; I6-L9 PolarHBondContact O-N 3.47Å; E7-L9 VanDerWaalsContact C-N 3.3Å; E7-L9 PolarHBondContact O-N 3.44Å; L9-D13 HydrophobicContact CB-CB 4.45Å; L9-D13 HydrophobicContact CD2-CB 4.36Å; L9-K14 HydrophobicContact CB-CG 3.9Å; L9-K14 HydrophobicContact CD1-CG 4.33Å; L9-K14 WeakPolarHBondContact O-CE 3.41Å; L9-M17 HydrophobicContact CD1-CE 4.28Å; L9-M17 HydrophobicContact CD1-SD 3.41Å; L9-M17 WeakPolarHBondContact CD1-SD 3.24Å
10	T	92.4	Very high	88.5	Confident	79 Å²	79	106.5 Å²	106.5	49%	0.485	55%	0.547	S	S	.	.			trans	-66.1	154.1	168.4	75.6	0	0	0	0	110.1	K12 D13 K14	T10-K12 PolarHBondContact O-N 3.03Å; T10-D13 PolarHBondContact O-N 3.36Å; T10-D13 PolarHBondContact OG1-N 3.4Å; T10-D13 PolarHBondContact OG1-OD2 2.98Å; T10-K14 PolarHBondContact O-N 3.18Å
11	E	93.4	Very high	88.9	Confident	128 Å²	128	105.7 Å²	105.7	60%	0.598	54%	0.541	S	S	*	.	H	α-helix	trans	-56.9	-35.2	176.6	-158.4	65.7	-174.7	0	0	112.2	D13 K14 L15	E11-D13 VanDerWaalsContact C-N 3.34Å; E11-D13 PolarHBondContact O-N 3.27Å; E11-K14 PolarHBondContact O-N 3.28Å; E11-K14 IonicContact OE2-NZ 3.82Å; E11-L15 WeakPolarHBondContact O-CG 3.37Å; E11-L15 PolarHBondContact O-N 3.12Å
12	K	94.6	Very high	90.4	Very high	144 Å²	144	99 Å²	99	63%	0.626	51%	0.51	S	S	*	.	H	α-helix	trans	-63.8	-38.6	175.3	-175.8	178	-178.3	177.1	0	112.3	T10 K16	T10-K12 PolarHBondContact O-N 3.03Å; K12-K16 WeakPolarHBondContact O-CG 3.38Å; K12-K16 PolarHBondContact O-N 3.41Å; K12-K16 VanDerWaalsContact O-N 3.12Å
13	D	92.8	Very high	91.3	Very high	57 Å²	57	100.3 Å²	100.3	31%	0.305	51%	0.505	S	S	.	.	H	α-helix	trans	-74.8	-36.7	-179.8	-61.9	-42.6	0	0	0	111.3	L9 T10 E11 K16 M17	L9-D13 HydrophobicContact CB-CB 4.45Å; L9-D13 HydrophobicContact CD2-CB 4.36Å; T10-D13 PolarHBondContact O-N 3.36Å; T10-D13 PolarHBondContact OG1-N 3.4Å; T10-D13 PolarHBondContact OG1-OD2 2.98Å; E11-D13 VanDerWaalsContact C-N 3.34Å; E11-D13 PolarHBondContact O-N 3.27Å; D13-K16 PolarHBondContact O-N 3.05Å; D13-K16 IonicContact OD1-NZ 3.8Å; D13-M17 WeakPolarHBondContact O-CG 3.34Å; D13-M17 PolarHBondContact O-N 3.44Å
14	K	93.5	Very high	92.1	Very high	74 Å²	74	99.5 Å²	99.5	32%	0.322	49%	0.489	S	S	.	.	H	α-helix	trans	-57.5	-48.7	170.6	-66.4	176.9	-172.8	169.2	0	111.6	I6 L9 T10 E11 K16 M17 E18	I6-K14 VanDerWaalsContact O-CE 3.24Å; I6-K14 WeakPolarHBondContact O-CE 3.35Å; L9-K14 HydrophobicContact CB-CG 3.9Å; L9-K14 HydrophobicContact CD1-CG 4.33Å; L9-K14 WeakPolarHBondContact O-CE 3.41Å; T10-K14 PolarHBondContact O-N 3.18Å; E11-K14 PolarHBondContact O-N 3.28Å; E11-K14 IonicContact OE2-NZ 3.82Å; K14-K16 VanDerWaalsContact C-N 3.34Å; K14-K16 PolarHBondContact O-N 3.27Å; K14-M17 PolarHBondContact O-N 2.89Å; K14-E18 PolarHBondContact O-N 2.9Å
15	L	95.1	Very high	93	Very high	92 Å²	92	99.4 Å²	99.4	48%	0.482	49%	0.486	S	S	.	.	H	α-helix	trans	-63.3	-36.6	178.2	-71.8	173.8	0	0	0	112.8	E11 E18 V19	E11-L15 WeakPolarHBondContact O-CG 3.37Å; E11-L15 PolarHBondContact O-N 3.12Å; L15-E18 PolarHBondContact O-N 3.38Å; L15-V19 VanDerWaalsContact O-CG2 3.31Å; L15-V19 WeakPolarHBondContact O-CG2 3.39Å; L15-V19 PolarHBondContact O-N 3.41Å
16	K	95.6	Very high	93.6	Very high	107 Å²	107	100.4 Å²	100.4	47%	0.465	50%	0.495	S	S	.	.	H	α-helix	trans	-64.1	-46	173.7	-75.6	174.1	-179.2	172.6	0	111.5	K12 D13 K14 E18 V19 D20	K12-K16 WeakPolarHBondContact O-CG 3.38Å; K12-K16 PolarHBondContact O-N 3.41Å; K12-K16 VanDerWaalsContact O-N 3.12Å; D13-K16 PolarHBondContact O-N 3.05Å; D13-K16 IonicContact OD1-NZ 3.8Å; K14-K16 VanDerWaalsContact C-N 3.34Å; K14-K16 PolarHBondContact O-N 3.27Å; K16-E18 VanDerWaalsContact C-N 3.31Å; K16-E18 PolarHBondContact O-N 3.21Å; K16-V19 PolarHBondContact O-N 3.29Å; K16-D20 WeakPolarHBondContact O-CB 3.46Å; K16-D20 VanDerWaalsContact O-CG 3.31Å; K16-D20 PolarHBondContact O-N 2.98Å
