A0A3Q0KEZ7_SCHMA Loading...

Uncharacterized protein

AlphaFold DB (C4Q8P7), UniProt , Accession A0A3Q0KEZ7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 115 aa.

						>A0A3Q0KEZ7_SCHMA|A0A3Q0KEZ7
MTRYSLLGIIQLFISYQIFCLLFICAHGSSRCTTTVNSDGLPILTCDHDRLKVQSHFDIYNDEQNELIPESDYSNDPLQSQQSAEYIMPSKKAFVRLGKRGFVRIGKRGFVRIGR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.2	Low	76.3	Confident	223 Å²	223	128 Å²	128	100%	1.099	64%	0.642	S	S	*	*				0	-29.5	0	-70.3	-81.4	177.6	0	0	113.3
2	T	65	Low	77.2	Confident	110 Å²	110	127.5 Å²	127.5	68%	0.675	64%	0.642	S	S	*	*	H	α-helix	trans	-74	-26	-174.4	47.3	0	0	0	0	116.5	Y4 S5 L6	T2-Y4 PolarHBondContact O-N 3.45Å; T2-S5 PolarHBondContact O-N 3.18Å; T2-L6 PolarHBondContact O-N 3.4Å
3	R	62.4	Low	78.3	Confident	207 Å²	207	127.5 Å²	127.5	78%	0.781	64%	0.635	S	S	*	*	H	α-helix	trans	-63.9	-36.3	-176.3	-70.4	-172.9	178.1	176.2	-0.5	114.1	S5 L6 L7	R3-S5 VanDerWaalsContact C-N 3.31Å; R3-S5 PolarHBondContact O-N 2.95Å; R3-L6 PolarHBondContact O-N 3.4Å; R3-L7 WeakPolarHBondContact O-CG 3.47Å; R3-L7 PolarHBondContact O-N 3.49Å
4	Y	69.7	Low	79.3	Confident	201 Å²	201	124.8 Å²	124.8	79%	0.788	62%	0.623	S	S	*	*	H	α-helix	trans	-66.7	-33.9	176.8	-74.4	-75.4	0	0	0	112.4	T2 G8	T2-Y4 PolarHBondContact O-N 3.45Å; Y4-G8 PolarHBondContact O-N 3.21Å
5	S	75.9	Confident	80	Confident	76 Å²	76	120.9 Å²	120.9	53%	0.531	61%	0.612	S	S	.	*	H	α-helix	trans	-67.6	-45.5	177.3	-178.4	0	0	0	0	111.7	T2 R3 L7 G8 I9	T2-S5 PolarHBondContact O-N 3.18Å; R3-S5 VanDerWaalsContact C-N 3.31Å; R3-S5 PolarHBondContact O-N 2.95Å; S5-L7 PolarHBondContact O-N 3.48Å; S5-G8 PolarHBondContact O-N 2.98Å; S5-I9 WeakPolarHBondContact O-CG1 3.43Å; S5-I9 PolarHBondContact O-N 3.24Å
6	L	79	Confident	80.8	Confident	105 Å²	105	122.4 Å²	122.4	55%	0.55	61%	0.609	S	S	.	*	H	α-helix	trans	-62.7	-42.2	178.2	-70.4	174	0	0	0	112.6	T2 R3 G8 I9 I10	T2-L6 PolarHBondContact O-N 3.4Å; R3-L6 PolarHBondContact O-N 3.4Å; L6-G8 VanDerWaalsContact C-N 3.33Å; L6-G8 PolarHBondContact O-N 2.97Å; L6-I9 PolarHBondContact O-N 3.29Å; L6-I10 WeakPolarHBondContact O-CD1 3.48Å; L6-I10 VanDerWaalsContact O-CG1 3.26Å; L6-I10 WeakPolarHBondContact O-CG1 3.39Å; L6-I10 PolarHBondContact O-N 3.46Å
7	L	83.3	Confident	81.5	Confident	108 Å²	108	120.1 Å²	120.1	57%	0.565	60%	0.596	S	S	*	*	H	α-helix	trans	-61	-42.1	176.2	-73.4	169	0	0	0	111.8	R3 S5 I10 Q11	R3-L7 WeakPolarHBondContact O-CG 3.47Å; R3-L7 PolarHBondContact O-N 3.49Å; S5-L7 PolarHBondContact O-N 3.48Å; L7-I10 PolarHBondContact O-N 3.27Å; L7-Q11 WeakPolarHBondContact O-CB 3.33Å; L7-Q11 PolarHBondContact O-N 3.22Å
8	G	85	Confident	82	Confident	38 Å²	38	118.4 Å²	118.4	39%	0.392	59%	0.589	S	S	.	*	H	α-helix	trans	-61.7	-42.9	175.7	0	0	0	0	0	112.9	Y4 S5 L6 Q11 L12	Y4-G8 PolarHBondContact O-N 3.21Å; S5-G8 PolarHBondContact O-N 2.98Å; L6-G8 VanDerWaalsContact C-N 3.33Å; L6-G8 PolarHBondContact O-N 2.97Å; G8-Q11 PolarHBondContact O-N 3.3Å; G8-L12 WeakPolarHBondContact O-CB 3.26Å; G8-L12 PolarHBondContact O-N 3.04Å
9	I	86.5	Confident	82.3	Confident	103 Å²	103	119.4 Å²	119.4	53%	0.528	59%	0.59	S	S	.	*	H	α-helix	trans	-64.5	-44.7	177.6	-64.6	161.8	0	0	0	111	S5 L6 Q11 L12 F13	S5-I9 WeakPolarHBondContact O-CG1 3.43Å; S5-I9 PolarHBondContact O-N 3.24Å; L6-I9 PolarHBondContact O-N 3.29Å; I9-Q11 VanDerWaalsContact C-N 3.34Å; I9-Q11 PolarHBondContact O-N 3.44Å; I9-L12 PolarHBondContact O-N 3.37Å; I9-F13 PolarHBondContact O-N 3.33Å
10	I	87.9	Confident	82.6	Confident	94 Å²	94	115.2 Å²	115.2	48%	0.482	57%	0.572	S	S	.	*	H	α-helix	trans	-61.5	-44.8	177.6	-67.5	163.1	0	0	0	110.3	L6 L7 L12 F13 I14	L6-I10 WeakPolarHBondContact O-CD1 3.48Å; L6-I10 VanDerWaalsContact O-CG1 3.26Å; L6-I10 WeakPolarHBondContact O-CG1 3.39Å; L6-I10 PolarHBondContact O-N 3.46Å; L7-I10 PolarHBondContact O-N 3.27Å; I10-L12 VanDerWaalsContact C-N 3.33Å; I10-L12 PolarHBondContact O-N 3.48Å; I10-F13 PolarHBondContact O-N 3.39Å; I10-I14 HydrophobicContact CG2-CD1 3.7Å; I10-I14 HydrophobicContact CG2-CG1 4.38Å; I10-I14 VanDerWaalsContact O-CG1 3.28Å; I10-I14 WeakPolarHBondContact O-CG1 3.43Å; I10-I14 PolarHBondContact O-N 2.93Å
11	Q	86.8	Confident	82.7	Confident	143 Å²	143	114.7 Å²	114.7	67%	0.668	57%	0.571	S	S	*	*	H	α-helix	trans	-62.4	-40.7	178.6	-173.6	172.8	-14.3	0	0	112	L7 G8 I9 I14 S15	L7-Q11 WeakPolarHBondContact O-CB 3.33Å; L7-Q11 PolarHBondContact O-N 3.22Å; G8-Q11 PolarHBondContact O-N 3.3Å; I9-Q11 VanDerWaalsContact C-N 3.34Å; I9-Q11 PolarHBondContact O-N 3.44Å; Q11-I14 PolarHBondContact O-N 2.98Å; Q11-S15 WeakPolarHBondContact O-CB 3.48Å; Q11-S15 PolarHBondContact O-N 3.35Å; Q11-S15 PolarHBondContact O-OG 2.93Å
