A0A3Q0KH56_SCHMA Loading...

Small ribosomal subunit protein uS10

AlphaFold DB (Q15EU0), UniProt , Accession A0A3Q0KH56, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 117 aa.

						>A0A3Q0KH56_SCHMA|A0A3Q0KH56
MTEKKADVPQLSTRNWVRVTLTAASVKPLEKVTDGLIKKAKDQNLRVKGPVRMPTKVLRITTRKTPCGEGSKTWDRFQFRIHKRVIDLLSTDEATQQLKHIYLEPGVNCDVKVAGDL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.3	Very low	52.2	Low	240 Å²	240	159.5 Å²	159.5	100%	1.182	84%	0.837	S	S	*	*				0	100	0	-62.9	-175.7	-166.7	0	0	106.3	E3	M1-E3 PolarHBondContact O-N 3.36Å
2	T	51.8	Low	53.3	Low	148 Å²	148	154.3 Å²	154.3	91%	0.908	82%	0.824	S	S	*	*			trans	-70.8	113.1	179.8	16.8	0	0	0	0	108.3	K4	T2-K4 PolarHBondContact O-N 2.65Å; T2-K4 VanDerWaalsContact O-N 3.11Å
3	E	46.2	Very low	55	Low	188 Å²	188	149.7 Å²	149.7	88%	0.879	81%	0.805	S	S	*	*			trans	-51.2	115.8	176.8	-67	177.8	155.8	0	0	109.4	M1 K5	M1-E3 PolarHBondContact O-N 3.36Å; E3-K5 VanDerWaalsContact C-N 3.33Å; E3-K5 PolarHBondContact O-N 3.02Å
4	K	52.7	Low	56.8	Low	203 Å²	203	152.3 Å²	152.3	88%	0.883	80%	0.798	S	S	*	*			trans	-66.2	99.5	169.2	-155.4	-179.7	-171.4	-177	0	105.3	T2 A6	T2-K4 PolarHBondContact O-N 2.65Å; T2-K4 VanDerWaalsContact O-N 3.11Å; K4-A6 PolarHBondContact O-N 3.08Å
5	K	44.3	Very low	58.8	Low	198 Å²	198	146.1 Å²	146.1	86%	0.861	77%	0.766	S	S	*	*			trans	-47.6	118	170.7	-105.6	-178.2	174.3	179.8	0	107.3	E3 D7	E3-K5 VanDerWaalsContact C-N 3.33Å; E3-K5 PolarHBondContact O-N 3.02Å; K5-D7 PolarHBondContact O-N 3.09Å
6	A	51.3	Low	60.7	Low	88 Å²	88	147.3 Å²	147.3	73%	0.727	76%	0.757	S	S	*	*			trans	-58.6	121.6	171.4	0	0	0	0	0	107.3	K4 V8	K4-A6 PolarHBondContact O-N 3.08Å; A6-V8 PolarHBondContact O-N 2.81Å
7	D	55.8	Low	62.4	Low	140 Å²	140	138.8 Å²	138.8	75%	0.749	71%	0.714	S	S	*	*			trans	-60.8	108.5	173.5	-140.8	-94.7	0	0	0	106.5	K5 P9	K5-D7 PolarHBondContact O-N 3.09Å; D7-P9 WeakPolarHBondContact O-CD 3.26Å
8	V	59	Low	64.1	Low	112 Å²	112	138.1 Å²	138.1	68%	0.679	70%	0.7	S	S	*	*			trans	-58.7	121.8	170.9	178.8	0	0	0	0	105.2	A6 Q10	A6-V8 PolarHBondContact O-N 2.81Å; V8-Q10 VanDerWaalsContact C-N 3.3Å; V8-Q10 PolarHBondContact O-N 3.29Å
9	P	55.7	Low	65.5	Low	116 Å²	116	131.2 Å²	131.2	75%	0.753	67%	0.666	S	S	*	*			trans	-64.2	97.9	-179.3	25.1	-31.8	0	0	0	107.3	D7 L11	D7-P9 WeakPolarHBondContact O-CD 3.26Å; P9-L11 PolarHBondContact O-N 3.28Å; P9-L11 VanDerWaalsContact O-N 3.09Å
10	Q	57.4	Low	66.8	Low	162 Å²	162	125.4 Å²	125.4	76%	0.757	64%	0.637	S	S	*	*			trans	-59	121.4	180	-63.9	-179	28.2	0	0	106.4	V8 S12	V8-Q10 VanDerWaalsContact C-N 3.3Å; V8-Q10 PolarHBondContact O-N 3.29Å; Q10-S12 PolarHBondContact O-N 2.95Å
11	L	55.1	Low	68.1	Low	159 Å²	159	119.5 Å²	119.5	83%	0.832	61%	0.608	S	S	*	*			trans	-44.4	118.1	173.7	-129.3	91.4	0	0	0	107.3	P9 T13	P9-L11 PolarHBondContact O-N 3.28Å; P9-L11 VanDerWaalsContact O-N 3.09Å; L11-T13 PolarHBondContact O-N 2.99Å; L11-T13 PolarHBondContact O-OG1 3.04Å; L11-T13 VanDerWaalsContact O-OG1 3.08Å
12	S	64.8	Low	70.4	Confident	97 Å²	97	109.9 Å²	109.9	68%	0.678	56%	0.562	S	S	*	*			trans	-64.6	79.8	-166.8	49.7	0	0	0	0	111.6	Q10 R14	Q10-S12 PolarHBondContact O-N 2.95Å; S12-R14 PolarHBondContact O-N 2.87Å
13	T	76.2	Confident	72.4	Confident	95 Å²	95	103.2 Å²	103.2	58%	0.583	52%	0.522	S	S	*	.			trans	-74	124	179.9	-53.7	0	0	0	0	107	L11 N15	L11-T13 PolarHBondContact O-N 2.99Å; L11-T13 PolarHBondContact O-OG1 3.04Å; L11-T13 VanDerWaalsContact O-OG1 3.08Å; T13-N15 VanDerWaalsContact CG2-OD1 3.26Å; T13-N15 WeakPolarHBondContact CG2-OD1 3.43Å; T13-N15 PolarHBondContact O-N 3.44Å; T13-N15 PolarHBondContact O-OD1 2.79Å
14	R	80.1	Confident	74.7	Confident	186 Å²	186	96.5 Å²	96.5	70%	0.702	50%	0.499	S	S	*	.			trans	-76.7	108.6	175.7	-70.1	-179.2	179.5	159.2	-1.2	108	S12 L89	S12-R14 PolarHBondContact O-N 2.87Å; R14-L89 HydrophobicContact CB-CD1 4.02Å; R14-L89 HydrophobicContact CB-CG 4.11Å
15	N	86.4	Confident	76.6	Confident	60 Å²	60	90.2 Å²	90.2	32%	0.321	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	149.7	-179.9	-68.2	5	0	0	0	110	T13 S90 V113	T13-N15 VanDerWaalsContact CG2-OD1 3.26Å; T13-N15 WeakPolarHBondContact CG2-OD1 3.43Å; T13-N15 PolarHBondContact O-N 3.44Å; T13-N15 PolarHBondContact O-OD1 2.79Å; N15-S90 PolarHBondContact N-O 3.41Å; N15-S90 PolarHBondContact O-N 3.04Å; N15-V113 HydrophobicContact CB-CG1 3.83Å
16	W	89.1	Confident	79	Confident	164 Å²	164	83.7 Å²	83.7	62%	0.621	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73	132.3	166.2	-77.9	-49.9	0	0	0	109.5	L88 L89 A114	W16-L88 CarbonylContact C-O 3.58Å; W16-L88 WeakPolarHBondContact CA-O 3.44Å; W16-L89 HydrophobicContact CG-CD1 4.29Å; W16-A114 HydrophobicContact CB-CB 4.03Å; W16-A114 VanDerWaalsContact O-CB 3.29Å; W16-A114 WeakPolarHBondContact O-CB 3.31Å; W16-A114 PolarHBondContact O-N 2.74Å
17	V	90.3	Very high	80.9	Confident	3 Å²	3	87.9 Å²	87.9	2%	0.018	46%	0.459	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	127.2	177.7	-178.8	0	0	0	0	107.7	V19 D87 L88 T95 V111 K112 V113	V17-V19 HydrophobicContact CG1-CG2 4.48Å; V17-D87 CarbonylContact O-C 3.57Å; V17-D87 WeakPolarHBondContact O-CA 3.45Å; V17-L88 PolarHBondContact N-O 2.98Å; V17-L88 PolarHBondContact O-N 3.35Å; V17-T95 HydrophobicContact CG1-CG2 3.84Å; V17-T95 HydrophobicContact CG2-CG2 4.07Å; V17-V111 HydrophobicContact CG1-CG1 3.48Å; V17-V111 VanDerWaalsContact CG1-CG1 3.48Å; V17-K112 CarbonylContact C-O 3.57Å; V17-K112 WeakPolarHBondContact CA-O 3.43Å; V17-V113 HydrophobicContact CG2-CG1 4.49Å; V17-V113 HydrophobicContact CG2-CG2 4.25Å