17	M	92.8	Very high	94.3	Very high	79 Å²	79	100.2 Å²	100.2	39%	0.389	50%	0.5	S	S	.	.	H	α-helix	trans	-60.9	-41.4	177.1	-72.3	176.4	60.2	0	0	111.6	I4 L9 D13 K14 D20 Q21	I4-M17 HydrophobicContact CD1-CE 3.85Å; I4-M17 HydrophobicContact CD1-SD 4.48Å; L9-M17 HydrophobicContact CD1-CE 4.28Å; L9-M17 HydrophobicContact CD1-SD 3.41Å; L9-M17 WeakPolarHBondContact CD1-SD 3.24Å; D13-M17 WeakPolarHBondContact O-CG 3.34Å; D13-M17 PolarHBondContact O-N 3.44Å; K14-M17 PolarHBondContact O-N 2.89Å; M17-D20 PolarHBondContact O-N 3.46Å; M17-Q21 WeakPolarHBondContact O-CB 3.47Å; M17-Q21 PolarHBondContact O-N 3.47Å
18	E	94.6	Very high	95	Very high	110 Å²	110	97.1 Å²	97.1	51%	0.514	49%	0.488	S	S	.	.	H	α-helix	trans	-60.8	-48.3	174.9	-175.2	-179.6	-178.4	0	0	111.5	K14 L15 K16 D20 Q21 L22	K14-E18 PolarHBondContact O-N 2.9Å; L15-E18 PolarHBondContact O-N 3.38Å; K16-E18 VanDerWaalsContact C-N 3.31Å; K16-E18 PolarHBondContact O-N 3.21Å; E18-D20 VanDerWaalsContact C-N 3.33Å; E18-D20 PolarHBondContact O-N 2.92Å; E18-Q21 PolarHBondContact O-N 3.4Å; E18-L22 HydrophobicContact CG-CD1 4.18Å; E18-L22 VanDerWaalsContact O-CG 3.31Å; E18-L22 WeakPolarHBondContact O-CG 3.31Å; E18-L22 PolarHBondContact O-N 2.91Å
19	V	97.5	Very high	95.4	Very high	70 Å²	70	100.4 Å²	100.4	42%	0.424	50%	0.499	S	S	.	.	H	α-helix	trans	-61.8	-41	177.2	169.1	0	0	0	0	111.7	L15 K16 Q21 L22 K23	L15-V19 VanDerWaalsContact O-CG2 3.31Å; L15-V19 WeakPolarHBondContact O-CG2 3.39Å; L15-V19 PolarHBondContact O-N 3.41Å; K16-V19 PolarHBondContact O-N 3.29Å; V19-Q21 VanDerWaalsContact C-N 3.34Å; V19-L22 PolarHBondContact O-N 3.41Å; V19-K23 HydrophobicContact CG1-CD 4.27Å; V19-K23 WeakPolarHBondContact O-CB 3.29Å; V19-K23 VanDerWaalsContact O-CG 3.29Å; V19-K23 WeakPolarHBondContact O-CG 3.38Å; V19-K23 PolarHBondContact O-N 3.19Å
20	D	96	Very high	95.9	Very high	96 Å²	96	107 Å²	107	51%	0.513	52%	0.521	S	S	.	.	H	α-helix	trans	-66.9	-37	177.7	-71.1	-19.4	0	0	0	111.7	K16 M17 E18 K23 K24	K16-D20 WeakPolarHBondContact O-CB 3.46Å; K16-D20 VanDerWaalsContact O-CG 3.31Å; K16-D20 PolarHBondContact O-N 2.98Å; M17-D20 PolarHBondContact O-N 3.46Å; E18-D20 VanDerWaalsContact C-N 3.33Å; E18-D20 PolarHBondContact O-N 2.92Å; D20-K23 IonicContact OD1-NZ 3.9Å; D20-K24 PolarHBondContact O-N 3.03Å
21	Q	96.3	Very high	96.1	Very high	90 Å²	90	108 Å²	108	42%	0.421	52%	0.521	S	S	.	.	H	α-helix	trans	-65.8	-45.9	173.1	-179.2	59.4	28.5	0	0	111.5	M17 E18 V19 K23 K24 E25	M17-Q21 WeakPolarHBondContact O-CB 3.47Å; M17-Q21 PolarHBondContact O-N 3.47Å; E18-Q21 PolarHBondContact O-N 3.4Å; V19-Q21 VanDerWaalsContact C-N 3.34Å; Q21-K23 VanDerWaalsContact C-N 3.33Å; Q21-K23 PolarHBondContact O-N 3.22Å; Q21-K24 WeakPolarHBondContact O-CA 3.48Å; Q21-K24 WeakPolarHBondContact O-CB 3.28Å; Q21-K24 PolarHBondContact O-N 2.86Å; Q21-E25 WeakPolarHBondContact CG-OE1 3.49Å; Q21-E25 PolarHBondContact NE2-OE1 3.2Å; Q21-E25 WeakPolarHBondContact O-CG 3.31Å; Q21-E25 PolarHBondContact O-N 2.95Å
22	L	98.2	Very high	96.3	Very high	89 Å²	89	107.8 Å²	107.8	47%	0.466	52%	0.524	S	S	.	.	H	α-helix	trans	-62	-38.5	176.9	-70.8	172.4	0	0	0	112.3	E18 V19 K24 E25 V26	E18-L22 HydrophobicContact CG-CD1 4.18Å; E18-L22 VanDerWaalsContact O-CG 3.31Å; E18-L22 WeakPolarHBondContact O-CG 3.31Å; E18-L22 PolarHBondContact O-N 2.91Å; V19-L22 PolarHBondContact O-N 3.41Å; L22-K24 VanDerWaalsContact C-N 3.25Å; L22-K24 PolarHBondContact O-N 2.77Å; L22-E25 PolarHBondContact O-N 2.96Å; L22-V26 PolarHBondContact O-N 3.05Å