12	L	87.2	Confident	83.9	Confident	122 Å²	122	109.5 Å²	109.5	64%	0.639	55%	0.547	S	S	*	.	H	α-helix	trans	-64.8	-44.1	177	-157.2	147.2	0	0	0	110.9	G8 I9 I10 I14 S15 Y16	G8-L12 WeakPolarHBondContact O-CB 3.26Å; G8-L12 PolarHBondContact O-N 3.04Å; I9-L12 PolarHBondContact O-N 3.37Å; I10-L12 VanDerWaalsContact C-N 3.33Å; I10-L12 PolarHBondContact O-N 3.48Å; L12-I14 PolarHBondContact O-N 2.77Å; L12-S15 PolarHBondContact O-N 3.45Å; L12-S15 PolarHBondContact O-OG 3.48Å; L12-Y16 WeakPolarHBondContact O-CB 3.28Å; L12-Y16 PolarHBondContact O-N 3.41Å
13	F	90.6	Very high	84.7	Confident	127 Å²	127	109.6 Å²	109.6	56%	0.557	54%	0.538	S	S	*	.	H	α-helix	trans	-61.3	-44.8	175.6	-167.9	-97.7	0	0	0	112.3	I9 I10 Y16 Q17	I9-F13 PolarHBondContact O-N 3.33Å; I10-F13 PolarHBondContact O-N 3.39Å; F13-Y16 PolarHBondContact O-N 2.96Å; F13-Q17 HydrophobicContact CD1-CG 4.02Å; F13-Q17 HydrophobicContact CE1-CG 3.81Å; F13-Q17 HydrophobicContact CZ-CG 4.31Å; F13-Q17 VanDerWaalsContact O-CG 3.29Å; F13-Q17 WeakPolarHBondContact O-CG 3.47Å; F13-Q17 PolarHBondContact O-N 2.9Å
14	I	92.4	Very high	85.5	Confident	90 Å²	90	104.9 Å²	104.9	46%	0.462	53%	0.527	S	S	.	.	H	α-helix	trans	-61.3	-47.3	177.1	-68.7	167.7	0	0	0	110.7	I10 Q11 L12 Y16 Q17 I18	I10-I14 HydrophobicContact CG2-CD1 3.7Å; I10-I14 HydrophobicContact CG2-CG1 4.38Å; I10-I14 VanDerWaalsContact O-CG1 3.28Å; I10-I14 WeakPolarHBondContact O-CG1 3.43Å; I10-I14 PolarHBondContact O-N 2.93Å; Q11-I14 PolarHBondContact O-N 2.98Å; L12-I14 PolarHBondContact O-N 2.77Å; I14-Y16 VanDerWaalsContact C-N 3.29Å; I14-Y16 PolarHBondContact O-N 3.31Å; I14-Q17 PolarHBondContact O-N 3.32Å; I14-I18 HydrophobicContact CG2-CD1 3.64Å; I14-I18 HydrophobicContact CG2-CG1 4.37Å; I14-I18 VanDerWaalsContact O-CG1 3.26Å; I14-I18 WeakPolarHBondContact O-CG1 3.32Å; I14-I18 PolarHBondContact O-N 3.43Å
15	S	90.4	Very high	85.8	Confident	66 Å²	66	99.5 Å²	99.5	46%	0.462	52%	0.518	S	S	.	.	H	α-helix	trans	-61.2	-38.5	178.8	68.3	0	0	0	0	112.7	Q11 L12 I18 F19	Q11-S15 WeakPolarHBondContact O-CB 3.48Å; Q11-S15 PolarHBondContact O-N 3.35Å; Q11-S15 PolarHBondContact O-OG 2.93Å; L12-S15 PolarHBondContact O-N 3.45Å; L12-S15 PolarHBondContact O-OG 3.48Å; S15-I18 PolarHBondContact O-N 2.94Å; S15-F19 WeakPolarHBondContact O-CB 3.46Å; S15-F19 PolarHBondContact O-N 3.34Å
16	Y	92.6	Very high	85.6	Confident	146 Å²	146	99.3 Å²	99.3	57%	0.573	52%	0.521	S	S	*	.	H	α-helix	trans	-65.7	-46.2	176.6	-177.4	-98.7	0	0	0	111.6	L12 F13 I14 I18 F19 C20	L12-Y16 WeakPolarHBondContact O-CB 3.28Å; L12-Y16 PolarHBondContact O-N 3.41Å; F13-Y16 PolarHBondContact O-N 2.96Å; I14-Y16 VanDerWaalsContact C-N 3.29Å; I14-Y16 PolarHBondContact O-N 3.31Å; Y16-I18 VanDerWaalsContact C-N 3.33Å; Y16-I18 PolarHBondContact O-N 2.93Å; Y16-F19 PolarHBondContact O-N 2.9Å; Y16-C20 VanDerWaalsContact CE1-SG 3.54Å; Y16-C20 PolarHBondContact O-N 3.32Å; Y16-C20 PolarHBondContact O-SG 3.22Å
17	Q	91.9	Very high	85.1	Confident	82 Å²	82	99.6 Å²	99.6	38%	0.383	52%	0.519	S	S	.	.	H	α-helix	trans	-60.5	-43.1	176.4	-67.8	-66.3	-5.6	0	0	111.8	F13 I14 C20 L21	F13-Q17 HydrophobicContact CD1-CG 4.02Å; F13-Q17 HydrophobicContact CE1-CG 3.81Å; F13-Q17 HydrophobicContact CZ-CG 4.31Å; F13-Q17 VanDerWaalsContact O-CG 3.29Å; F13-Q17 WeakPolarHBondContact O-CG 3.47Å; F13-Q17 PolarHBondContact O-N 2.9Å; I14-Q17 PolarHBondContact O-N 3.32Å; Q17-C20 PolarHBondContact O-N 3.49Å; Q17-L21 WeakPolarHBondContact O-CB 3.26Å; Q17-L21 VanDerWaalsContact O-CG 3.32Å; Q17-L21 WeakPolarHBondContact O-CG 3.3Å; Q17-L21 PolarHBondContact O-N 2.96Å
18	I	91	Very high	84.2	Confident	90 Å²	90	96.8 Å²	96.8	46%	0.462	52%	0.516	S	S	.	.	H	α-helix	trans	-62	-45	176.2	-66.7	166.1	0	0	0	110.5	I14 S15 Y16 C20 L21 L22	I14-I18 HydrophobicContact CG2-CD1 3.64Å; I14-I18 HydrophobicContact CG2-CG1 4.37Å; I14-I18 VanDerWaalsContact O-CG1 3.26Å; I14-I18 WeakPolarHBondContact O-CG1 3.32Å; I14-I18 PolarHBondContact O-N 3.43Å; S15-I18 PolarHBondContact O-N 2.94Å; Y16-I18 VanDerWaalsContact C-N 3.33Å; Y16-I18 PolarHBondContact O-N 2.93Å; I18-C20 PolarHBondContact O-N 3.37Å; I18-L21 PolarHBondContact O-N 3.28Å; I18-L22 HydrophobicContact CG2-CD1 3.97Å; I18-L22 HydrophobicContact CG2-CG 4.35Å; I18-L22 WeakPolarHBondContact O-CB 3.43Å; I18-L22 VanDerWaalsContact O-CG 3.3Å; I18-L22 WeakPolarHBondContact O-CG 3.44Å; I18-L22 PolarHBondContact O-N 2.98Å
19	F	88.8	Confident	83.2	Confident	138 Å²	138	99 Å²	99	61%	0.605	53%	0.526	S	S	*	.	H	α-helix	trans	-61	-44.9	177.4	-178.6	-96.3	0	0	0	112	S15 Y16 L21 L22 F23	S15-F19 WeakPolarHBondContact O-CB 3.46Å; S15-F19 PolarHBondContact O-N 3.34Å; Y16-F19 PolarHBondContact O-N 2.9Å; F19-L21 PolarHBondContact O-N 3.21Å; F19-L22 PolarHBondContact O-N 2.87Å; F19-F23 WeakPolarHBondContact O-CB 3.48Å; F19-F23 PolarHBondContact O-N 2.9Å