18	R	91.5	Very high	82.7	Confident	126 Å²	126	82.3 Å²	82.3	48%	0.475	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	115.5	175.9	176.5	163.9	-71.8	165.7	0.8	109.4	V85 D87 K112	R18-V85 HydrophobicContact CG-CG1 3.62Å; R18-D87 WeakPolarHBondContact CB-OD1 3.18Å; R18-D87 VanDerWaalsContact CG-OD1 3.31Å; R18-D87 WeakPolarHBondContact CG-OD1 3.22Å; R18-D87 IonicContact CZ-OD1 3.53Å; R18-D87 IonicContact CZ-OD2 3.72Å; R18-D87 IonicContact NE-OD1 2.74Å; R18-D87 PolarHBondContact NE-OD1 3.03Å; R18-D87 IonicContact NE-OD2 3.69Å; R18-D87 IonicContact NH2-OD1 3.44Å; R18-D87 PolarHBondContact NH2-OD1 3.25Å; R18-D87 IonicContact NH2-OD2 2.87Å; R18-D87 PolarHBondContact NH2-OD2 3.48Å; R18-K112 PolarHBondContact N-O 2.79Å; R18-K112 PolarHBondContact O-N 2.78Å
19	V	91.2	Very high	84.3	Confident	8 Å²	8	77 Å²	77	5%	0.048	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	121.3	171.6	-174.3	0	0	0	0	108.8	V17 L21 L36 V85 I86 L88 D110 V111	V17-V19 HydrophobicContact CG1-CG2 4.48Å; V19-L21 HydrophobicContact CG1-CD2 4.02Å; V19-L21 HydrophobicContact CG1-CG 4.41Å; V19-L36 HydrophobicContact CB-CD2 4.09Å; V19-L36 HydrophobicContact CG1-CD2 3.75Å; V19-L36 HydrophobicContact CG2-CD2 4.26Å; V19-V85 CarbonylContact O-C 3.53Å; V19-V85 WeakPolarHBondContact O-CA 3.38Å; V19-I86 HydrophobicContact CB-CB 4.49Å; V19-I86 PolarHBondContact N-O 2.92Å; V19-I86 PolarHBondContact O-N 3.4Å; V19-L88 HydrophobicContact CG2-CD1 4.22Å; V19-D110 CarbonylContact C-O 3.56Å; V19-D110 WeakPolarHBondContact CA-O 2.93Å; V19-V111 HydrophobicContact CG1-CG2 4.3Å; V19-V111 HydrophobicContact CG2-CG1 4.45Å; V19-V111 HydrophobicContact CG2-CG2 4.24Å
20	T	92.4	Very high	86.1	Confident	15 Å²	15	73.1 Å²	73.1	9%	0.092	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	119.3	176.1	-66.7	0	0	0	0	109.4	T22 K83 D110	T20-T22 HydrophobicContact CG2-CG2 4.16Å; T20-K83 HydrophobicContact CG2-CD 4.29Å; T20-K83 HydrophobicContact CG2-CG 4.19Å; T20-D110 PolarHBondContact N-O 2.77Å; T20-D110 PolarHBondContact O-N 3.1Å
21	L	92.8	Very high	87.7	Confident	2 Å²	2	72.2 Å²	72.2	1%	0.01	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	132	174.4	-53.1	175.6	0	0	0	109.3	V19 L29 V32 T33 K83 R84 N108 C109	V19-L21 HydrophobicContact CG1-CD2 4.02Å; V19-L21 HydrophobicContact CG1-CG 4.41Å; L21-L29 HydrophobicContact CB-CD1 3.55Å; L21-V32 HydrophobicContact CD1-CG1 4.06Å; L21-V32 HydrophobicContact CD2-CG1 4.23Å; L21-T33 WeakPolarHBondContact CD1-OG1 3.47Å; L21-K83 CarbonylContact O-C 3.57Å; L21-K83 WeakPolarHBondContact O-CA 3.46Å; L21-R84 HydrophobicContact CB-CB 4.27Å; L21-R84 PolarHBondContact N-O 2.83Å; L21-R84 PolarHBondContact O-N 3.35Å; L21-N108 WeakPolarHBondContact CA-O 3.37Å; L21-C109 HydrophobicContact CD2-CB 4Å; L21-C109 WeakPolarHBondContact CD2-SG 3.3Å
22	T	93.7	Very high	89.5	Confident	38 Å²	38	64.9 Å²	64.9	23%	0.233	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.4	133.7	176.1	52.5	0	0	0	0	110.8	T20 H82 K83 N108	T20-T22 HydrophobicContact CG2-CG2 4.16Å; T22-H82 WeakPolarHBondContact CA-O 3.43Å; T22-K83 HydrophobicContact CG2-CB 4.11Å; T22-K83 HydrophobicContact CG2-CD 4.4Å; T22-K83 HydrophobicContact CG2-CG 3.94Å; T22-N108 PolarHBondContact N-O 3.03Å; T22-N108 PolarHBondContact O-N 2.75Å; T22-N108 WeakPolarHBondContact OG1-CB 3.24Å; T22-N108 PolarHBondContact OG1-O 2.73Å
23	A	94.6	Very high	90.8	Very high	7 Å²	7	60.3 Å²	60.3	6%	0.058	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.5	157.4	177.2	0	0	0	0	0	111.6	L29 H82 V107	A23-L29 HydrophobicContact CB-CB 3.94Å; A23-L29 HydrophobicContact CB-CD1 4.03Å; A23-L29 HydrophobicContact CB-CD2 4.23Å; A23-L29 HydrophobicContact CB-CG 4.3Å; A23-H82 PolarHBondContact N-O 2.73Å; A23-H82 PolarHBondContact O-N 3.19Å; A23-V107 HydrophobicContact CB-CB 4.49Å; A23-V107 HydrophobicContact CB-CG2 4.06Å
24	A	94.2	Very high	91.5	Very high	47 Å²	47	59.7 Å²	59.7	39%	0.388	29%	0.286	S	S	.	.	S	Bend	trans	-77.4	-31.2	171	0	0	0	0	0	112.4	F79 R80 H82	A24-F79 HydrophobicContact CB-CE2 3.71Å; A24-F79 HydrophobicContact CB-CZ 3.74Å; A24-R80 WeakPolarHBondContact CA-O 3.41Å; A24-H82 PolarHBondContact O-CD2 2.89Å; A24-H82 VanDerWaalsContact O-CD2 3.31Å
25	S	93.1	Very high	92	Very high	71 Å²	71	51.6 Å²	51.6	50%	0.497	26%	0.261	S	S	.	.			trans	-109.7	131.8	-175.2	-66.9	0	0	0	0	111.4	L29	S25-L29 WeakPolarHBondContact O-CB 3.32Å
26	V	93.5	Very high	92.2	Very high	61 Å²	61	49 Å²	49	37%	0.37	25%	0.247	S	C	.	.	H	α-helix	trans	-71.4	-39.2	-177.2	-176.9	0	0	0	0	112.6	L29 E30 H82	V26-L29 WeakPolarHBondContact O-CB 3.29Å; V26-L29 PolarHBondContact O-N 3.01Å; V26-E30 HydrophobicContact CG1-CG 3.75Å; V26-E30 WeakPolarHBondContact O-CG 3.4Å; V26-E30 PolarHBondContact O-N 2.95Å; V26-H82 WeakPolarHBondContact CG2-NE2 3.38Å
27	K	93	Very high	92.3	Very high	176 Å²	176	42.2 Å²	42.2	77%	0.765	22%	0.223	S	C	*	.	H	α-helix	trans	-57.3	-55	-176.1	-67.4	-177.2	179.4	-178.3	0	113.7	L29 K31	K27-L29 VanDerWaalsContact C-N 3.3Å; K27-L29 PolarHBondContact O-N 3.43Å; K27-K31 WeakPolarHBondContact O-CG 3.5Å; K27-K31 PolarHBondContact O-N 3.33Å
28	P	92.3	Very high	92.3	Very high	23 Å²	23	48.6 Å²	48.6	15%	0.149	25%	0.25	C	S	.	.	H	α-helix	trans	-64.9	-35.6	177	25.1	-33.9	0	0	0	111.9	K31 V32 E104 V107	P28-K31 PolarHBondContact O-N 3.01Å; P28-V32 WeakPolarHBondContact O-CG2 3.43Å; P28-V32 PolarHBondContact O-N 3.41Å; P28-E104 HydrophobicContact CB-CG 3.58Å; P28-V107 HydrophobicContact CB-CG2 3.91Å; P28-V107 HydrophobicContact CG-CG2 4.38Å