23	K	98	Very high	96.5	Very high	129 Å²	129	106.3 Å²	106.3	56%	0.561	53%	0.526	S	S	*	.	H	α-helix	trans	-63.5	-29.3	172.9	-76.2	172.3	-175.2	167.2	0	113.1	V19 D20 Q21 V26	V19-K23 HydrophobicContact CG1-CD 4.27Å; V19-K23 WeakPolarHBondContact O-CB 3.29Å; V19-K23 VanDerWaalsContact O-CG 3.29Å; V19-K23 WeakPolarHBondContact O-CG 3.38Å; V19-K23 PolarHBondContact O-N 3.19Å; D20-K23 IonicContact OD1-NZ 3.9Å; Q21-K23 VanDerWaalsContact C-N 3.33Å; Q21-K23 PolarHBondContact O-N 3.22Å; K23-V26 VanDerWaalsContact O-CG1 3.28Å; K23-V26 WeakPolarHBondContact O-CG1 3.36Å
24	K	97.2	Very high	96.8	Very high	137 Å²	137	107.1 Å²	107.1	60%	0.596	54%	0.537	S	S	*	.	H	α-helix	trans	-77.4	-39	173.1	-175.1	-177.4	175.4	-173.7	0	111.5	D20 Q21 L22 T27	D20-K24 PolarHBondContact O-N 3.03Å; Q21-K24 WeakPolarHBondContact O-CA 3.48Å; Q21-K24 WeakPolarHBondContact O-CB 3.28Å; Q21-K24 PolarHBondContact O-N 2.86Å; L22-K24 VanDerWaalsContact C-N 3.25Å; L22-K24 PolarHBondContact O-N 2.77Å; K24-T27 PolarHBondContact O-N 2.96Å; K24-T27 PolarHBondContact O-OG1 3.24Å
25	E	97.9	Very high	97	Very high	73 Å²	73	108.3 Å²	108.3	34%	0.341	54%	0.542	S	S	.	.	H	α-helix	trans	-71.7	-27.6	-179.2	-72.4	177.3	-163.7	0	0	113.8	Q21 L22 T27 L28 R30	Q21-E25 WeakPolarHBondContact CG-OE1 3.49Å; Q21-E25 PolarHBondContact NE2-OE1 3.2Å; Q21-E25 WeakPolarHBondContact O-CG 3.31Å; Q21-E25 PolarHBondContact O-N 2.95Å; L22-E25 PolarHBondContact O-N 2.96Å; E25-T27 VanDerWaalsContact C-N 3.31Å; E25-T27 PolarHBondContact O-N 3.43Å; E25-L28 HydrophobicContact CB-CD1 4.35Å; E25-L28 HydrophobicContact CG-CD1 4.31Å; E25-L28 WeakPolarHBondContact O-CB 3.45Å; E25-L28 PolarHBondContact O-N 3.35Å; E25-R30 PolarHBondContact O-NH1 3.47Å; E25-R30 PolarHBondContact O-NH2 3.38Å
26	V	97.7	Very high	97.1	Very high	105 Å²	105	106.2 Å²	106.2	64%	0.636	53%	0.534	S	S	*	.	H	α-helix	trans	-69.1	-31.2	177.3	70.7	0	0	0	0	112	L22 K23 L28	L22-V26 PolarHBondContact O-N 3.05Å; K23-V26 VanDerWaalsContact O-CG1 3.28Å; K23-V26 WeakPolarHBondContact O-CG1 3.36Å; V26-L28 VanDerWaalsContact C-N 3.27Å; V26-L28 PolarHBondContact O-N 3.5Å
27	T	97.2	Very high	97.2	Very high	108 Å²	108	104.7 Å²	104.7	66%	0.663	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.4	-1.9	178.5	61	0	0	0	0	113.6	K24 E25 E29	K24-T27 PolarHBondContact O-N 2.96Å; K24-T27 PolarHBondContact O-OG1 3.24Å; E25-T27 VanDerWaalsContact C-N 3.31Å; E25-T27 PolarHBondContact O-N 3.43Å; T27-E29 PolarHBondContact O-N 3.36Å
28	L	97.5	Very high	97.5	Very high	101 Å²	101	105.8 Å²	105.8	53%	0.529	54%	0.541	S	S	.	.			trans	-69.5	121.7	176.3	-67.3	173.8	0	0	0	110.5	E25 V26 R30	E25-L28 HydrophobicContact CB-CD1 4.35Å; E25-L28 HydrophobicContact CG-CD1 4.31Å; E25-L28 WeakPolarHBondContact O-CB 3.45Å; E25-L28 PolarHBondContact O-N 3.35Å; V26-L28 VanDerWaalsContact C-N 3.27Å; V26-L28 PolarHBondContact O-N 3.5Å; L28-R30 PolarHBondContact O-N 3.03Å; L28-R30 PolarHBondContact O-NH1 3.43Å
29	E	97.6	Very high	97.6	Very high	198 Å²	198	105.3 Å²	105.3	93%	0.925	54%	0.539	S	S	*	.			trans	-70	109.6	171.4	-65.3	-173	164	0	0	109.6	T27	T27-E29 PolarHBondContact O-N 3.36Å