20	C	87.6	Confident	82.1	Confident	34 Å²	34	96.1 Å²	96.1	23%	0.23	52%	0.515	C	S	.	.	H	α-helix	trans	-61.1	-44.7	175.9	-69.1	0	0	0	0	112.1	Y16 Q17 I18 F23 I24	Y16-C20 VanDerWaalsContact CE1-SG 3.54Å; Y16-C20 PolarHBondContact O-N 3.32Å; Y16-C20 PolarHBondContact O-SG 3.22Å; Q17-C20 PolarHBondContact O-N 3.49Å; I18-C20 PolarHBondContact O-N 3.37Å; C20-F23 PolarHBondContact O-N 3.34Å; C20-I24 WeakPolarHBondContact O-CD1 3.41Å; C20-I24 VanDerWaalsContact O-CG1 3.24Å; C20-I24 WeakPolarHBondContact O-CG1 3.29Å; C20-I24 PolarHBondContact O-N 3.5Å
21	L	84.2	Confident	81	Confident	106 Å²	106	101.1 Å²	101.1	56%	0.555	53%	0.528	S	S	*	.	H	α-helix	trans	-62.5	-44.1	176.9	-73.3	169.8	0	0	0	111.5	Q17 I18 F19 F23 I24 C25	Q17-L21 WeakPolarHBondContact O-CB 3.26Å; Q17-L21 VanDerWaalsContact O-CG 3.32Å; Q17-L21 WeakPolarHBondContact O-CG 3.3Å; Q17-L21 PolarHBondContact O-N 2.96Å; I18-L21 PolarHBondContact O-N 3.28Å; F19-L21 PolarHBondContact O-N 3.21Å; L21-F23 VanDerWaalsContact C-N 3.34Å; L21-F23 PolarHBondContact O-N 3.3Å; L21-I24 PolarHBondContact O-N 2.83Å; L21-C25 WeakPolarHBondContact O-CB 3.24Å; L21-C25 PolarHBondContact O-N 2.89Å; L21-C25 PolarHBondContact O-SG 3.44Å
22	L	82.6	Confident	80.2	Confident	114 Å²	114	97.6 Å²	97.6	60%	0.597	52%	0.518	S	S	*	.	H	α-helix	trans	-61.7	-42.4	176	-72.7	173.5	0	0	0	111.8	I18 F19 C25 A26	I18-L22 HydrophobicContact CG2-CD1 3.97Å; I18-L22 HydrophobicContact CG2-CG 4.35Å; I18-L22 WeakPolarHBondContact O-CB 3.43Å; I18-L22 VanDerWaalsContact O-CG 3.3Å; I18-L22 WeakPolarHBondContact O-CG 3.44Å; I18-L22 PolarHBondContact O-N 2.98Å; F19-L22 PolarHBondContact O-N 2.87Å; L22-C25 PolarHBondContact O-N 3.36Å; L22-A26 VanDerWaalsContact O-CB 3.31Å; L22-A26 WeakPolarHBondContact O-CB 3.31Å; L22-A26 PolarHBondContact O-N 3.34Å
23	F	82.3	Confident	79.3	Confident	112 Å²	112	95.5 Å²	95.5	49%	0.491	51%	0.51	S	S	.	.	H	α-helix	trans	-62.7	-45.1	177	-172.3	-93.2	0	0	0	111.6	F19 C20 L21 A26 H27	F19-F23 WeakPolarHBondContact O-CB 3.48Å; F19-F23 PolarHBondContact O-N 2.9Å; C20-F23 PolarHBondContact O-N 3.34Å; L21-F23 VanDerWaalsContact C-N 3.34Å; L21-F23 PolarHBondContact O-N 3.3Å; F23-A26 PolarHBondContact O-N 3.32Å; F23-H27 AromaticContact CD2-CD2 3.55Å; F23-H27 AromaticContact CD2-NE2 3.92Å; F23-H27 AromaticContact CE1-CD2 3.89Å; F23-H27 AromaticContact CE2-CD2 3.3Å; F23-H27 WeakPolarHBondContact CE2-CD2 3.44Å; F23-H27 AromaticContact CE2-NE2 3.44Å; F23-H27 WeakPolarHBondContact CE2-NE2 3.3Å; F23-H27 AromaticContact CG-CD2 3.95Å; F23-H27 AromaticContact CZ-CD2 3.48Å; F23-H27 VanDerWaalsContact CZ-CD2 3.48Å; F23-H27 WeakPolarHBondContact CZ-CD2 3.48Å; F23-H27 AromaticContact CZ-NE2 3.9Å; F23-H27 WeakPolarHBondContact O-CB 3.47Å; F23-H27 PolarHBondContact O-CD2 3.47Å; F23-H27 PolarHBondContact O-N 2.93Å
24	I	80	Confident	78.3	Confident	107 Å²	107	94.6 Å²	94.6	55%	0.549	52%	0.515	S	S	.	.	H	α-helix	trans	-66.2	-36.7	176.2	-64.8	162.6	0	0	0	111	C20 L21 G28	C20-I24 WeakPolarHBondContact O-CD1 3.41Å; C20-I24 VanDerWaalsContact O-CG1 3.24Å; C20-I24 WeakPolarHBondContact O-CG1 3.29Å; C20-I24 PolarHBondContact O-N 3.5Å; L21-I24 PolarHBondContact O-N 2.83Å; I24-G28 WeakPolarHBondContact O-CA 3.02Å; I24-G28 PolarHBondContact O-N 2.69Å
25	C	75.9	Confident	77.4	Confident	88 Å²	88	93.5 Å²	93.5	60%	0.595	51%	0.513	S	S	*	.	H	α-helix	trans	-68.5	-40.1	175.5	-70	0	0	0	0	112.2	L21 L22 S29	L21-C25 WeakPolarHBondContact O-CB 3.24Å; L21-C25 PolarHBondContact O-N 2.89Å; L21-C25 PolarHBondContact O-SG 3.44Å; L22-C25 PolarHBondContact O-N 3.36Å; C25-S29 PolarHBondContact O-OG 3.1Å
26	A	70.7	Confident	76.6	Confident	72 Å²	72	95.6 Å²	95.6	60%	0.595	52%	0.523	S	S	*	.	H	α-helix	trans	-69.8	-43.8	179.9	0	0	0	0	0	112.2	L22 F23	L22-A26 VanDerWaalsContact O-CB 3.31Å; L22-A26 WeakPolarHBondContact O-CB 3.31Å; L22-A26 PolarHBondContact O-N 3.34Å; F23-A26 PolarHBondContact O-N 3.32Å
27	H	69.3	Low	75.7	Confident	111 Å²	111	91.9 Å²	91.9	51%	0.514	51%	0.513	S	S	.	.	H	α-helix	trans	-97.6	-27.4	-176.2	-68.8	-73.4	0	0	0	113.8	F23 S29 H48	F23-H27 AromaticContact CD2-CD2 3.55Å; F23-H27 AromaticContact CD2-NE2 3.92Å; F23-H27 AromaticContact CE1-CD2 3.89Å; F23-H27 AromaticContact CE2-CD2 3.3Å; F23-H27 WeakPolarHBondContact CE2-CD2 3.44Å; F23-H27 AromaticContact CE2-NE2 3.44Å; F23-H27 WeakPolarHBondContact CE2-NE2 3.3Å; F23-H27 AromaticContact CG-CD2 3.95Å; F23-H27 AromaticContact CZ-CD2 3.48Å; F23-H27 VanDerWaalsContact CZ-CD2 3.48Å; F23-H27 WeakPolarHBondContact CZ-CD2 3.48Å; F23-H27 AromaticContact CZ-NE2 3.9Å; F23-H27 WeakPolarHBondContact O-CB 3.47Å; F23-H27 PolarHBondContact O-CD2 3.47Å; F23-H27 PolarHBondContact O-N 2.93Å; H27-S29 PolarHBondContact O-N 3.3Å; H27-H48 PolarHBondContact O-CE1 3.29Å; H27-H48 PolarHBondContact O-NE2 3.18Å