29	L	93	Very high	92.2	Very high	0 Å²	0	46.4 Å²	46.4	0%	0	24%	0.244	C	C	.	.	H	α-helix	trans	-62.2	-47.1	179.3	-175.6	62.8	0	0	0	112.9	L21 A23 S25 V26 K27 V32 T33 H82 R84 V107	L21-L29 HydrophobicContact CB-CD1 3.55Å; A23-L29 HydrophobicContact CB-CB 3.94Å; A23-L29 HydrophobicContact CB-CD1 4.03Å; A23-L29 HydrophobicContact CB-CD2 4.23Å; A23-L29 HydrophobicContact CB-CG 4.3Å; S25-L29 WeakPolarHBondContact O-CB 3.32Å; V26-L29 WeakPolarHBondContact O-CB 3.29Å; V26-L29 PolarHBondContact O-N 3.01Å; K27-L29 VanDerWaalsContact C-N 3.3Å; K27-L29 PolarHBondContact O-N 3.43Å; L29-V32 PolarHBondContact O-N 3.48Å; L29-T33 WeakPolarHBondContact O-CB 3.43Å; L29-T33 PolarHBondContact O-N 3.22Å; L29-T33 PolarHBondContact O-OG1 3.1Å; L29-H82 HydrophobicContact CD2-CB 3.44Å; L29-H82 VanDerWaalsContact CD2-CB 3.44Å; L29-R84 HydrophobicContact CD1-CG 4.26Å; L29-R84 HydrophobicContact CD2-CG 3.88Å; L29-R84 HydrophobicContact CG-CG 3.94Å; L29-V107 HydrophobicContact CD1-CG1 4Å
30	E	92.9	Very high	92	Very high	35 Å²	35	46.1 Å²	46.1	16%	0.164	24%	0.242	C	C	.	.	H	α-helix	trans	-67.7	-38	178.8	-61.4	-73.2	143	0	0	110.6	V26 V32 T33 D34 R52 R84	V26-E30 HydrophobicContact CG1-CG 3.75Å; V26-E30 WeakPolarHBondContact O-CG 3.4Å; V26-E30 PolarHBondContact O-N 2.95Å; E30-V32 PolarHBondContact O-N 3.42Å; E30-T33 PolarHBondContact O-N 3.33Å; E30-D34 WeakPolarHBondContact O-CB 3.27Å; E30-D34 VanDerWaalsContact O-CG 3.27Å; E30-D34 PolarHBondContact O-N 3.02Å; E30-R52 IonicContact OE1-NE 3.69Å; E30-R52 IonicContact OE1-NH2 3.92Å; E30-R52 IonicContact OE2-CZ 3.81Å; E30-R52 IonicContact OE2-NE 3.87Å; E30-R52 IonicContact OE2-NH2 2.87Å; E30-R52 PolarHBondContact OE2-NH2 2.99Å; E30-R84 IonicContact OE1-CZ 2.73Å; E30-R84 VanDerWaalsContact OE1-CZ 3.24Å; E30-R84 IonicContact OE1-NE 3.91Å; E30-R84 PolarHBondContact OE1-NE 3.24Å; E30-R84 IonicContact OE1-NH2 2.89Å; E30-R84 PolarHBondContact OE1-NH2 2.88Å
31	K	92.1	Very high	91.9	Very high	144 Å²	144	52 Å²	52	63%	0.626	27%	0.266	S	S	*	.	H	α-helix	trans	-57	-46.6	173.4	-73.4	179.5	178.5	-174.5	0	112.6	K27 P28 G35	K27-K31 WeakPolarHBondContact O-CG 3.5Å; K27-K31 PolarHBondContact O-N 3.33Å; P28-K31 PolarHBondContact O-N 3.01Å; K31-G35 PolarHBondContact O-N 2.98Å
32	V	91.6	Very high	91.7	Very high	5 Å²	5	57.8 Å²	57.8	3%	0.03	30%	0.298	C	S	.	.	H	α-helix	trans	-66.9	-42.9	177.8	174.4	0	0	0	0	110.9	L21 P28 L29 E30 G35 L36 Y102 E104 V107	L21-V32 HydrophobicContact CD1-CG1 4.06Å; L21-V32 HydrophobicContact CD2-CG1 4.23Å; P28-V32 WeakPolarHBondContact O-CG2 3.43Å; P28-V32 PolarHBondContact O-N 3.41Å; L29-V32 PolarHBondContact O-N 3.48Å; E30-V32 PolarHBondContact O-N 3.42Å; V32-G35 PolarHBondContact O-N 2.85Å; V32-L36 WeakPolarHBondContact O-CB 3.32Å; V32-L36 PolarHBondContact O-N 3.39Å; V32-Y102 HydrophobicContact CG1-CD1 4.01Å; V32-Y102 HydrophobicContact CG1-CG 3.9Å; V32-Y102 HydrophobicContact CG2-CD1 4.42Å; V32-E104 HydrophobicContact CG2-CB 3.5Å; V32-E104 VanDerWaalsContact CG2-CB 3.5Å; V32-E104 HydrophobicContact CG2-CG 4.13Å; V32-V107 HydrophobicContact CG1-CG1 4.44Å; V32-V107 HydrophobicContact CG2-CB 4.5Å; V32-V107 HydrophobicContact CG2-CG1 4.43Å; V32-V107 HydrophobicContact CG2-CG2 4.25Å
33	T	92.5	Very high	91.4	Very high	0 Å²	0	59.5 Å²	59.5	0%	0	30%	0.303	C	S	.	.	H	α-helix	trans	-59.5	-49.2	178.4	-56.1	0	0	0	0	111	L21 L29 E30 L36 I37 P50 I86	L21-T33 WeakPolarHBondContact CD1-OG1 3.47Å; L29-T33 WeakPolarHBondContact O-CB 3.43Å; L29-T33 PolarHBondContact O-N 3.22Å; L29-T33 PolarHBondContact O-OG1 3.1Å; E30-T33 PolarHBondContact O-N 3.33Å; T33-L36 PolarHBondContact O-N 3.42Å; T33-I37 HydrophobicContact CG2-CD1 4.07Å; T33-I37 WeakPolarHBondContact O-CD1 3.46Å; T33-I37 VanDerWaalsContact O-CG1 3.3Å; T33-I37 WeakPolarHBondContact O-CG1 3.27Å; T33-I37 PolarHBondContact O-N 2.89Å; T33-I37 VanDerWaalsContact O-N 3.11Å; T33-P50 HydrophobicContact CG2-CB 3.46Å; T33-P50 VanDerWaalsContact CG2-CB 3.46Å; T33-P50 HydrophobicContact CG2-CG 4.18Å; T33-I86 HydrophobicContact CG2-CD1 3.87Å
34	D	92.2	Very high	91	Very high	82 Å²	82	66.1 Å²	66.1	44%	0.439	34%	0.337	S	S	.	.	H	α-helix	trans	-65.9	-40.3	179	-70.4	-23.8	0	0	0	111.7	E30 I37 K38	E30-D34 WeakPolarHBondContact O-CB 3.27Å; E30-D34 VanDerWaalsContact O-CG 3.27Å; E30-D34 PolarHBondContact O-N 3.02Å; D34-I37 PolarHBondContact O-N 3Å; D34-K38 WeakPolarHBondContact O-CG 3.35Å; D34-K38 PolarHBondContact O-N 2.79Å
35	G	90.2	Very high	90.6	Very high	17 Å²	17	65.4 Å²	65.4	18%	0.175	33%	0.327	C	S	.	.	H	α-helix	trans	-58.1	-49	173.8	0	0	0	0	0	111.8	K31 V32 I37 K38 K39 Y102	K31-G35 PolarHBondContact O-N 2.98Å; V32-G35 PolarHBondContact O-N 2.85Å; G35-I37 VanDerWaalsContact C-N 3.32Å; G35-I37 PolarHBondContact O-N 2.78Å; G35-K38 PolarHBondContact O-N 3.08Å; G35-K39 PolarHBondContact O-N 3.48Å; G35-Y102 WeakPolarHBondContact CA-OH 3.35Å; G35-Y102 PolarHBondContact O-OH 3.49Å
36	L	89.8	Confident	90.4	Very high	6 Å²	6	71.1 Å²	71.1	3%	0.031	34%	0.337	C	S	.	.	H	α-helix	trans	-62.4	-41.5	-177.9	-169.8	69.6	0	0	0	111.5	V19 V32 T33 K39 A40 I86 L98 Y102	V19-L36 HydrophobicContact CB-CD2 4.09Å; V19-L36 HydrophobicContact CG1-CD2 3.75Å; V19-L36 HydrophobicContact CG2-CD2 4.26Å; V32-L36 WeakPolarHBondContact O-CB 3.32Å; V32-L36 PolarHBondContact O-N 3.39Å; T33-L36 PolarHBondContact O-N 3.42Å; L36-K39 PolarHBondContact O-N 3.04Å; L36-A40 VanDerWaalsContact O-CB 3.32Å; L36-A40 WeakPolarHBondContact O-CB 3.32Å; L36-A40 PolarHBondContact O-N 3.07Å; L36-I86 HydrophobicContact CB-CD1 4.36Å; L36-I86 HydrophobicContact CD2-CD1 3.73Å; L36-I86 HydrophobicContact CG-CD1 4.43Å; L36-L98 HydrophobicContact CD1-CB 4.5Å; L36-L98 HydrophobicContact CD1-CD2 3.65Å; L36-Y102 HydrophobicContact CB-CE2 4.11Å; L36-Y102 HydrophobicContact CD1-CD2 4.04Å; L36-Y102 HydrophobicContact CD1-CE2 3.67Å; L36-Y102 PolarHBondContact N-OH 2.8Å