30	R	97.6	Very high	97.7	Very high	180 Å²	180	106.5 Å²	106.5	68%	0.679	55%	0.546	S	S	*	.	P	Polyproline II helix	trans	-86.9	134.3	179.3	-67	169.2	-179.1	71.6	0.8	109.3	E25 L28	E25-R30 PolarHBondContact O-NH1 3.47Å; E25-R30 PolarHBondContact O-NH2 3.38Å; L28-R30 PolarHBondContact O-N 3.03Å; L28-R30 PolarHBondContact O-NH1 3.43Å
31	M	97.1	Very high	97.8	Very high	100 Å²	100	107.6 Å²	107.6	49%	0.493	54%	0.543	S	S	.	.	P	Polyproline II helix	trans	-75.6	151.3	172.1	-165.5	177.8	-57.8	0	0	110.5	V33 K35	M31-V33 PolarHBondContact O-N 3.33Å; M31-K35 HydrophobicContact CG-CB 4.45Å; M31-K35 HydrophobicContact CG-CD 4.1Å; M31-K35 HydrophobicContact CG-CG 4.47Å; M31-K35 HydrophobicContact SD-CD 3.81Å; M31-K35 HydrophobicContact SD-CG 4.02Å
32	L	98.2	Very high	97.8	Very high	125 Å²	125	106.5 Å²	106.5	65%	0.654	54%	0.54	S	S	*	.	P	Polyproline II helix	trans	-61.1	133.9	174.4	-69	176.4	0	0	0	110.6	S34 K35 C36	L32-S34 VanDerWaalsContact C-N 3.27Å; L32-S34 PolarHBondContact O-N 3.17Å; L32-K35 HydrophobicContact CB-CB 4.26Å; L32-K35 PolarHBondContact O-N 3.14Å; L32-K35 VanDerWaalsContact O-N 3.15Å; L32-C36 PolarHBondContact O-N 3.46Å; L32-C36 PolarHBondContact O-SG 3.23Å
33	V	98.3	Very high	97.8	Very high	112 Å²	112	108.9 Å²	108.9	68%	0.679	54%	0.543	S	S	*	.	H	α-helix	trans	-58.3	-40.9	178.4	178	0	0	0	0	111.1	M31 K35 C36 C37	M31-V33 PolarHBondContact O-N 3.33Å; V33-K35 VanDerWaalsContact C-N 3.33Å; V33-K35 PolarHBondContact O-N 3.23Å; V33-C36 PolarHBondContact O-N 3.45Å; V33-C37 WeakPolarHBondContact O-CB 3.26Å; V33-C37 PolarHBondContact O-N 3.15Å; V33-C37 PolarHBondContact O-SG 2.89Å
34	S	98.1	Very high	97.8	Very high	74 Å²	74	106.6 Å²	106.6	52%	0.517	54%	0.54	S	S	.	.	H	α-helix	trans	-56.8	-45.4	176.9	51.8	0	0	0	0	112.4	L32 C37 E38	L32-S34 VanDerWaalsContact C-N 3.27Å; L32-S34 PolarHBondContact O-N 3.17Å; S34-C37 PolarHBondContact O-N 3.39Å; S34-E38 WeakPolarHBondContact O-CG 3.49Å; S34-E38 PolarHBondContact O-N 2.69Å
35	K	97.8	Very high	97.8	Very high	99 Å²	99	105.9 Å²	105.9	43%	0.43	54%	0.539	S	S	.	.	H	α-helix	trans	-65.5	-43.2	177.2	-176.8	176.5	173.5	-175.9	0	111.9	M31 L32 V33 C37 E38 E39	M31-K35 HydrophobicContact CG-CB 4.45Å; M31-K35 HydrophobicContact CG-CD 4.1Å; M31-K35 HydrophobicContact CG-CG 4.47Å; M31-K35 HydrophobicContact SD-CD 3.81Å; M31-K35 HydrophobicContact SD-CG 4.02Å; L32-K35 HydrophobicContact CB-CB 4.26Å; L32-K35 PolarHBondContact O-N 3.14Å; L32-K35 VanDerWaalsContact O-N 3.15Å; V33-K35 VanDerWaalsContact C-N 3.33Å; V33-K35 PolarHBondContact O-N 3.23Å; K35-C37 VanDerWaalsContact C-N 3.29Å; K35-C37 PolarHBondContact O-N 3.33Å; K35-E38 PolarHBondContact O-N 3.03Å; K35-E39 WeakPolarHBondContact CE-OE1 3.04Å; K35-E39 IonicContact NZ-OE1 3.44Å; K35-E39 PolarHBondContact O-N 2.86Å
36	C	98.1	Very high	97.8	Very high	48 Å²	48	108.8 Å²	108.8	32%	0.324	55%	0.553	S	S	.	*	H	α-helix	trans	-60.8	-41.3	176.4	-59.4	0	0	0	0	111.3	L32 V33 E39 V40	L32-C36 PolarHBondContact O-N 3.46Å; L32-C36 PolarHBondContact O-SG 3.23Å; V33-C36 PolarHBondContact O-N 3.45Å; C36-E39 PolarHBondContact O-N 3.36Å; C36-V40 WeakPolarHBondContact O-CB 3.37Å; C36-V40 VanDerWaalsContact O-CG2 3.26Å; C36-V40 WeakPolarHBondContact O-CG2 3.39Å; C36-V40 PolarHBondContact O-N 3.11Å
37	C	97.9	Very high	97.8	Very high	76 Å²	76	108.9 Å²	108.9	51%	0.514	54%	0.542	S	S	.	.	H	α-helix	trans	-64.5	-39.7	177.5	-69.6	0	0	0	0	112.3	V33 S34 K35 R41	V33-C37 WeakPolarHBondContact O-CB 3.26Å; V33-C37 PolarHBondContact O-N 3.15Å; V33-C37 PolarHBondContact O-SG 2.89Å; S34-C37 PolarHBondContact O-N 3.39Å; K35-C37 VanDerWaalsContact C-N 3.29Å; K35-C37 PolarHBondContact O-N 3.33Å; C37-R41 VanDerWaalsContact O-CB 3.24Å; C37-R41 WeakPolarHBondContact O-CB 3.19Å; C37-R41 PolarHBondContact O-N 3.47Å