28	G	65.4	Low	75.1	Confident	49 Å²	49	93.1 Å²	93.1	51%	0.505	53%	0.531	S	S	.	.			trans	-78.9	8.4	-176.1	0	0	0	0	0	114.8	I24 S30	I24-G28 WeakPolarHBondContact O-CA 3.02Å; I24-G28 PolarHBondContact O-N 2.69Å; G28-S30 PolarHBondContact O-N 3.34Å
29	S	62.8	Low	74.6	Confident	86 Å²	86	94.4 Å²	94.4	60%	0.601	54%	0.538	S	S	*	.			trans	-74.3	43.7	170.7	-63.4	0	0	0	0	111.8	C25 H27 R31	C25-S29 PolarHBondContact O-OG 3.1Å; H27-S29 PolarHBondContact O-N 3.3Å; S29-R31 PolarHBondContact O-N 3.14Å; S29-R31 VanDerWaalsContact O-N 3.1Å
30	S	63.9	Low	74	Confident	41 Å²	41	90.4 Å²	90.4	29%	0.287	54%	0.536	S	S	.	.			trans	-71.2	104.5	170.2	-171.7	0	0	0	0	108.2	G28 C32	G28-S30 PolarHBondContact O-N 3.34Å; S30-C32 PolarHBondContact O-N 3.21Å
31	R	64.6	Low	73.2	Confident	199 Å²	199	93.9 Å²	93.9	75%	0.751	55%	0.552	S	S	*	*			trans	-81.3	109.4	169.9	-69.2	-176.3	175.7	-175.5	0.6	107.7	S29 D47	S29-R31 PolarHBondContact O-N 3.14Å; S29-R31 VanDerWaalsContact O-N 3.1Å; R31-D47 PolarHBondContact O-N 3.45Å
32	C	69.4	Low	72.8	Confident	69 Å²	69	93.9 Å²	93.9	47%	0.466	56%	0.558	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.3	120.7	167.9	-62.5	0	0	0	0	109	S30 L44 T45 C46	S30-C32 PolarHBondContact O-N 3.21Å; C32-L44 HydrophobicContact CB-CD1 3.95Å; C32-T45 CarbonylContact C-O 3.55Å; C32-T45 WeakPolarHBondContact CA-O 3.48Å; C32-C46 HydrophobicContact CB-CB 4.16Å; C32-C46 WeakPolarHBondContact CB-SG 3.17Å; C32-C46 WeakPolarHBondContact SG-CB 3.39Å; C32-C46 CovalentContact SG-SG 2.05Å; C32-C46 PolarHBondContact SG-SG 3.01Å
33	T	69.3	Low	72.4	Confident	78 Å²	78	92 Å²	92	48%	0.479	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	125.8	173.6	-172.3	0	0	0	0	109	T35 T45	T33-T35 HydrophobicContact CG2-CG2 4.44Å; T33-T45 WeakPolarHBondContact CG2-OG1 3.11Å; T33-T45 PolarHBondContact N-O 3.3Å; T33-T45 PolarHBondContact O-N 3.25Å; T33-T45 PolarHBondContact O-OG1 3.03Å
34	T	68.7	Low	72	Confident	108 Å²	108	91.9 Å²	91.9	66%	0.663	55%	0.552	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-88.8	119.6	171.5	55	0	0	0	0	108	L44	T34-L44 HydrophobicContact CG2-CD1 3.44Å; T34-L44 VanDerWaalsContact CG2-CD1 3.44Å
35	T	73.5	Confident	71.5	Confident	67 Å²	67	89.8 Å²	89.8	41%	0.411	54%	0.544	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	135.9	174.5	55.4	0	0	0	0	108.4	T33 I43	T33-T35 HydrophobicContact CG2-CG2 4.44Å; T35-I43 PolarHBondContact N-O 3.06Å; T35-I43 WeakPolarHBondContact O-CA 3.42Å; T35-I43 PolarHBondContact O-N 3.39Å; T35-I43 VanDerWaalsContact O-O 3.14Å
36	V	73.8	Confident	71.2	Confident	111 Å²	111	86.9 Å²	86.9	67%	0.673	53%	0.525	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.5	125.8	177.2	-173.3	0	0	0	0	108
37	N	74.4	Confident	70.9	Confident	67 Å²	67	86.9 Å²	86.9	36%	0.358	52%	0.515	S	S	.	.			trans	-69.8	166.2	174.6	-163.1	14.2	0	0	0	111	D39 G40 L41 I43	N37-D39 PolarHBondContact ND2-OD2 3.1Å; N37-D39 VanDerWaalsContact ND2-OD2 3.11Å; N37-D39 PolarHBondContact O-N 2.77Å; N37-G40 PolarHBondContact O-N 3.12Å; N37-L41 PolarHBondContact N-O 2.86Å; N37-I43 HydrophobicContact CB-CD1 3.67Å; N37-I43 HydrophobicContact CB-CG1 4.14Å
38	S	78.9	Confident	70.5	Confident	109 Å²	109	86.2 Å²	86.2	76%	0.762	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.5	-27.1	172.7	52.3	0	0	0	0	113.5	G40	S38-G40 PolarHBondContact O-N 2.92Å
39	D	79.8	Confident	70	Confident	116 Å²	116	88.6 Å²	88.6	62%	0.62	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.6	3.8	-179.3	-47.6	-39.3	0	0	0	113	N37 L41	N37-D39 PolarHBondContact ND2-OD2 3.1Å; N37-D39 VanDerWaalsContact ND2-OD2 3.11Å; N37-D39 PolarHBondContact O-N 2.77Å; D39-L41 HydrophobicContact CB-CD1 4.31Å; D39-L41 PolarHBondContact O-N 3.37Å
40	G	76.4	Confident	69.5	Low	54 Å²	54	93.1 Å²	93.1	56%	0.557	52%	0.516	S	S	*	.	S	Bend	trans	77.5	1	-177.4	0	0	0	0	0	114.4	N37 S38	N37-G40 PolarHBondContact O-N 3.12Å; S38-G40 PolarHBondContact O-N 2.92Å
41	L	70.6	Confident	68.7	Low	108 Å²	108	97.6 Å²	97.6	57%	0.565	54%	0.537	S	S	*	.			trans	-78.8	131.4	177.8	-71.7	161.4	0	0	0	110.7	N37 D39 I43	N37-L41 PolarHBondContact N-O 2.86Å; D39-L41 HydrophobicContact CB-CD1 4.31Å; D39-L41 PolarHBondContact O-N 3.37Å; L41-I43 PolarHBondContact O-N 3.13Å
42	P	75.9	Confident	67.9	Low	106 Å²	106	95.9 Å²	95.9	69%	0.688	54%	0.535	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.2	118.8	175.4	29.8	-32.4	0	0	0	109.9
43	I	74.6	Confident	66.9	Low	73 Å²	73	97.1 Å²	97.1	37%	0.374	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	115.2	171.7	-54.7	179.1	0	0	0	107.5	T35 N37 L41 T45	T35-I43 PolarHBondContact N-O 3.06Å; T35-I43 WeakPolarHBondContact O-CA 3.42Å; T35-I43 PolarHBondContact O-N 3.39Å; T35-I43 VanDerWaalsContact O-O 3.14Å; N37-I43 HydrophobicContact CB-CD1 3.67Å; N37-I43 HydrophobicContact CB-CG1 4.14Å; L41-I43 PolarHBondContact O-N 3.13Å; I43-T45 HydrophobicContact CG2-CG2 3.77Å