37	I	90.8	Very high	90.2	Very high	21 Å²	21	70.1 Å²	70.1	11%	0.108	33%	0.332	C	S	.	.	H	α-helix	trans	-65.2	-42.5	177.7	-66.6	159.5	0	0	0	111.2	T33 D34 G35 A40 K41 P50 I86	T33-I37 HydrophobicContact CG2-CD1 4.07Å; T33-I37 WeakPolarHBondContact O-CD1 3.46Å; T33-I37 VanDerWaalsContact O-CG1 3.3Å; T33-I37 WeakPolarHBondContact O-CG1 3.27Å; T33-I37 PolarHBondContact O-N 2.89Å; T33-I37 VanDerWaalsContact O-N 3.11Å; D34-I37 PolarHBondContact O-N 3Å; G35-I37 VanDerWaalsContact C-N 3.32Å; G35-I37 PolarHBondContact O-N 2.78Å; I37-A40 PolarHBondContact O-N 2.78Å; I37-K41 HydrophobicContact CG2-CD 4.19Å; I37-K41 VanDerWaalsContact O-CG 3.32Å; I37-K41 WeakPolarHBondContact O-CG 3.3Å; I37-K41 PolarHBondContact O-N 3.22Å; I37-P50 HydrophobicContact CD1-CB 3.98Å; I37-P50 VanDerWaalsContact CD1-CD 3.49Å; I37-P50 HydrophobicContact CD1-CG 3.54Å; I37-I86 HydrophobicContact CD1-CD1 4.34Å; I37-I86 HydrophobicContact CG1-CD1 4Å
38	K	90.9	Very high	90.1	Very high	137 Å²	137	67.9 Å²	67.9	60%	0.596	32%	0.322	S	S	*	.	H	α-helix	trans	-60.1	-50.1	177.3	-74.9	174.5	-179.7	-178	0	110.8	D34 G35 A40 K41 D42	D34-K38 WeakPolarHBondContact O-CG 3.35Å; D34-K38 PolarHBondContact O-N 2.79Å; G35-K38 PolarHBondContact O-N 3.08Å; K38-A40 PolarHBondContact O-N 3.37Å; K38-K41 WeakPolarHBondContact O-CA 3.34Å; K38-K41 WeakPolarHBondContact O-CB 3.37Å; K38-K41 PolarHBondContact O-N 3.03Å; K38-K41 VanDerWaalsContact O-N 3.09Å; K38-D42 PolarHBondContact O-N 3.46Å
39	K	88.6	Confident	89.8	Confident	80 Å²	80	68.8 Å²	68.8	35%	0.348	34%	0.336	S	S	.	.	H	α-helix	trans	-63.2	-40.5	179.3	-67.5	-168.4	-176.7	-172.1	0	113.3	G35 L36 K41 D42 Q43 I101 Y102	G35-K39 PolarHBondContact O-N 3.48Å; L36-K39 PolarHBondContact O-N 3.04Å; K39-K41 VanDerWaalsContact C-N 3.26Å; K39-K41 PolarHBondContact O-N 3.03Å; K39-D42 PolarHBondContact O-N 3.02Å; K39-Q43 WeakPolarHBondContact O-CG 3.47Å; K39-Q43 PolarHBondContact O-N 3.4Å; K39-I101 HydrophobicContact CD-CD1 3.91Å; K39-I101 HydrophobicContact CD-CG2 3.77Å; K39-Y102 HydrophobicContact CD-CE2 4.44Å; K39-Y102 WeakPolarHBondContact CD-OH 3.42Å; K39-Y102 WeakPolarHBondContact CE-OH 3.35Å
40	A	88.8	Confident	89.7	Confident	1 Å²	1	71.1 Å²	71.1	1%	0.008	35%	0.351	C	S	.	.	H	α-helix	trans	-63.4	-35.4	175.9	0	0	0	0	0	111.9	L36 I37 K38 N44 L45 V47 L88	L36-A40 VanDerWaalsContact O-CB 3.32Å; L36-A40 WeakPolarHBondContact O-CB 3.32Å; L36-A40 PolarHBondContact O-N 3.07Å; I37-A40 PolarHBondContact O-N 2.78Å; K38-A40 PolarHBondContact O-N 3.37Å; A40-N44 PolarHBondContact O-N 3.26Å; A40-L45 HydrophobicContact CB-CB 4.49Å; A40-L45 HydrophobicContact CB-CD1 4.47Å; A40-L45 WeakPolarHBondContact O-CB 3.39Å; A40-L45 PolarHBondContact O-N 3.43Å; A40-V47 HydrophobicContact CB-CG2 3.53Å; A40-L88 HydrophobicContact CB-CD2 3.95Å
41	K	88.8	Confident	89.9	Confident	138 Å²	138	73.2 Å²	73.2	60%	0.6	37%	0.366	S	S	*	.	H	α-helix	trans	-69.5	-41.5	172.6	-73.3	176.4	177.3	-174.7	0	112.3	I37 K38 K39 Q43 N44	I37-K41 HydrophobicContact CG2-CD 4.19Å; I37-K41 VanDerWaalsContact O-CG 3.32Å; I37-K41 WeakPolarHBondContact O-CG 3.3Å; I37-K41 PolarHBondContact O-N 3.22Å; K38-K41 WeakPolarHBondContact O-CA 3.34Å; K38-K41 WeakPolarHBondContact O-CB 3.37Å; K38-K41 PolarHBondContact O-N 3.03Å; K38-K41 VanDerWaalsContact O-N 3.09Å; K39-K41 VanDerWaalsContact C-N 3.26Å; K39-K41 PolarHBondContact O-N 3.03Å; K41-Q43 PolarHBondContact O-N 3.09Å; K41-N44 PolarHBondContact O-N 2.87Å
42	D	89.5	Confident	90	Very high	125 Å²	125	74 Å²	74	67%	0.668	36%	0.364	S	S	*	.	H	α-helix	trans	-60.8	-35	177.3	-60.6	-28.8	0	0	0	111.6	K38 K39 N44	K38-D42 PolarHBondContact O-N 3.46Å; K39-D42 PolarHBondContact O-N 3.02Å; D42-N44 VanDerWaalsContact C-N 3.26Å; D42-N44 PolarHBondContact O-N 3.11Å
43	Q	86.8	Confident	90.2	Very high	73 Å²	73	77.5 Å²	77.5	34%	0.341	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.8	3.4	174.6	-67.5	-174.9	-24.2	0	0	114.1	K39 K41 L45	K39-Q43 WeakPolarHBondContact O-CG 3.47Å; K39-Q43 PolarHBondContact O-N 3.4Å; K41-Q43 PolarHBondContact O-N 3.09Å; Q43-L45 HydrophobicContact CB-CD1 4.29Å; Q43-L45 HydrophobicContact CB-CG 4.06Å; Q43-L45 PolarHBondContact O-N 3.34Å
44	N	85.6	Confident	90.4	Very high	146 Å²	146	82.6 Å²	82.6	78%	0.781	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.4	31.7	-176.3	-60.5	-65.3	0	0	0	114.4	A40 K41 D42	A40-N44 PolarHBondContact O-N 3.26Å; K41-N44 PolarHBondContact O-N 2.87Å; D42-N44 VanDerWaalsContact C-N 3.26Å; D42-N44 PolarHBondContact O-N 3.11Å
45	L	86	Confident	90.6	Very high	32 Å²	32	81.2 Å²	81.2	17%	0.168	41%	0.409	C	S	.	.			trans	-77.8	147	174.4	-62.1	173.9	0	0	0	110.7	A40 Q43 V47 A94 L98	A40-L45 HydrophobicContact CB-CB 4.49Å; A40-L45 HydrophobicContact CB-CD1 4.47Å; A40-L45 WeakPolarHBondContact O-CB 3.39Å; A40-L45 PolarHBondContact O-N 3.43Å; Q43-L45 HydrophobicContact CB-CD1 4.29Å; Q43-L45 HydrophobicContact CB-CG 4.06Å; Q43-L45 PolarHBondContact O-N 3.34Å; L45-V47 PolarHBondContact O-N 2.9Å; L45-A94 HydrophobicContact CD1-CB 4.45Å; L45-A94 HydrophobicContact CD2-CB 4.48Å; L45-L98 HydrophobicContact CD1-CD1 4.06Å
46	R	88.8	Confident	90.8	Very high	191 Å²	191	87.6 Å²	87.6	72%	0.721	43%	0.432	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78	113	172.4	-67.3	177.2	67.4	-163.2	4.7	109.2	L89	R46-L89 HydrophobicContact CB-CB 4.18Å; R46-L89 PolarHBondContact O-N 2.92Å
47	V	90.8	Very high	91.2	Very high	41 Å²	41	90 Å²	90	25%	0.248	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	127.5	-178	-172.4	0	0	0	0	110.3	A40 L45 I86 L88	A40-V47 HydrophobicContact CB-CG2 3.53Å; L45-V47 PolarHBondContact O-N 2.9Å; V47-I86 HydrophobicContact CG1-CG2 3.96Å; V47-L88 HydrophobicContact CB-CD2 3.97Å; V47-L88 HydrophobicContact CG1-CD2 3.75Å; V47-L88 HydrophobicContact CG2-CD2 3.58Å
48	K	91	Very high	91.4	Very high	129 Å²	129	93.5 Å²	93.5	56%	0.561	47%	0.466	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.7	124	155.8	-65.8	-178	177.4	176.8	0	106.9	D87	K48-D87 HydrophobicContact CB-CB 4.08Å; K48-D87 HydrophobicContact CD-CB 4.22Å; K48-D87 PolarHBondContact N-O 3.3Å