38	E	98.1	Very high	97.7	Very high	102 Å²	102	105.7 Å²	105.7	48%	0.477	52%	0.524	S	S	.	.	H	α-helix	trans	-61.4	-51.3	174.4	-74.2	170.9	-176	0	0	111.1	S34 K35 V40 R41 D42	S34-E38 WeakPolarHBondContact O-CG 3.49Å; S34-E38 PolarHBondContact O-N 2.69Å; K35-E38 PolarHBondContact O-N 3.03Å; E38-V40 VanDerWaalsContact C-N 3.34Å; E38-V40 PolarHBondContact O-N 2.92Å; E38-R41 PolarHBondContact O-N 2.91Å; E38-D42 WeakPolarHBondContact O-CB 3.31Å; E38-D42 PolarHBondContact O-N 3.06Å
39	E	98.1	Very high	97.5	Very high	100 Å²	100	102.9 Å²	102.9	47%	0.467	52%	0.519	S	S	.	.	H	α-helix	trans	-60.6	-41.9	179.7	-69.8	178	-173.6	0	0	112.3	K35 C36 Y43	K35-E39 WeakPolarHBondContact CE-OE1 3.04Å; K35-E39 IonicContact NZ-OE1 3.44Å; K35-E39 PolarHBondContact O-N 2.86Å; C36-E39 PolarHBondContact O-N 3.36Å; E39-Y43 VanDerWaalsContact O-CB 3.31Å; E39-Y43 WeakPolarHBondContact O-CB 3.24Å; E39-Y43 PolarHBondContact O-N 3.01Å
40	V	98.3	Very high	97.3	Very high	95 Å²	95	101.4 Å²	101.4	58%	0.576	51%	0.512	S	S	*	.	H	α-helix	trans	-66.8	-44.3	176.8	171.1	0	0	0	0	111.4	C36 E38 Y43 V44	C36-V40 WeakPolarHBondContact O-CB 3.37Å; C36-V40 VanDerWaalsContact O-CG2 3.26Å; C36-V40 WeakPolarHBondContact O-CG2 3.39Å; C36-V40 PolarHBondContact O-N 3.11Å; E38-V40 VanDerWaalsContact C-N 3.34Å; E38-V40 PolarHBondContact O-N 2.92Å; V40-Y43 PolarHBondContact O-N 3.22Å; V40-V44 HydrophobicContact CG1-CG2 4.5Å; V40-V44 VanDerWaalsContact O-CG2 3.29Å; V40-V44 WeakPolarHBondContact O-CG2 3.25Å; V40-V44 PolarHBondContact O-N 2.82Å
41	R	97.8	Very high	97.2	Very high	118 Å²	118	96 Å²	96	45%	0.445	50%	0.497	S	S	.	.	H	α-helix	trans	-58.8	-52.6	176.8	177.1	-161.5	64.4	-154.4	-5.3	110.1	C37 E38 Y43 V44 E45	C37-R41 VanDerWaalsContact O-CB 3.24Å; C37-R41 WeakPolarHBondContact O-CB 3.19Å; C37-R41 PolarHBondContact O-N 3.47Å; E38-R41 PolarHBondContact O-N 2.91Å; R41-Y43 VanDerWaalsContact C-N 3.3Å; R41-Y43 PolarHBondContact O-N 3.37Å; R41-V44 PolarHBondContact O-N 2.98Å; R41-V44 VanDerWaalsContact O-N 3.13Å; R41-E45 WeakPolarHBondContact CD-OE1 3.39Å; R41-E45 HydrophobicContact CG-CG 4.1Å; R41-E45 WeakPolarHBondContact CG-OE1 3.17Å; R41-E45 WeakPolarHBondContact O-CB 3.49Å; R41-E45 WeakPolarHBondContact O-CG 3.29Å; R41-E45 PolarHBondContact O-N 3.04Å
42	D	98	Very high	97.1	Very high	67 Å²	67	94.5 Å²	94.5	36%	0.358	49%	0.494	S	S	.	.	H	α-helix	trans	-60.7	-43.2	-176.1	-64.2	-5.7	0	0	0	110.2	E38 V44 E45 E46	E38-D42 WeakPolarHBondContact O-CB 3.31Å; E38-D42 PolarHBondContact O-N 3.06Å; D42-V44 VanDerWaalsContact C-N 3.35Å; D42-V44 PolarHBondContact O-N 3.02Å; D42-E45 PolarHBondContact O-N 3.22Å; D42-E46 WeakPolarHBondContact O-CB 3.17Å; D42-E46 VanDerWaalsContact O-CG 3.25Å; D42-E46 WeakPolarHBondContact O-CG 3.44Å; D42-E46 PolarHBondContact O-N 3.41Å
43	Y	98.3	Very high	96.9	Very high	139 Å²	139	96 Å²	96	55%	0.545	50%	0.502	S	S	.	.	H	α-helix	trans	-58	-44.8	175.5	179.6	-90.6	0	0	0	113	E39 V40 R41 R47	E39-Y43 VanDerWaalsContact O-CB 3.31Å; E39-Y43 WeakPolarHBondContact O-CB 3.24Å; E39-Y43 PolarHBondContact O-N 3.01Å; V40-Y43 PolarHBondContact O-N 3.22Å; R41-Y43 VanDerWaalsContact C-N 3.3Å; R41-Y43 PolarHBondContact O-N 3.37Å; Y43-R47 VanDerWaalsContact CD2-NH1 3.31Å; Y43-R47 VanDerWaalsContact CE2-NE 3.32Å; Y43-R47 PolarHBondContact O-NH1 3.48Å