44	L	73.7	Confident	65.7	Low	111 Å²	111	100.1 Å²	100.1	58%	0.581	55%	0.548	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.9	114.7	169.9	-177.2	73	0	0	0	107.7	C32 T34	C32-L44 HydrophobicContact CB-CD1 3.95Å; T34-L44 HydrophobicContact CG2-CD1 3.44Å; T34-L44 VanDerWaalsContact CG2-CD1 3.44Å
45	T	69	Low	64.7	Low	63 Å²	63	99 Å²	99	39%	0.387	55%	0.545	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	121.9	173.9	55.4	0	0	0	0	108.8	C32 T33 I43	C32-T45 CarbonylContact C-O 3.55Å; C32-T45 WeakPolarHBondContact CA-O 3.48Å; T33-T45 WeakPolarHBondContact CG2-OG1 3.11Å; T33-T45 PolarHBondContact N-O 3.3Å; T33-T45 PolarHBondContact O-N 3.25Å; T33-T45 PolarHBondContact O-OG1 3.03Å; I43-T45 HydrophobicContact CG2-CG2 3.77Å
46	C	69.5	Low	63.1	Low	27 Å²	27	103.1 Å²	103.1	18%	0.182	56%	0.559	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-108.5	137.1	178	-63.6	0	0	0	0	110.1	C32 H48 D49	C32-C46 HydrophobicContact CB-CB 4.16Å; C32-C46 WeakPolarHBondContact CB-SG 3.17Å; C32-C46 WeakPolarHBondContact SG-CB 3.39Å; C32-C46 CovalentContact SG-SG 2.05Å; C32-C46 PolarHBondContact SG-SG 3.01Å; C46-H48 PolarHBondContact O-N 3.48Å; C46-H48 VanDerWaalsContact O-N 3.1Å; C46-D49 PolarHBondContact O-N 3.15Å
47	D	66.2	Low	61.5	Low	71 Å²	71	105.7 Å²	105.7	38%	0.38	56%	0.561	S	S	.	*	H	α-helix	trans	-60.2	-24.3	-175.1	-134.8	0.1	0	0	0	113	R31 D49 R50	R31-D47 PolarHBondContact O-N 3.45Å; D47-D49 PolarHBondContact O-N 3Å; D47-R50 WeakPolarHBondContact O-CB 3.12Å; D47-R50 PolarHBondContact O-N 3.1Å; D47-R50 VanDerWaalsContact O-N 3.13Å; D47-R50 WeakPolarHBondContact OD1-CD 3.08Å; D47-R50 IonicContact OD1-NH1 3.71Å
48	H	60.2	Low	59.8	Low	97 Å²	97	109 Å²	109	45%	0.449	58%	0.58	S	S	.	*	H	α-helix	trans	-61.2	-29.3	173.6	-78	-13.2	0	0	0	114	H27 C46 R50	H27-H48 PolarHBondContact O-CE1 3.29Å; H27-H48 PolarHBondContact O-NE2 3.18Å; C46-H48 PolarHBondContact O-N 3.48Å; C46-H48 VanDerWaalsContact O-N 3.1Å; H48-R50 VanDerWaalsContact C-N 3.28Å; H48-R50 PolarHBondContact O-N 3.09Å
49	D	55.8	Low	57.8	Low	99 Å²	99	110.1 Å²	110.1	53%	0.529	58%	0.575	S	S	.	*	H	α-helix	trans	-73.1	-24.6	177.9	-70.9	-32.9	0	0	0	111.8	C46 D47 L51 K52 V53	C46-D49 PolarHBondContact O-N 3.15Å; D47-D49 PolarHBondContact O-N 3Å; D49-L51 VanDerWaalsContact C-N 3.29Å; D49-L51 PolarHBondContact O-N 3.11Å; D49-K52 PolarHBondContact O-N 3.35Å; D49-K52 VanDerWaalsContact O-N 3.15Å; D49-V53 WeakPolarHBondContact O-CG2 3.37Å; D49-V53 PolarHBondContact O-N 3.34Å; D49-V53 VanDerWaalsContact O-N 3.11Å
50	R	50.3	Low	55.8	Low	181 Å²	181	115.5 Å²	115.5	68%	0.683	59%	0.589	S	S	*	*	H	α-helix	trans	-62.8	-35.6	178	-75.4	178.4	131.7	173.3	-0.3	112.5	D47 H48 K52 V53 Q54	D47-R50 WeakPolarHBondContact O-CB 3.12Å; D47-R50 PolarHBondContact O-N 3.1Å; D47-R50 VanDerWaalsContact O-N 3.13Å; D47-R50 WeakPolarHBondContact OD1-CD 3.08Å; D47-R50 IonicContact OD1-NH1 3.71Å; H48-R50 VanDerWaalsContact C-N 3.28Å; H48-R50 PolarHBondContact O-N 3.09Å; R50-K52 VanDerWaalsContact C-N 3.33Å; R50-K52 PolarHBondContact O-N 3.4Å; R50-V53 PolarHBondContact O-N 3.38Å; R50-Q54 PolarHBondContact O-N 3.46Å; R50-Q54 VanDerWaalsContact O-N 3.09Å
51	L	48	Very low	53.7	Low	136 Å²	136	119.7 Å²	119.7	71%	0.712	60%	0.598	S	S	*	*	H	α-helix	trans	-69.1	-30.8	177.3	-75.4	168.7	0	0	0	112.7	D49	D49-L51 VanDerWaalsContact C-N 3.29Å; D49-L51 PolarHBondContact O-N 3.11Å
52	K	47.8	Very low	52.1	Low	163 Å²	163	121.9 Å²	121.9	71%	0.709	61%	0.611	S	S	*	*	H	α-helix	trans	-75.3	-32.2	174.8	-94.4	-176.5	176.4	179.4	0	113.2	D49 R50 S55	D49-K52 PolarHBondContact O-N 3.35Å; D49-K52 VanDerWaalsContact O-N 3.15Å; R50-K52 VanDerWaalsContact C-N 3.33Å; R50-K52 PolarHBondContact O-N 3.4Å; K52-S55 PolarHBondContact O-OG 2.05Å
53	V	48.6	Very low	50.2	Low	94 Å²	94	125.7 Å²	125.7	57%	0.57	62%	0.619	S	S	*	*	H	α-helix	trans	-75.3	-34.1	178.4	178.4	0	0	0	0	111.2	D49 R50 S55 H56	D49-V53 WeakPolarHBondContact O-CG2 3.37Å; D49-V53 PolarHBondContact O-N 3.34Å; D49-V53 VanDerWaalsContact O-N 3.11Å; R50-V53 PolarHBondContact O-N 3.38Å; V53-S55 PolarHBondContact O-N 2.81Å; V53-H56 PolarHBondContact O-N 2.75Å
54	Q	44.6	Very low	48.3	Very low	142 Å²	142	129.7 Å²	129.7	66%	0.664	64%	0.636	S	S	*	*	H	α-helix	trans	-64	-38.4	177.6	-156.4	89.4	33.4	0	0	112.1	R50 H56 F57	R50-Q54 PolarHBondContact O-N 3.46Å; R50-Q54 VanDerWaalsContact O-N 3.09Å; Q54-H56 PolarHBondContact O-N 2.8Å; Q54-F57 PolarHBondContact O-N 3.07Å
55	S	46.6	Very low	46.6	Very low	84 Å²	84	132.1 Å²	132.1	59%	0.587	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.5	-9.2	-178.3	62.1	0	0	0	0	114.8	K52 V53	K52-S55 PolarHBondContact O-OG 2.05Å; V53-S55 PolarHBondContact O-N 2.81Å