49	G	84.7	Confident	91.7	Very high	42 Å²	42	95.4 Å²	95.4	43%	0.433	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-55.8	173.3	-169.6	0	0	0	0	0	114.4	V51	G49-V51 PolarHBondContact O-N 3.49Å
50	P	92.4	Very high	92	Very high	49 Å²	49	96.9 Å²	96.9	32%	0.318	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.2	107.2	-175	29.3	-32.7	0	0	0	109.9	T33 I37 R52 I86	T33-P50 HydrophobicContact CG2-CB 3.46Å; T33-P50 VanDerWaalsContact CG2-CB 3.46Å; T33-P50 HydrophobicContact CG2-CG 4.18Å; I37-P50 HydrophobicContact CD1-CB 3.98Å; I37-P50 VanDerWaalsContact CD1-CD 3.49Å; I37-P50 HydrophobicContact CD1-CG 3.54Å; P50-R52 PolarHBondContact O-N 2.96Å; P50-I86 HydrophobicContact CB-CG1 4.16Å
51	V	95.6	Very high	92.3	Very high	79 Å²	79	100.9 Å²	100.9	48%	0.479	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.5	115.3	173.2	-177.8	0	0	0	0	107.8	G49 M53 R84 V85	G49-V51 PolarHBondContact O-N 3.49Å; V51-M53 HydrophobicContact CG1-SD 4.33Å; V51-M53 PolarHBondContact O-N 2.66Å; V51-R84 WeakPolarHBondContact O-CA 3.45Å; V51-V85 HydrophobicContact CB-CB 4.49Å; V51-V85 PolarHBondContact N-O 3.23Å; V51-V85 PolarHBondContact O-N 3.05Å
52	R	95.8	Very high	92.4	Very high	159 Å²	159	97 Å²	97	60%	0.6	49%	0.492	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.9	103.7	173.8	-65.4	-162.6	169.4	118.7	0.1	108.9	E30 P50 R84	E30-R52 IonicContact OE1-NE 3.69Å; E30-R52 IonicContact OE1-NH2 3.92Å; E30-R52 IonicContact OE2-CZ 3.81Å; E30-R52 IonicContact OE2-NE 3.87Å; E30-R52 IonicContact OE2-NH2 2.87Å; E30-R52 PolarHBondContact OE2-NH2 2.99Å; P50-R52 PolarHBondContact O-N 2.96Å; R52-R84 VanDerWaalsContact CD-CZ 3.47Å; R52-R84 VanDerWaalsContact CG-CZ 3.44Å
53	M	95.5	Very high	92.5	Very high	79 Å²	79	95 Å²	95	39%	0.389	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	150.6	172.6	-67.2	-61.9	-72.3	0	0	110.1	V51 T55 K83 V85	V51-M53 HydrophobicContact CG1-SD 4.33Å; V51-M53 PolarHBondContact O-N 2.66Å; M53-T55 PolarHBondContact O-N 3.34Å; M53-K83 HydrophobicContact CB-CB 3.92Å; M53-K83 HydrophobicContact CB-CD 4.21Å; M53-K83 HydrophobicContact CB-CG 4.02Å; M53-K83 HydrophobicContact CG-CD 4.15Å; M53-K83 HydrophobicContact CG-CG 4.1Å; M53-K83 PolarHBondContact N-O 3.1Å; M53-K83 VanDerWaalsContact N-O 3.1Å; M53-V85 HydrophobicContact CG-CG2 3.84Å
54	P	96.8	Very high	92.6	Very high	107 Å²	107	97.3 Å²	97.3	70%	0.695	48%	0.484	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-52.1	134.7	174.2	-26.9	35	0	0	0	111.2	K56	P54-K56 PolarHBondContact O-N 3.43Å
55	T	95.8	Very high	92.7	Very high	54 Å²	54	91.9 Å²	91.9	33%	0.331	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	119.1	178.6	-61.2	0	0	0	0	108.6	M53 V57 R80 I81 H82	M53-T55 PolarHBondContact O-N 3.34Å; T55-V57 PolarHBondContact O-N 3.39Å; T55-R80 HydrophobicContact CG2-CB 3.88Å; T55-R80 HydrophobicContact CG2-CG 4.41Å; T55-I81 WeakPolarHBondContact CA-O 3.29Å; T55-I81 WeakPolarHBondContact CG2-O 3.42Å; T55-H82 VanDerWaalsContact CG2-CE1 3.46Å; T55-H82 WeakPolarHBondContact CG2-CE1 3.2Å; T55-H82 WeakPolarHBondContact CG2-ND1 3.21Å; T55-H82 PolarHBondContact OG1-ND1 3.26Å
56	K	95.2	Very high	92.7	Very high	150 Å²	150	96.8 Å²	96.8	65%	0.652	49%	0.49	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.4	125.4	174.1	-65.6	-173.7	177.4	-173.3	0	108.3	P54 I81	P54-K56 PolarHBondContact O-N 3.43Å; K56-I81 HydrophobicContact CB-CB 4.36Å; K56-I81 PolarHBondContact N-O 3.27Å; K56-I81 VanDerWaalsContact N-O 3.1Å; K56-I81 PolarHBondContact O-N 3.11Å
57	V	96.5	Very high	92.2	Very high	56 Å²	56	92.2 Å²	92.2	34%	0.339	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	107.7	178.4	-171.7	0	0	0	0	108.3	T55 R59 Q78 R80	T55-V57 PolarHBondContact O-N 3.39Å; V57-R59 HydrophobicContact CG1-CG 3.89Å; V57-Q78 HydrophobicContact CG1-CB 4.41Å; V57-R80 HydrophobicContact CG1-CG 4.39Å; V57-R80 HydrophobicContact CG2-CG 4.3Å
58	L	96	Very high	91.4	Very high	96 Å²	96	92 Å²	92	50%	0.503	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.8	128.9	168.2	-54.8	-178.5	0	0	0	107.8	Q78 F79 I81	L58-Q78 WeakPolarHBondContact O-CA 3.39Å; L58-F79 HydrophobicContact CB-CB 4.24Å; L58-F79 HydrophobicContact CD1-CD1 4.03Å; L58-F79 PolarHBondContact N-O 3.1Å; L58-F79 PolarHBondContact O-N 2.94Å; L58-I81 HydrophobicContact CD1-CD1 4.02Å; L58-I81 HydrophobicContact CG-CD1 4.32Å
59	R	96.7	Very high	90.8	Very high	176 Å²	176	93.3 Å²	93.3	66%	0.664	50%	0.501	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.1	127.1	-179.5	-62.6	-176.1	173.2	167.8	-1.4	108.6	V57 F77 Q78	V57-R59 HydrophobicContact CG1-CG 3.89Å; R59-F77 WeakPolarHBondContact CA-O 3.34Å; R59-Q78 HydrophobicContact CG-CG 4.35Å
60	I	95.9	Very high	90.4	Very high	111 Å²	111	94 Å²	94	57%	0.569	51%	0.507	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118.7	121.9	169.5	-61.7	175.7	0	0	0	106.2	T62 F77	I60-T62 HydrophobicContact CG2-CG2 4.06Å; I60-F77 HydrophobicContact CB-CB 4.43Å; I60-F77 PolarHBondContact N-O 3.2Å; I60-F77 PolarHBondContact O-N 3.29Å
61	T	94.3	Very high	89.9	Confident	85 Å²	85	95.2 Å²	95.2	52%	0.521	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	118.7	177.2	56.3	0	0	0	0	109.3	D75 R76	T61-D75 VanDerWaalsContact CA-O 3.24Å; T61-D75 WeakPolarHBondContact CA-O 3.5Å; T61-R76 HydrophobicContact CG2-CB 4.43Å; T61-R76 HydrophobicContact CG2-CG 4.05Å
62	T	91.3	Very high	89.3	Confident	58 Å²	58	100.6 Å²	100.6	36%	0.356	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	158.9	179.7	51.6	0	0	0	0	110.4	I60 W74 D75	I60-T62 HydrophobicContact CG2-CG2 4.06Å; T62-W74 CarbonylContact O-C 3.55Å; T62-W74 WeakPolarHBondContact O-CA 3.45Å; T62-D75 PolarHBondContact N-O 3.14Å; T62-D75 PolarHBondContact O-N 3.35Å