44	V	98	Very high	96.7	Very high	82 Å²	82	95.1 Å²	95.1	50%	0.497	50%	0.497	S	S	.	.	H	α-helix	trans	-71.1	-46.2	-179.6	171.7	0	0	0	0	110.7	V40 R41 D42 E46 R47 S48	V40-V44 HydrophobicContact CG1-CG2 4.5Å; V40-V44 VanDerWaalsContact O-CG2 3.29Å; V40-V44 WeakPolarHBondContact O-CG2 3.25Å; V40-V44 PolarHBondContact O-N 2.82Å; R41-V44 PolarHBondContact O-N 2.98Å; R41-V44 VanDerWaalsContact O-N 3.13Å; D42-V44 VanDerWaalsContact C-N 3.35Å; D42-V44 PolarHBondContact O-N 3.02Å; V44-E46 PolarHBondContact O-N 2.91Å; V44-R47 PolarHBondContact O-N 3.06Å; V44-S48 WeakPolarHBondContact O-CB 3.48Å; V44-S48 PolarHBondContact O-N 2.91Å; V44-S48 PolarHBondContact O-OG 3.46Å
45	E	97.3	Very high	96.5	Very high	121 Å²	121	98.8 Å²	98.8	57%	0.565	50%	0.503	S	S	*	.	H	α-helix	trans	-61	-44.2	-179.1	-75.3	-177.2	178.3	0	0	111.7	R41 D42 R47 S48	R41-E45 WeakPolarHBondContact CD-OE1 3.39Å; R41-E45 HydrophobicContact CG-CG 4.1Å; R41-E45 WeakPolarHBondContact CG-OE1 3.17Å; R41-E45 WeakPolarHBondContact O-CB 3.49Å; R41-E45 WeakPolarHBondContact O-CG 3.29Å; R41-E45 PolarHBondContact O-N 3.04Å; D42-E45 PolarHBondContact O-N 3.22Å; E45-R47 PolarHBondContact O-N 3.35Å; E45-S48 PolarHBondContact O-OG 3.26Å
46	E	97.5	Very high	96.1	Very high	135 Å²	135	96.2 Å²	96.2	63%	0.631	51%	0.505	S	S	*	.	H	α-helix	trans	-56.1	-36.1	176.1	-78.1	176.7	177	0	0	113.3	D42 V44	D42-E46 WeakPolarHBondContact O-CB 3.17Å; D42-E46 VanDerWaalsContact O-CG 3.25Å; D42-E46 WeakPolarHBondContact O-CG 3.44Å; D42-E46 PolarHBondContact O-N 3.41Å; V44-E46 PolarHBondContact O-N 2.91Å
47	R	96.5	Very high	95.7	Very high	107 Å²	107	97.1 Å²	97.1	40%	0.404	51%	0.506	S	S	.	.	H	α-helix	trans	-105	-22.3	-170.5	-70.1	165.9	-173.5	67.8	7.7	113.9	Y43 V44 E45 G49 E50 D51	Y43-R47 VanDerWaalsContact CD2-NH1 3.31Å; Y43-R47 VanDerWaalsContact CE2-NE 3.32Å; Y43-R47 PolarHBondContact O-NH1 3.48Å; V44-R47 PolarHBondContact O-N 3.06Å; E45-R47 PolarHBondContact O-N 3.35Å; R47-G49 PolarHBondContact O-N 3.04Å; R47-G49 VanDerWaalsContact O-N 3.08Å; R47-E50 PolarHBondContact O-N 3.44Å; R47-D51 PolarHBondContact O-N 3.49Å; R47-D51 VanDerWaalsContact O-N 3.15Å
48	S	95.5	Very high	95.3	Very high	41 Å²	41	96.8 Å²	96.8	29%	0.287	50%	0.503	S	S	.	.	H	α-helix	trans	-58	-24.9	179.5	65	0	0	0	0	113.2	V44 E45 E50	V44-S48 WeakPolarHBondContact O-CB 3.48Å; V44-S48 PolarHBondContact O-N 2.91Å; V44-S48 PolarHBondContact O-OG 3.46Å; E45-S48 PolarHBondContact O-OG 3.26Å; S48-E50 VanDerWaalsContact C-N 3.27Å; S48-E50 PolarHBondContact O-N 3.12Å
49	G	93.7	Very high	94.5	Very high	42 Å²	42	98.6 Å²	98.6	43%	0.433	51%	0.511	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.5	-24.6	174.3	0	0	0	0	0	114.4	R47 K55	R47-G49 PolarHBondContact O-N 3.04Å; R47-G49 VanDerWaalsContact O-N 3.08Å; G49-K55 VanDerWaalsContact O-CG 3.22Å; G49-K55 WeakPolarHBondContact O-CG 3.25Å
50	E	93.6	Very high	93.9	Very high	167 Å²	167	99.8 Å²	99.8	78%	0.78	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	-107	-10.8	-178.7	-62.5	179.3	-171	0	0	112.4	R47 S48 P52	R47-E50 PolarHBondContact O-N 3.44Å; S48-E50 VanDerWaalsContact C-N 3.27Å; S48-E50 PolarHBondContact O-N 3.12Å; E50-P52 WeakPolarHBondContact O-CD 3.46Å
51	D	95.7	Very high	93.4	Very high	67 Å²	67	102.4 Å²	102.4	36%	0.358	52%	0.524	S	S	.	.			trans	-64.4	113.8	178.4	-173.1	-28.5	0	0	0	110	R47 L53 V54 K55	R47-D51 PolarHBondContact O-N 3.49Å; R47-D51 VanDerWaalsContact O-N 3.15Å; D51-L53 PolarHBondContact O-N 3.01Å; D51-L53 WeakPolarHBondContact OD1-CA 3.42Å; D51-L53 WeakPolarHBondContact OD1-CB 3.44Å; D51-L53 PolarHBondContact OD1-N 3.15Å; D51-V54 HydrophobicContact CB-CB 3.95Å; D51-V54 HydrophobicContact CB-CG2 3.73Å; D51-V54 PolarHBondContact O-N 2.96Å; D51-K55 PolarHBondContact O-N 2.9Å