56	H	40.3	Very low	45	Very low	153 Å²	153	136.7 Å²	136.7	71%	0.708	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	-7.3	177.8	-168.6	-87.7	0	0	0	113	V53 Q54	V53-H56 PolarHBondContact O-N 2.75Å; Q54-H56 PolarHBondContact O-N 2.8Å
57	F	40.3	Very low	43.3	Very low	165 Å²	165	143.3 Å²	143.3	72%	0.724	70%	0.7	S	S	*	*	S	Bend	trans	-99.9	-2.9	-176.7	-96.2	-82.8	0	0	0	115.6	Q54	Q54-F57 PolarHBondContact O-N 3.07Å
58	D	38.7	Very low	41.7	Very low	138 Å²	138	147.8 Å²	147.8	74%	0.738	72%	0.722	S	S	*	*	S	Bend	trans	-100.3	19.2	-177.1	-66.5	-24.7	0	0	0	114.4
59	I	36.1	Very low	40.6	Very low	132 Å²	132	147.7 Å²	147.7	68%	0.677	73%	0.73	S	S	*	*			trans	-124.5	55.4	173.3	-45.2	175.4	0	0	0	110.7
60	Y	37.8	Very low	39.4	Very low	229 Å²	229	152.1 Å²	152.1	90%	0.898	75%	0.747	S	S	*	*	S	Bend	trans	-122.7	104.8	150.6	-90.2	-85.9	0	0	0	107.8	D62	Y60-D62 PolarHBondContact O-N 2.97Å
61	N	33.6	Very low	38.5	Very low	141 Å²	141	148.6 Å²	148.6	75%	0.754	75%	0.75	S	S	*	*			trans	-54.2	123	-179.8	-67.2	-44.7	0	0	0	111	E63	N61-E63 PolarHBondContact O-N 2.78Å
62	D	37.5	Very low	37.7	Very low	155 Å²	155	149.6 Å²	149.6	83%	0.829	76%	0.756	S	S	*	*				29.2	68.4	120.3	-153.5	22.8	0	0	0	116.4	Y60	Y60-D62 PolarHBondContact O-N 2.97Å
63	E	35.9	Very low	37	Very low	186 Å²	186	152.6 Å²	152.6	87%	0.869	77%	0.765	S	S	*	*			trans	-113.4	96.2	151.4	-82.5	-166.8	133.7	0	0	108	N61 N65	N61-E63 PolarHBondContact O-N 2.78Å; E63-N65 PolarHBondContact O-N 3.09Å
64	Q	33.6	Very low	36.1	Very low	156 Å²	156	152.8 Å²	152.8	73%	0.729	77%	0.77	S	S	*	*			trans	-5.3	93.4	152.5	-63.8	176.7	-63.1	0	0	114.6
65	N	38.1	Very low	35.5	Very low	163 Å²	163	152.9 Å²	152.9	87%	0.872	78%	0.776	S	S	*	*			trans	-108.8	85.3	153.4	-118	24.9	0	0	0	106.7	E63 L67	E63-N65 PolarHBondContact O-N 3.09Å; N65-L67 PolarHBondContact O-N 3.24Å
66	E	35	Very low	34.7	Very low	159 Å²	159	156.3 Å²	156.3	74%	0.743	79%	0.787	S	S	*	*			trans	-53.9	124.2	174.6	-67.6	-173.5	160.3	0	0	109.4	I68	E66-I68 PolarHBondContact O-N 3.23Å
67	L	33.9	Very low	34.6	Very low	166 Å²	166	155 Å²	155	87%	0.869	79%	0.793	S	S	*	*			trans	-63.3	95.8	-178.5	-158	79.5	0	0	0	108.8	N65 P69	N65-L67 PolarHBondContact O-N 3.24Å; L67-P69 WeakPolarHBondContact O-CD 3.16Å
68	I	32.7	Very low	34.3	Very low	164 Å²	164	154.9 Å²	154.9	84%	0.841	80%	0.798	S	S	*	*			trans	-76.2	112.9	170	-58.1	173.3	0	0	0	107.5	E66	E66-I68 PolarHBondContact O-N 3.23Å
69	P	36.4	Very low	33.9	Very low	95 Å²	95	157.7 Å²	157.7	62%	0.617	81%	0.807	S	S	*	*			trans	-87.4	135.7	177.3	5.2	16	0	0	0	110.4	L67	L67-P69 WeakPolarHBondContact O-CD 3.16Å
70	E	31.5	Very low	33.7	Very low	193 Å²	193	156.2 Å²	156.2	90%	0.902	81%	0.809	S	S	*	*			trans	59.6	107.6	147.2	-52.4	-168.6	171	0	0	118.9
71	S	32.4	Very low	33.6	Very low	107 Å²	107	153.8 Å²	153.8	75%	0.748	81%	0.806	S	S	*	*			trans	-157.5	125.6	138.2	63.5	0	0	0	0	111.3	Y73	S71-Y73 PolarHBondContact O-N 2.95Å
72	D	30.7	Very low	33.6	Very low	156 Å²	156	156.4 Å²	156.4	83%	0.834	81%	0.813	S	S	*	*			trans	-33.5	116.7	174.1	-68.6	-57.8	0	0	0	115.7
73	Y	32.3	Very low	33.4	Very low	226 Å²	226	154.3 Å²	154.3	89%	0.886	81%	0.811	S	S	*	*			trans	-128.4	112.7	148.7	-90.3	-85.5	0	0	0	110.2	S71	S71-Y73 PolarHBondContact O-N 2.95Å
74	S	31.2	Very low	33.6	Very low	98 Å²	98	149.5 Å²	149.5	69%	0.685	80%	0.803	S	S	*	*			trans	-64.1	139.8	176	-74.2	0	0	0	0	112.1
75	N	31.8	Very low	33.7	Very low	145 Å²	145	149.9 Å²	149.9	78%	0.775	80%	0.804	S	S	*	*			trans	68.7	82.8	150.7	-52.1	-36.8	0	0	0	118.7
76	D	29.7	Very low	33.7	Very low	155 Å²	155	152 Å²	152	83%	0.829	80%	0.802	S	S	*	*			trans	-137.5	109.6	142.9	-92.1	-34.6	0	0	0	110.1	L78	D76-L78 PolarHBondContact O-N 2.9Å
77	P	37.6	Very low	34.1	Very low	127 Å²	127	151.8 Å²	151.8	83%	0.825	80%	0.804	S	S	*	*			trans	-80.2	63	180	33.2	-33.9	0	0	0	111.1
78	L	34	Very low	34.2	Very low	161 Å²	161	151 Å²	151	84%	0.843	80%	0.798	S	S	*	*			trans	-139.3	39.3	172	-90	177	0	0	0	112.6	D76	D76-L78 PolarHBondContact O-N 2.9Å
79	Q	30	Very low	34.8	Very low	197 Å²	197	149 Å²	149	92%	0.921	80%	0.795	S	S	*	*			trans	-137.4	69.7	160.7	-76.9	-164.8	-3.1	0	0	110.7
80	S	31.8	Very low	35	Very low	102 Å²	102	149.3 Å²	149.3	71%	0.713	80%	0.8	S	S	*	*			trans	-81.1	131.1	155.5	67.2	0	0	0	0	108.9
81	Q	35.5	Very low	35.9	Very low	178 Å²	178	150.1 Å²	150.1	83%	0.832	80%	0.8	S	S	*	*			trans	89.1	86	154.8	-53.1	-175.9	-63.4	0	0	117.4
82	Q	34.5	Very low	36.7	Very low	195 Å²	195	151.8 Å²	151.8	91%	0.911	79%	0.794	S	S	*	*			trans	-146.6	-0.9	143.3	-116.1	171.7	-3.9	0	0	116	A84	Q82-A84 VanDerWaalsContact C-N 3.28Å; Q82-A84 PolarHBondContact O-N 2.97Å; Q82-A84 VanDerWaalsContact O-N 3.09Å
83	S	32.3	Very low	37.8	Very low	111 Å²	111	147.8 Å²	147.8	78%	0.776	78%	0.783	S	S	*	*			trans	-83.9	77.9	161	49.5	0	0	0	0	109.4	E85	S83-E85 PolarHBondContact O-N 2.96Å