63	R	90.4	Very high	89.1	Confident	81 Å²	81	95.4 Å²	95.4	31%	0.306	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.1	142.7	166.6	-68.4	-70.2	-65.5	-88.4	-3.5	108.7	G68 W74	R63-G68 PolarHBondContact NH1-O 3.49Å; R63-G68 PolarHBondContact NH2-O 3.37Å; R63-W74 VanDerWaalsContact CD-CZ2 3.47Å; R63-W74 HydrophobicContact CG-CE3 4.14Å; R63-W74 HydrophobicContact CG-CH2 4Å; R63-W74 HydrophobicContact CG-CZ2 4.41Å; R63-W74 HydrophobicContact CG-CZ3 3.85Å
64	K	90.2	Very high	88.9	Confident	122 Å²	122	98.1 Å²	98.1	53%	0.53	53%	0.527	S	S	.	.	S	Bend	trans	-70.2	-39.9	171.3	-66.8	-166.6	171.4	-177.8	0	111.8	T73 D75	K64-T73 PolarHBondContact N-O 2.76Å; K64-D75 WeakPolarHBondContact CE-OD1 3.44Å; K64-D75 WeakPolarHBondContact CG-OD2 3.5Å; K64-D75 IonicContact NZ-OD1 3.24Å
65	T	87.1	Confident	88.7	Confident	33 Å²	33	95.5 Å²	95.5	20%	0.202	51%	0.507	C	S	.	.	S	Bend	trans	-79.9	135.4	-176.6	47.7	0	0	0	0	111.5
66	P	85.7	Confident	88.7	Confident	135 Å²	135	102.2 Å²	102.2	88%	0.877	53%	0.526	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.8	-36.6	-178.1	27.8	-34.6	0	0	0	113.3
67	C	78.3	Confident	88.8	Confident	95 Å²	95	100.8 Å²	100.8	64%	0.642	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.3	10	-169.1	52.4	0	0	0	0	115.4	E69	C67-E69 PolarHBondContact O-N 2.82Å
68	G	74.6	Confident	88.8	Confident	37 Å²	37	102.7 Å²	102.7	38%	0.381	53%	0.525	S	S	.	.	S	Bend	trans	69.3	-30	-178.9	0	0	0	0	0	115.2	R63	R63-G68 PolarHBondContact NH1-O 3.49Å; R63-G68 PolarHBondContact NH2-O 3.37Å
69	E	78.9	Confident	88.8	Confident	155 Å²	155	103.2 Å²	103.2	72%	0.724	52%	0.524	S	S	*	.			trans	-77.8	136.3	171.1	-65.3	-56.2	144.5	0	0	111.1	C67	C67-E69 PolarHBondContact O-N 2.82Å
70	G	75.3	Confident	88.8	Confident	56 Å²	56	101.2 Å²	101.2	58%	0.577	52%	0.516	S	S	*	.	S	Bend	trans	123.4	-169.5	-176.9	0	0	0	0	0	114.3
71	S	82.1	Confident	88.8	Confident	76 Å²	76	98.3 Å²	98.3	53%	0.531	50%	0.501	S	S	.	.			trans	-58.9	143.2	-177.2	66.4	0	0	0	0	111.8	T73	S71-T73 PolarHBondContact O-N 2.86Å; S71-T73 PolarHBondContact O-OG1 2.86Å; S71-T73 VanDerWaalsContact OG-CG2 3.3Å; S71-T73 WeakPolarHBondContact OG-CG2 3.33Å; S71-T73 PolarHBondContact OG-OG1 3.18Å
72	K	83.4	Confident	88.9	Confident	191 Å²	191	95.2 Å²	95.2	83%	0.83	48%	0.481	S	S	*	.			trans	-71	54.1	178.4	-64	-180	-178.8	176.9	0	111.9
73	T	90.6	Very high	89.1	Confident	51 Å²	51	96 Å²	96	31%	0.313	48%	0.479	S	S	.	.			trans	-98.2	137.6	-179.4	55	0	0	0	0	110.8	K64 S71	K64-T73 PolarHBondContact N-O 2.76Å; S71-T73 PolarHBondContact O-N 2.86Å; S71-T73 PolarHBondContact O-OG1 2.86Å; S71-T73 VanDerWaalsContact OG-CG2 3.3Å; S71-T73 WeakPolarHBondContact OG-CG2 3.33Å; S71-T73 PolarHBondContact OG-OG1 3.18Å
74	W	91.8	Very high	89.3	Confident	135 Å²	135	93 Å²	93	51%	0.511	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	137.1	-173.8	-63.7	84.2	0	0	0	110	T62 R63	T62-W74 CarbonylContact O-C 3.55Å; T62-W74 WeakPolarHBondContact O-CA 3.45Å; R63-W74 VanDerWaalsContact CD-CZ2 3.47Å; R63-W74 HydrophobicContact CG-CE3 4.14Å; R63-W74 HydrophobicContact CG-CH2 4Å; R63-W74 HydrophobicContact CG-CZ2 4.41Å; R63-W74 HydrophobicContact CG-CZ3 3.85Å
75	D	93.4	Very high	89.5	Confident	52 Å²	52	87.9 Å²	87.9	28%	0.278	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.5	138.6	164.2	-76.1	-37.2	0	0	0	109.8	T61 T62 K64 F77	T61-D75 VanDerWaalsContact CA-O 3.24Å; T61-D75 WeakPolarHBondContact CA-O 3.5Å; T62-D75 PolarHBondContact N-O 3.14Å; T62-D75 PolarHBondContact O-N 3.35Å; K64-D75 WeakPolarHBondContact CE-OD1 3.44Å; K64-D75 WeakPolarHBondContact CG-OD2 3.5Å; K64-D75 IonicContact NZ-OD1 3.24Å; D75-F77 HydrophobicContact CB-CD2 4.17Å; D75-F77 HydrophobicContact CB-CE2 3.51Å; D75-F77 HydrophobicContact CB-CZ 3.82Å
76	R	95.5	Very high	89.8	Confident	196 Å²	196	86.3 Å²	86.3	74%	0.74	44%	0.437	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.4	83.9	-178.8	-62.4	-175.6	175.5	175.2	-1.2	109.2	T61	T61-R76 HydrophobicContact CG2-CB 4.43Å; T61-R76 HydrophobicContact CG2-CG 4.05Å
77	F	96.7	Very high	90.1	Very high	120 Å²	120	81.2 Å²	81.2	53%	0.526	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.9	136.7	176.1	-59.4	-73.5	0	0	0	110.4	R59 I60 D75	R59-F77 WeakPolarHBondContact CA-O 3.34Å; I60-F77 HydrophobicContact CB-CB 4.43Å; I60-F77 PolarHBondContact N-O 3.2Å; I60-F77 PolarHBondContact O-N 3.29Å; D75-F77 HydrophobicContact CB-CD2 4.17Å; D75-F77 HydrophobicContact CB-CE2 3.51Å; D75-F77 HydrophobicContact CB-CZ 3.82Å
78	Q	96.1	Very high	90.6	Very high	95 Å²	95	76.7 Å²	76.7	44%	0.444	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	133.9	176.9	-62	-170.7	1.5	0	0	110.4	V57 L58 R59	V57-Q78 HydrophobicContact CG1-CB 4.41Å; L58-Q78 WeakPolarHBondContact O-CA 3.39Å; R59-Q78 HydrophobicContact CG-CG 4.35Å
79	F	96.2	Very high	91.3	Very high	108 Å²	108	76.5 Å²	76.5	47%	0.474	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	126.3	167	-174.3	-101.4	0	0	0	108.9	A24 L58 I81	A24-F79 HydrophobicContact CB-CE2 3.71Å; A24-F79 HydrophobicContact CB-CZ 3.74Å; L58-F79 HydrophobicContact CB-CB 4.24Å; L58-F79 HydrophobicContact CD1-CD1 4.03Å; L58-F79 PolarHBondContact N-O 3.1Å; L58-F79 PolarHBondContact O-N 2.94Å; F79-I81 HydrophobicContact CD1-CD1 4.28Å; F79-I81 HydrophobicContact CD1-CG1 3.77Å; F79-I81 HydrophobicContact CE1-CD1 4.13Å; F79-I81 HydrophobicContact CE1-CG1 3.53Å
80	R	96	Very high	91.5	Very high	133 Å²	133	69.2 Å²	69.2	50%	0.502	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	126.8	-177.6	-65.3	-176.4	-176.7	-174.9	2	108.9	A24 T55 V57	A24-R80 WeakPolarHBondContact CA-O 3.41Å; T55-R80 HydrophobicContact CG2-CB 3.88Å; T55-R80 HydrophobicContact CG2-CG 4.41Å; V57-R80 HydrophobicContact CG1-CG 4.39Å; V57-R80 HydrophobicContact CG2-CG 4.3Å