52	P	93.5	Very high	92.9	Very high	68 Å²	68	99.1 Å²	99.1	44%	0.442	52%	0.516	S	S	.	.	H	α-helix	trans	-67.4	-20.4	-176.8	-14.7	28.4	0	0	0	113.6	E50 G56 I57	E50-P52 WeakPolarHBondContact O-CD 3.46Å; P52-G56 CarbonylContact O-C 3.19Å; P52-G56 WeakPolarHBondContact O-CA 3.06Å; P52-G56 PolarHBondContact O-N 3.45Å; P52-I57 HydrophobicContact CB-CD1 4.04Å; P52-I57 HydrophobicContact CB-CG1 3.3Å
53	L	94.4	Very high	92.5	Very high	157 Å²	157	101.4 Å²	101.4	82%	0.822	53%	0.534	S	S	*	.	H	α-helix	trans	-82.1	-18.6	174.4	-59.4	-179.1	0	0	0	112.2	D51	D51-L53 PolarHBondContact O-N 3.01Å; D51-L53 WeakPolarHBondContact OD1-CA 3.42Å; D51-L53 WeakPolarHBondContact OD1-CB 3.44Å; D51-L53 PolarHBondContact OD1-N 3.15Å
54	V	95.2	Very high	91.9	Very high	92 Å²	92	103.3 Å²	103.3	56%	0.558	55%	0.546	S	S	*	.	H	α-helix	trans	-89.4	-46.1	173	178.8	0	0	0	0	111.2	D51	D51-V54 HydrophobicContact CB-CB 3.95Å; D51-V54 HydrophobicContact CB-CG2 3.73Å; D51-V54 PolarHBondContact O-N 2.96Å
55	K	92.9	Very high	90.7	Very high	151 Å²	151	104.1 Å²	104.1	66%	0.657	54%	0.542	S	S	*	.	H	α-helix	trans	-88.8	-17.5	-178	-69.6	-60.6	-175.9	-179.5	0	115	G49 D51	G49-K55 VanDerWaalsContact O-CG 3.22Å; G49-K55 WeakPolarHBondContact O-CG 3.25Å; D51-K55 PolarHBondContact O-N 2.9Å
56	G	90.4	Very high	89.6	Confident	45 Å²	45	106.6 Å²	106.6	46%	0.464	55%	0.554	S	S	.	*			trans	85.3	148.6	-167.5	0	0	0	0	0	111.9	P52	P52-G56 CarbonylContact O-C 3.19Å; P52-G56 WeakPolarHBondContact O-CA 3.06Å; P52-G56 PolarHBondContact O-N 3.45Å
57	I	89.9	Confident	88.1	Confident	67 Å²	67	107.4 Å²	107.4	34%	0.344	56%	0.562	S	S	.	*			trans	-95.3	123	175.3	-56.4	157.1	0	0	0	108.2	P52 K61 N62	P52-I57 HydrophobicContact CB-CD1 4.04Å; P52-I57 HydrophobicContact CB-CG1 3.3Å; I57-K61 HydrophobicContact CG2-CB 4.2Å; I57-N62 HydrophobicContact CB-CB 4.34Å; I57-N62 HydrophobicContact CG2-CB 3.79Å
58	P	87.9	Confident	86.3	Confident	69 Å²	69	112.6 Å²	112.6	45%	0.448	59%	0.587	S	S	.	*			trans	-53.9	139.5	171.1	-26.5	35.6	0	0	0	111.4	D60 K61 N62	P58-D60 WeakPolarHBondContact CB-OD1 3.49Å; P58-D60 PolarHBondContact O-N 3.08Å; P58-D60 VanDerWaalsContact O-N 3.12Å; P58-K61 CarbonylContact O-C 3.54Å; P58-K61 PolarHBondContact O-N 2.77Å; P58-N62 PolarHBondContact O-N 3.24Å
59	E	83.1	Confident	84.3	Confident	140 Å²	140	113.1 Å²	113.1	65%	0.654	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.9	-35.1	-174.2	-72.8	-168	172.7	0	0	113.7	K61 N62 K65	E59-K61 VanDerWaalsContact C-N 3.27Å; E59-K61 PolarHBondContact O-N 3.2Å; E59-N62 PolarHBondContact O-N 2.92Å; E59-K65 VanDerWaalsContact O-CD 3.25Å; E59-K65 WeakPolarHBondContact O-CD 3.22Å; E59-K65 IonicContact OE2-NZ 3.7Å; E59-K65 PolarHBondContact OE2-NZ 2.81Å
60	D	84.7	Confident	82.4	Confident	125 Å²	125	114.1 Å²	114.1	67%	0.668	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.5	-24.9	177.9	61.1	-56.7	0	0	0	113.3	P58	P58-D60 WeakPolarHBondContact CB-OD1 3.49Å; P58-D60 PolarHBondContact O-N 3.08Å; P58-D60 VanDerWaalsContact O-N 3.12Å
61	K	87.6	Confident	80.5	Confident	150 Å²	150	112 Å²	112	65%	0.652	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.8	-9	177.8	-61.7	-172.6	-178	179.4	0	113.3	I57 P58 E59 P63	I57-K61 HydrophobicContact CG2-CB 4.2Å; P58-K61 CarbonylContact O-C 3.54Å; P58-K61 PolarHBondContact O-N 2.77Å; E59-K61 VanDerWaalsContact C-N 3.27Å; E59-K61 PolarHBondContact O-N 3.2Å; K61-P63 WeakPolarHBondContact O-CD 3.34Å