84	A	41.6	Very low	39	Very low	85 Å²	85	142.2 Å²	142.2	70%	0.702	76%	0.764	S	S	*	*			trans	-65.5	76.3	159.4	0	0	0	0	0	107.6	Q82 Y86	Q82-A84 VanDerWaalsContact C-N 3.28Å; Q82-A84 PolarHBondContact O-N 2.97Å; Q82-A84 VanDerWaalsContact O-N 3.09Å; A84-Y86 WeakPolarHBondContact O-CD2 3.13Å; A84-Y86 PolarHBondContact O-N 2.92Å
85	E	35.1	Very low	40.3	Very low	164 Å²	164	141.3 Å²	141.3	77%	0.766	75%	0.754	S	S	*	*			trans	-60.1	113.3	177.8	-170.4	159.6	176.1	0	0	107.8	S83 I87	S83-E85 PolarHBondContact O-N 2.96Å; E85-I87 VanDerWaalsContact C-N 3.25Å; E85-I87 PolarHBondContact O-N 3.22Å
86	Y	37.5	Very low	41.4	Very low	207 Å²	207	143.5 Å²	143.5	81%	0.812	75%	0.751	S	S	*	*			trans	-62.5	87.9	177.7	-74.1	-99	0	0	0	108.3	A84 M88	A84-Y86 WeakPolarHBondContact O-CD2 3.13Å; A84-Y86 PolarHBondContact O-N 2.92Å; Y86-M88 PolarHBondContact O-N 3.02Å
87	I	43.3	Very low	42.7	Very low	156 Å²	156	141.6 Å²	141.6	80%	0.8	74%	0.74	S	S	*	*			trans	-62.4	108	176.6	-64.9	169.9	0	0	0	107.7	E85	E85-I87 VanDerWaalsContact C-N 3.25Å; E85-I87 PolarHBondContact O-N 3.22Å
88	M	36.9	Very low	43.6	Very low	149 Å²	149	137.7 Å²	137.7	73%	0.734	72%	0.724	S	S	*	*			trans	-48.3	146.6	176.9	-77.7	-73.4	137.7	0	0	112.2	Y86 S90	Y86-M88 PolarHBondContact O-N 3.02Å; M88-S90 VanDerWaalsContact C-N 3.3Å; M88-S90 PolarHBondContact O-N 3.35Å
89	P	44.4	Very low	44.8	Very low	121 Å²	121	139.5 Å²	139.5	79%	0.786	73%	0.725	S	S	*	*			trans	-78.9	70.6	-160.9	34.2	-36.7	0	0	0	112.1	K91	P89-K91 VanDerWaalsContact C-N 3.29Å; P89-K91 PolarHBondContact O-N 3.09Å; P89-K91 VanDerWaalsContact O-N 3.12Å
90	S	42.2	Very low	45.8	Very low	103 Å²	103	140.5 Å²	140.5	72%	0.72	72%	0.72	S	S	*	*			trans	-85.3	74	166.6	71.5	0	0	0	0	110.5	M88 K92	M88-S90 VanDerWaalsContact C-N 3.3Å; M88-S90 PolarHBondContact O-N 3.35Å; S90-K92 PolarHBondContact O-N 3.44Å
91	K	49.8	Very low	46.6	Very low	209 Å²	209	136.5 Å²	136.5	91%	0.909	70%	0.695	S	S	*	*	S	Bend	trans	52.9	0.2	158.9	-70	-178.1	179	176.1	0	120.7	P89	P89-K91 VanDerWaalsContact C-N 3.29Å; P89-K91 PolarHBondContact O-N 3.09Å; P89-K91 VanDerWaalsContact O-N 3.12Å
92	K	48.4	Very low	48	Very low	142 Å²	142	133 Å²	133	62%	0.617	68%	0.677	S	S	*	*			trans	-146.9	89.7	174.4	-60.7	178.3	-173.7	167.4	0	109.7	S90 F94	S90-K92 PolarHBondContact O-N 3.44Å; K92-F94 HydrophobicContact CB-CD2 4.15Å; K92-F94 HydrophobicContact CB-CE2 3.46Å; K92-F94 VanDerWaalsContact CB-CE2 3.46Å; K92-F94 HydrophobicContact CB-CZ 4.07Å; K92-F94 HydrophobicContact CD-CE2 4.34Å; K92-F94 HydrophobicContact CD-CZ 4.43Å; K92-F94 HydrophobicContact CG-CE2 4.49Å; K92-F94 WeakPolarHBondContact O-CD2 3.39Å; K92-F94 PolarHBondContact O-N 2.87Å
93	A	54.8	Low	49.3	Very low	73 Å²	73	124.7 Å²	124.7	60%	0.603	64%	0.639	S	S	*	*			trans	-68	115.4	173	0	0	0	0	0	109.4
94	F	56	Low	50.6	Low	109 Å²	109	125.2 Å²	125.2	48%	0.478	63%	0.625	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-112.9	127	166.9	-60.5	-89.1	0	0	0	107.2	K92 R104	K92-F94 HydrophobicContact CB-CD2 4.15Å; K92-F94 HydrophobicContact CB-CE2 3.46Å; K92-F94 VanDerWaalsContact CB-CE2 3.46Å; K92-F94 HydrophobicContact CB-CZ 4.07Å; K92-F94 HydrophobicContact CD-CE2 4.34Å; K92-F94 HydrophobicContact CD-CZ 4.43Å; K92-F94 HydrophobicContact CG-CE2 4.49Å; K92-F94 WeakPolarHBondContact O-CD2 3.39Å; K92-F94 PolarHBondContact O-N 2.87Å; F94-R104 HydrophobicContact CD1-CB 4.03Å; F94-R104 HydrophobicContact CD1-CG 3.91Å; F94-R104 HydrophobicContact CE1-CB 4.12Å; F94-R104 HydrophobicContact CE1-CG 3.64Å
95	V	59.2	Low	51.6	Low	79 Å²	79	125.8 Å²	125.8	48%	0.479	62%	0.615	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.4	116	170	-178.6	0	0	0	0	106.7	L97 V103	V95-L97 HydrophobicContact CG1-CD2 4.17Å; V95-L97 PolarHBondContact O-N 3.07Å; V95-V103 PolarHBondContact N-O 3.37Å; V95-V103 VanDerWaalsContact N-O 3.07Å; V95-V103 PolarHBondContact O-N 3.09Å
96	R	54.7	Low	52.5	Low	190 Å²	190	119.3 Å²	119.3	72%	0.717	59%	0.592	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-81.1	112.4	176.2	-174.2	177.9	-179.3	175.4	5.6	108.5	G98	R96-G98 WeakPolarHBondContact CG-O 3.49Å; R96-G98 PolarHBondContact NE-O 2.81Å; R96-G98 VanDerWaalsContact NE-O 3.09Å; R96-G98 PolarHBondContact O-N 3.36Å
97	L	56.5	Low	53.6	Low	115 Å²	115	120.2 Å²	120.2	60%	0.602	60%	0.6	S	S	*	*			trans	-93.9	82	171.8	-65.6	-176.9	0	0	0	108.2	V95 G101 V103	V95-L97 HydrophobicContact CG1-CD2 4.17Å; V95-L97 PolarHBondContact O-N 3.07Å; L97-G101 CarbonylContact C-O 3.51Å; L97-G101 PolarHBondContact N-O 2.9Å; L97-V103 HydrophobicContact CD1-CG2 3.49Å; L97-V103 VanDerWaalsContact CD1-CG2 3.49Å; L97-V103 HydrophobicContact CG-CG2 3.96Å
98	G	56.5	Low	54.4	Low	46 Å²	46	123.2 Å²	123.2	47%	0.474	60%	0.601	S	S	.	*	S	Bend	trans	78.3	-155.9	171.8	0	0	0	0	0	116.3	R96	R96-G98 WeakPolarHBondContact CG-O 3.49Å; R96-G98 PolarHBondContact NE-O 2.81Å; R96-G98 VanDerWaalsContact NE-O 3.09Å; R96-G98 PolarHBondContact O-N 3.36Å