81	I	96.4	Very high	92	Very high	50 Å²	50	68.5 Å²	68.5	26%	0.256	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	109	174	-59.9	168.6	0	0	0	107.2	T55 K56 L58 F79	T55-I81 WeakPolarHBondContact CA-O 3.29Å; T55-I81 WeakPolarHBondContact CG2-O 3.42Å; K56-I81 HydrophobicContact CB-CB 4.36Å; K56-I81 PolarHBondContact N-O 3.27Å; K56-I81 VanDerWaalsContact N-O 3.1Å; K56-I81 PolarHBondContact O-N 3.11Å; L58-I81 HydrophobicContact CD1-CD1 4.02Å; L58-I81 HydrophobicContact CG-CD1 4.32Å; F79-I81 HydrophobicContact CD1-CD1 4.28Å; F79-I81 HydrophobicContact CD1-CG1 3.77Å; F79-I81 HydrophobicContact CE1-CD1 4.13Å; F79-I81 HydrophobicContact CE1-CG1 3.53Å
82	H	96.3	Very high	91.9	Very high	21 Å²	21	69.2 Å²	69.2	10%	0.097	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.7	124.3	173.7	-59.6	-71.3	0	0	0	108.7	T22 A23 A24 V26 L29 T55	T22-H82 WeakPolarHBondContact CA-O 3.43Å; A23-H82 PolarHBondContact N-O 2.73Å; A23-H82 PolarHBondContact O-N 3.19Å; A24-H82 PolarHBondContact O-CD2 2.89Å; A24-H82 VanDerWaalsContact O-CD2 3.31Å; V26-H82 WeakPolarHBondContact CG2-NE2 3.38Å; L29-H82 HydrophobicContact CD2-CB 3.44Å; L29-H82 VanDerWaalsContact CD2-CB 3.44Å; T55-H82 VanDerWaalsContact CG2-CE1 3.46Å; T55-H82 WeakPolarHBondContact CG2-CE1 3.2Å; T55-H82 WeakPolarHBondContact CG2-ND1 3.21Å; T55-H82 PolarHBondContact OG1-ND1 3.26Å
83	K	95.6	Very high	91.8	Very high	74 Å²	74	67.2 Å²	67.2	32%	0.322	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	132.8	179.8	-178	177	-170.7	179.1	0	110	T20 L21 T22 M53 V85	T20-K83 HydrophobicContact CG2-CD 4.29Å; T20-K83 HydrophobicContact CG2-CG 4.19Å; L21-K83 CarbonylContact O-C 3.57Å; L21-K83 WeakPolarHBondContact O-CA 3.46Å; T22-K83 HydrophobicContact CG2-CB 4.11Å; T22-K83 HydrophobicContact CG2-CD 4.4Å; T22-K83 HydrophobicContact CG2-CG 3.94Å; M53-K83 HydrophobicContact CB-CB 3.92Å; M53-K83 HydrophobicContact CB-CD 4.21Å; M53-K83 HydrophobicContact CB-CG 4.02Å; M53-K83 HydrophobicContact CG-CD 4.15Å; M53-K83 HydrophobicContact CG-CG 4.1Å; M53-K83 PolarHBondContact N-O 3.1Å; M53-K83 VanDerWaalsContact N-O 3.1Å; K83-V85 HydrophobicContact CG-CG2 4.44Å
84	R	95.1	Very high	91.3	Very high	19 Å²	19	65.3 Å²	65.3	7%	0.072	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	142.2	171.3	-55.5	-63.2	-179.7	-133.2	8.6	108.4	L21 L29 E30 V51 R52	L21-R84 HydrophobicContact CB-CB 4.27Å; L21-R84 PolarHBondContact N-O 2.83Å; L21-R84 PolarHBondContact O-N 3.35Å; L29-R84 HydrophobicContact CD1-CG 4.26Å; L29-R84 HydrophobicContact CD2-CG 3.88Å; L29-R84 HydrophobicContact CG-CG 3.94Å; E30-R84 IonicContact OE1-CZ 2.73Å; E30-R84 VanDerWaalsContact OE1-CZ 3.24Å; E30-R84 IonicContact OE1-NE 3.91Å; E30-R84 PolarHBondContact OE1-NE 3.24Å; E30-R84 IonicContact OE1-NH2 2.89Å; E30-R84 PolarHBondContact OE1-NH2 2.88Å; V51-R84 WeakPolarHBondContact O-CA 3.45Å; R52-R84 VanDerWaalsContact CD-CZ 3.47Å; R52-R84 VanDerWaalsContact CG-CZ 3.44Å
85	V	94.4	Very high	90.7	Very high	13 Å²	13	59 Å²	59	8%	0.079	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	131.6	177.5	-178.2	0	0	0	0	108.3	R18 V19 V51 M53 K83	R18-V85 HydrophobicContact CG-CG1 3.62Å; V19-V85 CarbonylContact O-C 3.53Å; V19-V85 WeakPolarHBondContact O-CA 3.38Å; V51-V85 HydrophobicContact CB-CB 4.49Å; V51-V85 PolarHBondContact N-O 3.23Å; V51-V85 PolarHBondContact O-N 3.05Å; M53-V85 HydrophobicContact CG-CG2 3.84Å; K83-V85 HydrophobicContact CG-CG2 4.44Å
86	I	92.8	Very high	90.1	Very high	1 Å²	1	61.2 Å²	61.2	1%	0.005	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.2	124.3	175.6	-65.8	167.3	0	0	0	106.8	V19 T33 L36 I37 V47 P50 L88	V19-I86 HydrophobicContact CB-CB 4.49Å; V19-I86 PolarHBondContact N-O 2.92Å; V19-I86 PolarHBondContact O-N 3.4Å; T33-I86 HydrophobicContact CG2-CD1 3.87Å; L36-I86 HydrophobicContact CB-CD1 4.36Å; L36-I86 HydrophobicContact CD2-CD1 3.73Å; L36-I86 HydrophobicContact CG-CD1 4.43Å; I37-I86 HydrophobicContact CD1-CD1 4.34Å; I37-I86 HydrophobicContact CG1-CD1 4Å; V47-I86 HydrophobicContact CG1-CG2 3.96Å; P50-I86 HydrophobicContact CB-CG1 4.16Å; I86-L88 HydrophobicContact CG2-CD2 3.84Å; I86-L88 HydrophobicContact CG2-CG 4.06Å
87	D	91.8	Very high	89.4	Confident	27 Å²	27	56.6 Å²	56.6	14%	0.144	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	129	174.5	-64.6	-23.9	0	0	0	109	V17 R18 K48	V17-D87 CarbonylContact O-C 3.57Å; V17-D87 WeakPolarHBondContact O-CA 3.45Å; R18-D87 WeakPolarHBondContact CB-OD1 3.18Å; R18-D87 VanDerWaalsContact CG-OD1 3.31Å; R18-D87 WeakPolarHBondContact CG-OD1 3.22Å; R18-D87 IonicContact CZ-OD1 3.53Å; R18-D87 IonicContact CZ-OD2 3.72Å; R18-D87 IonicContact NE-OD1 2.74Å; R18-D87 PolarHBondContact NE-OD1 3.03Å; R18-D87 IonicContact NE-OD2 3.69Å; R18-D87 IonicContact NH2-OD1 3.44Å; R18-D87 PolarHBondContact NH2-OD1 3.25Å; R18-D87 IonicContact NH2-OD2 2.87Å; R18-D87 PolarHBondContact NH2-OD2 3.48Å; K48-D87 HydrophobicContact CB-CB 4.08Å; K48-D87 HydrophobicContact CD-CB 4.22Å; K48-D87 PolarHBondContact N-O 3.3Å
88	L	90.5	Very high	88.5	Confident	1 Å²	1	51.6 Å²	51.6	1%	0.005	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	143.8	-178.8	-58.7	175.1	0	0	0	109.2	W16 V17 V19 A40 V47 I86 L98	W16-L88 CarbonylContact C-O 3.58Å; W16-L88 WeakPolarHBondContact CA-O 3.44Å; V17-L88 PolarHBondContact N-O 2.98Å; V17-L88 PolarHBondContact O-N 3.35Å; V19-L88 HydrophobicContact CG2-CD1 4.22Å; A40-L88 HydrophobicContact CB-CD2 3.95Å; V47-L88 HydrophobicContact CB-CD2 3.97Å; V47-L88 HydrophobicContact CG1-CD2 3.75Å; V47-L88 HydrophobicContact CG2-CD2 3.58Å; I86-L88 HydrophobicContact CG2-CD2 3.84Å; I86-L88 HydrophobicContact CG2-CG 4.06Å; L88-L98 HydrophobicContact CD1-CD1 3.56Å