62	N	88.4	Confident	78.7	Confident	50 Å²	50	114.3 Å²	114.3	27%	0.267	63%	0.628	S	S	.	*			trans	-73.4	113.1	-179.3	-171.7	-10.2	0	0	0	110.2	I57 P58 E59 F64 K65	I57-N62 HydrophobicContact CB-CB 4.34Å; I57-N62 HydrophobicContact CG2-CB 3.79Å; P58-N62 PolarHBondContact O-N 3.24Å; E59-N62 PolarHBondContact O-N 2.92Å; N62-F64 PolarHBondContact O-N 3.45Å; N62-F64 VanDerWaalsContact O-N 3.11Å; N62-F64 PolarHBondContact OD1-N 3.01Å; N62-K65 HydrophobicContact CB-CB 4.48Å; N62-K65 WeakPolarHBondContact O-CB 3.13Å; N62-K65 PolarHBondContact O-N 3.42Å
63	P	87.9	Confident	76.9	Confident	114 Å²	114	118.7 Å²	118.7	74%	0.74	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.9	-19.5	177.9	-19.7	33.9	0	0	0	113.1	K61	K61-P63 WeakPolarHBondContact O-CD 3.34Å
64	F	86.9	Confident	75.2	Confident	179 Å²	179	119.5 Å²	119.5	79%	0.785	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.6	19.6	178.2	-52.5	-79.8	0	0	0	112.4	N62 E66	N62-F64 PolarHBondContact O-N 3.45Å; N62-F64 VanDerWaalsContact O-N 3.11Å; N62-F64 PolarHBondContact OD1-N 3.01Å; F64-E66 PolarHBondContact O-N 3.33Å
65	K	73.4	Confident	74.2	Confident	99 Å²	99	120.9 Å²	120.9	43%	0.43	67%	0.67	S	S	.	*			trans	-49.8	137.4	169.2	-170.2	-175.1	-163.3	142	0	108.5	E59 N62 L67	E59-K65 VanDerWaalsContact O-CD 3.25Å; E59-K65 WeakPolarHBondContact O-CD 3.22Å; E59-K65 IonicContact OE2-NZ 3.7Å; E59-K65 PolarHBondContact OE2-NZ 2.81Å; N62-K65 HydrophobicContact CB-CB 4.48Å; N62-K65 WeakPolarHBondContact O-CB 3.13Å; N62-K65 PolarHBondContact O-N 3.42Å; K65-L67 PolarHBondContact O-N 3.38Å
66	E	72.6	Confident	73.2	Confident	173 Å²	173	119.3 Å²	119.3	81%	0.808	67%	0.671	S	S	*	*			trans	-52.5	110.3	172	-70.8	-167.3	167.6	0	0	108.9	F64 K68	F64-E66 PolarHBondContact O-N 3.33Å; E66-K68 PolarHBondContact O-N 3.13Å
67	L	65.7	Low	72.2	Confident	152 Å²	152	123.4 Å²	123.4	80%	0.796	68%	0.683	S	S	*	*			trans	-59.1	106.4	165.5	-77.3	160.7	0	0	0	105	K65 G69 G70	K65-L67 PolarHBondContact O-N 3.38Å; L67-G69 PolarHBondContact O-N 3.37Å; L67-G70 PolarHBondContact O-N 2.87Å
68	K	59.2	Low	71.2	Confident	216 Å²	216	126.7 Å²	126.7	94%	0.939	70%	0.703	S	S	*	*	S	Bend	trans	-64.6	75.5	163.8	-69.6	-167.2	177.7	-175.1	0	107.3	E66	E66-K68 PolarHBondContact O-N 3.13Å
69	G	54.3	Low	70.1	Confident	52 Å²	52	130.3 Å²	130.3	54%	0.536	72%	0.719	S	S	.	*	S	Bend	trans	159.7	36.9	-163.7	0	0	0	0	0	112.8	L67	L67-G69 PolarHBondContact O-N 3.37Å
70	G	53.5	Low	69.3	Low	64 Å²	64	129.7 Å²	129.7	66%	0.66	72%	0.723	S	S	*	*			trans	-48.9	145.3	167.9	0	0	0	0	0	111.1	L67 V72	L67-G70 PolarHBondContact O-N 2.87Å; G70-V72 PolarHBondContact O-N 3.23Å; G70-V72 VanDerWaalsContact O-N 3.14Å
71	C	53.1	Low	68.2	Low	121 Å²	121	130 Å²	130	82%	0.818	73%	0.727	S	S	*	*			trans	-6.6	98.2	-178.6	-151.5	0	0	0	0	114.6	I73	C71-I73 PolarHBondContact O-N 2.91Å; C71-I73 VanDerWaalsContact O-N 3.17Å
72	V	58.6	Low	66.7	Low	117 Å²	117	128.5 Å²	128.5	71%	0.709	73%	0.732	S	S	*	*			trans	-75.3	102.9	166.4	-169.8	0	0	0	0	106.2	G70 S74	G70-V72 PolarHBondContact O-N 3.23Å; G70-V72 VanDerWaalsContact O-N 3.14Å; V72-S74 PolarHBondContact O-N 3.04Å
73	I	55.8	Low	64.9	Low	159 Å²	159	135 Å²	135	82%	0.815	77%	0.771	S	S	*	*			trans	-79.8	102.4	165	-50.6	174.5	0	0	0	105.7	C71	C71-I73 PolarHBondContact O-N 2.91Å; C71-I73 VanDerWaalsContact O-N 3.17Å
74	S	57.4	Low	62.8	Low	174 Å²	174	136.9 Å²	136.9	100%	1.217	77%	0.774	S	S	*	*			trans	-123.7	0	162.4	-72.3	0	0	0	0	108.9	V72	V72-S74 PolarHBondContact O-N 3.04Å

Retrieved 74 of 74 residues in 197.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).