99	K	59.4	Low	55.1	Low	199 Å²	199	118.6 Å²	118.6	87%	0.865	59%	0.592	S	S	*	*	S	Bend	trans	-75.2	-26.5	-168.7	-75.9	-177.4	179.4	178.2	0	114.6
100	R	51.8	Low	55.7	Low	218 Å²	218	119.4 Å²	119.4	82%	0.823	58%	0.583	S	S	*	*	S	Bend	trans	-137	27.5	-171.4	-65.2	-175.5	173.3	174	-2.6	113.7	R115	R100-R115 VanDerWaalsContact O-OXT 3.05Å
101	G	47.6	Very low	56.6	Low	18 Å²	18	118.9 Å²	118.9	19%	0.186	58%	0.576	C	S	.	*			trans	-149.8	133.4	-177.1	0	0	0	0	0	112	L97 G114	L97-G101 CarbonylContact C-O 3.51Å; L97-G101 PolarHBondContact N-O 2.9Å; G101-G114 WeakPolarHBondContact CA-O 3.4Å
102	F	66.5	Low	57.2	Low	104 Å²	104	118 Å²	118	46%	0.456	57%	0.567	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-127.6	141.4	168.4	63.3	-87.1	0	0	0	110	G114	F102-G114 PolarHBondContact N-O 3.38Å; F102-G114 PolarHBondContact O-N 3.11Å; F102-G114 VanDerWaalsContact O-N 3.13Å
103	V	60	Low	57.9	Low	20 Å²	20	118 Å²	118	12%	0.121	57%	0.572	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-105.2	120	174	172.5	0	0	0	0	107.7	V95 L97 V111 I113	V95-V103 PolarHBondContact N-O 3.37Å; V95-V103 VanDerWaalsContact N-O 3.07Å; V95-V103 PolarHBondContact O-N 3.09Å; L97-V103 HydrophobicContact CD1-CG2 3.49Å; L97-V103 VanDerWaalsContact CD1-CG2 3.49Å; L97-V103 HydrophobicContact CG-CG2 3.96Å; V103-V111 HydrophobicContact CG1-CG1 3.36Å; V103-I113 HydrophobicContact CG2-CG1 4.44Å
104	R	61.3	Low	58.1	Low	123 Å²	123	115.5 Å²	115.5	46%	0.464	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-108	127	173.5	-173	-175.6	-177.1	179.4	-4.3	109.8	F94 R112	F94-R104 HydrophobicContact CD1-CB 4.03Å; F94-R104 HydrophobicContact CD1-CG 3.91Å; F94-R104 HydrophobicContact CE1-CB 4.12Å; F94-R104 HydrophobicContact CE1-CG 3.64Å; R104-R112 PolarHBondContact N-O 3.3Å; R104-R112 VanDerWaalsContact N-O 3.09Å; R104-R112 PolarHBondContact O-N 3.13Å
105	I	61.1	Low	58	Low	97 Å²	97	123.7 Å²	123.7	50%	0.497	58%	0.581	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-83.3	115.1	169.1	-58.5	174.9	0	0	0	107.9
106	G	54.1	Low	58	Low	27 Å²	27	126 Å²	126	28%	0.278	59%	0.586	S	S	.	*			trans	-76.4	165.3	176.3	0	0	0	0	0	112.8	R108 G109 F110	G106-R108 PolarHBondContact O-N 2.93Å; G106-G109 PolarHBondContact O-N 3.32Å; G106-F110 PolarHBondContact N-O 3.01Å
107	K	62	Low	58.1	Low	226 Å²	226	122.6 Å²	122.6	98%	0.983	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.5	-21.5	178.8	-76.9	-174.7	176.7	-177.5	0	114.9
108	R	59.1	Low	58.2	Low	219 Å²	219	123 Å²	123	83%	0.826	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.4	21	179.3	-66.3	-177	178.1	171.9	0.1	113	G106 F110	G106-R108 PolarHBondContact O-N 2.93Å; R108-F110 HydrophobicContact CB-CD2 3.67Å; R108-F110 HydrophobicContact CB-CE2 3.61Å; R108-F110 PolarHBondContact O-N 2.96Å
109	G	52.1	Low	58.3	Low	53 Å²	53	127.5 Å²	127.5	55%	0.546	58%	0.584	S	S	.	*	S	Bend	trans	76.6	-0.6	178.6	0	0	0	0	0	115.3	G106 V111	G106-G109 PolarHBondContact O-N 3.32Å; G109-V111 PolarHBondContact O-N 3.07Å
110	F	55.8	Low	58.3	Low	138 Å²	138	123.1 Å²	123.1	61%	0.605	57%	0.566	S	S	*	*			trans	-71.4	124.3	175.7	-61.6	-75.1	0	0	0	111.3	G106 R108	G106-F110 PolarHBondContact N-O 3.01Å; R108-F110 HydrophobicContact CB-CD2 3.67Å; R108-F110 HydrophobicContact CB-CE2 3.61Å; R108-F110 PolarHBondContact O-N 2.96Å
111	V	62.7	Low	58.7	Low	92 Å²	92	116.7 Å²	116.7	56%	0.558	55%	0.549	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.6	114.2	171	178.5	0	0	0	0	107.7	V103 G109	V103-V111 HydrophobicContact CG1-CG1 3.36Å; G109-V111 PolarHBondContact O-N 3.07Å
112	R	61.3	Low	59.5	Low	190 Å²	190	123.8 Å²	123.8	72%	0.717	58%	0.575	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-104.4	126.5	172.4	-66.3	-173.7	179.3	-172.8	-1.7	109.4	R104	R104-R112 PolarHBondContact N-O 3.3Å; R104-R112 VanDerWaalsContact N-O 3.09Å; R104-R112 PolarHBondContact O-N 3.13Å
113	I	63.2	Low	58.9	Low	142 Å²	142	125.3 Å²	125.3	73%	0.728	58%	0.584	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96.3	117.1	176.8	-58	168	0	0	0	107.6	V103	V103-I113 HydrophobicContact CG2-CG1 4.44Å
114	G	58.9	Low	58.9	Low	20 Å²	20	134.1 Å²	134.1	21%	0.206	62%	0.623	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-104	138.4	169.4	0	0	0	0	0	110.6	G101 F102	G101-G114 WeakPolarHBondContact CA-O 3.4Å; F102-G114 PolarHBondContact N-O 3.38Å; F102-G114 PolarHBondContact O-N 3.11Å; F102-G114 VanDerWaalsContact O-N 3.13Å
115	R	54.7	Low	58.6	Low	282 Å²	282	135.1 Å²	135.1	100%	1.064	64%	0.637	S	S	*	*			trans	-87.7	0	164.2	-75.8	-175	178	145.6	-0.5	110.3	R100	R100-R115 VanDerWaalsContact O-OXT 3.05Å

Retrieved 115 of 115 residues in 64.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).