89	L	88.9	Confident	87.5	Confident	32 Å²	32	52.5 Å²	52.5	17%	0.168	25%	0.246	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-100	104.3	161.7	-176.3	71.4	0	0	0	107.4	R14 W16 R46	R14-L89 HydrophobicContact CB-CD1 4.02Å; R14-L89 HydrophobicContact CB-CG 4.11Å; W16-L89 HydrophobicContact CG-CD1 4.29Å; R46-L89 HydrophobicContact CB-CB 4.18Å; R46-L89 PolarHBondContact O-N 2.92Å
90	S	83.5	Confident	86.3	Confident	2 Å²	2	55.2 Å²	55.2	1%	0.014	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	156.9	-169.6	-167.9	0	0	0	0	111.8	N15 A94 T95	N15-S90 PolarHBondContact N-O 3.41Å; N15-S90 PolarHBondContact O-N 3.04Å; S90-A94 VanDerWaalsContact OG-CB 3.27Å; S90-A94 WeakPolarHBondContact OG-CB 3.34Å; S90-T95 PolarHBondContact OG-OG1 3.02Å
91	T	84.2	Confident	84.8	Confident	41 Å²	41	51.7 Å²	51.7	25%	0.252	25%	0.251	S	S	.	.			trans	-77.9	161.6	162.9	56.2	0	0	0	0	109.6	E93 A94 T95	T91-E93 PolarHBondContact O-N 3.31Å; T91-A94 PolarHBondContact O-N 3.37Å; T91-T95 PolarHBondContact O-N 2.91Å; T91-T95 VanDerWaalsContact O-N 3.08Å; T91-T95 PolarHBondContact O-OG1 3.49Å
92	D	80.5	Confident	83.2	Confident	91 Å²	91	51.7 Å²	51.7	49%	0.487	25%	0.248	S	C	.	.	H	α-helix	trans	-61.9	-42.6	-179.8	-171.7	45.8	0	0	0	112.1	A94 T95 Q96	D92-A94 PolarHBondContact O-N 2.84Å; D92-T95 WeakPolarHBondContact O-CA 3.45Å; D92-T95 VanDerWaalsContact O-CB 3.27Å; D92-T95 WeakPolarHBondContact O-CB 3.32Å; D92-T95 PolarHBondContact O-N 2.83Å; D92-Q96 PolarHBondContact O-N 3.26Å; D92-Q96 PolarHBondContact OD2-NE2 3.42Å; D92-Q96 VanDerWaalsContact OD2-NE2 3.07Å
93	E	82.2	Confident	82	Confident	149 Å²	149	59 Å²	59	70%	0.696	29%	0.287	S	S	*	.	H	α-helix	trans	-57.2	-47.7	177	-63	179.2	176	0	0	112.8	T91 T95 Q96 Q97	T91-E93 PolarHBondContact O-N 3.31Å; E93-T95 PolarHBondContact O-N 2.86Å; E93-Q96 PolarHBondContact O-N 2.81Å; E93-Q97 WeakPolarHBondContact O-CG 3.46Å; E93-Q97 PolarHBondContact O-N 3.47Å
94	A	80.4	Confident	81.3	Confident	11 Å²	11	59 Å²	59	9%	0.091	29%	0.288	C	S	.	.	H	α-helix	trans	-66.7	-29.9	177.6	0	0	0	0	0	111.7	L45 S90 T91 D92 Q97 L98	L45-A94 HydrophobicContact CD1-CB 4.45Å; L45-A94 HydrophobicContact CD2-CB 4.48Å; S90-A94 VanDerWaalsContact OG-CB 3.27Å; S90-A94 WeakPolarHBondContact OG-CB 3.34Å; T91-A94 PolarHBondContact O-N 3.37Å; D92-A94 PolarHBondContact O-N 2.84Å; A94-Q97 PolarHBondContact O-N 3.02Å; A94-L98 WeakPolarHBondContact O-CD1 3.38Å; A94-L98 VanDerWaalsContact O-CG 3.29Å; A94-L98 WeakPolarHBondContact O-CG 3.41Å; A94-L98 PolarHBondContact O-N 2.89Å; A94-L98 VanDerWaalsContact O-N 3.1Å
95	T	78.8	Confident	80.9	Confident	2 Å²	2	63.3 Å²	63.3	1%	0.012	32%	0.318	C	S	.	.	H	α-helix	trans	-66.5	-40.3	175.8	-54.8	0	0	0	0	111.8	V17 S90 T91 D92 E93 L98 K99 V111	V17-T95 HydrophobicContact CG1-CG2 3.84Å; V17-T95 HydrophobicContact CG2-CG2 4.07Å; S90-T95 PolarHBondContact OG-OG1 3.02Å; T91-T95 PolarHBondContact O-N 2.91Å; T91-T95 VanDerWaalsContact O-N 3.08Å; T91-T95 PolarHBondContact O-OG1 3.49Å; D92-T95 WeakPolarHBondContact O-CA 3.45Å; D92-T95 VanDerWaalsContact O-CB 3.27Å; D92-T95 WeakPolarHBondContact O-CB 3.32Å; D92-T95 PolarHBondContact O-N 2.83Å; E93-T95 PolarHBondContact O-N 2.86Å; T95-L98 PolarHBondContact O-N 2.99Å; T95-K99 PolarHBondContact O-N 2.85Å; T95-V111 HydrophobicContact CG2-CG1 4Å
96	Q	80.9	Confident	80.6	Confident	99 Å²	99	65.6 Å²	65.6	46%	0.463	35%	0.345	S	S	.	.	H	α-helix	trans	-65.1	-43.5	175.9	-63.9	176.8	21.5	0	0	111.2	D92 E93 L98 K99 H100	D92-Q96 PolarHBondContact O-N 3.26Å; D92-Q96 PolarHBondContact OD2-NE2 3.42Å; D92-Q96 VanDerWaalsContact OD2-NE2 3.07Å; E93-Q96 PolarHBondContact O-N 2.81Å; Q96-L98 VanDerWaalsContact C-N 3.3Å; Q96-L98 PolarHBondContact O-N 2.82Å; Q96-K99 WeakPolarHBondContact O-CB 3.46Å; Q96-K99 PolarHBondContact O-N 3.05Å; Q96-H100 PolarHBondContact O-CD2 3.24Å
97	Q	80.9	Confident	80.6	Confident	100 Å²	100	66.2 Å²	66.2	47%	0.467	35%	0.348	S	S	.	.	H	α-helix	trans	-58	-41.8	175.6	-68	176.6	4.4	0	0	112.1	E93 A94 K99 H100 I101	E93-Q97 WeakPolarHBondContact O-CG 3.46Å; E93-Q97 PolarHBondContact O-N 3.47Å; A94-Q97 PolarHBondContact O-N 3.02Å; Q97-K99 VanDerWaalsContact C-N 3.31Å; Q97-K99 PolarHBondContact O-N 3.2Å; Q97-H100 PolarHBondContact O-N 3.24Å; Q97-I101 WeakPolarHBondContact O-CD1 3.36Å; Q97-I101 WeakPolarHBondContact O-CG1 3.42Å
98	L	78.1	Confident	80.5	Confident	14 Å²	14	70.2 Å²	70.2	7%	0.073	37%	0.37	C	S	.	.	H	α-helix	trans	-64.2	-32.1	179.6	-72.2	162.2	0	0	0	113.3	L36 L45 L88 A94 T95 Q96	L36-L98 HydrophobicContact CD1-CB 4.5Å; L36-L98 HydrophobicContact CD1-CD2 3.65Å; L45-L98 HydrophobicContact CD1-CD1 4.06Å; L88-L98 HydrophobicContact CD1-CD1 3.56Å; A94-L98 WeakPolarHBondContact O-CD1 3.38Å; A94-L98 VanDerWaalsContact O-CG 3.29Å; A94-L98 WeakPolarHBondContact O-CG 3.41Å; A94-L98 PolarHBondContact O-N 2.89Å; A94-L98 VanDerWaalsContact O-N 3.1Å; T95-L98 PolarHBondContact O-N 2.99Å; Q96-L98 VanDerWaalsContact C-N 3.3Å; Q96-L98 PolarHBondContact O-N 2.82Å
99	K	74.8	Confident	80.5	Confident	114 Å²	114	73 Å²	73	50%	0.496	39%	0.389	S	S	.	.	H	α-helix	trans	-65.5	-39.6	179.4	-72.9	174.1	179.4	177.9	0	112.7	T95 Q96 Q97 I101 V111	T95-K99 PolarHBondContact O-N 2.85Å; Q96-K99 WeakPolarHBondContact O-CB 3.46Å; Q96-K99 PolarHBondContact O-N 3.05Å; Q97-K99 VanDerWaalsContact C-N 3.31Å; Q97-K99 PolarHBondContact O-N 3.2Å; K99-I101 PolarHBondContact O-N 3.35Å; K99-V111 HydrophobicContact CG-CB 4.35Å; K99-V111 HydrophobicContact CG-CG2 3.96Å
100	H	69.5	Low	80.5	Confident	165 Å²	165	75.2 Å²	75.2	76%	0.764	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.4	-13.2	-172.2	-72.1	-66.2	0	0	0	114.4	Q96 Q97	Q96-H100 PolarHBondContact O-CD2 3.24Å; Q97-H100 PolarHBondContact O-N 3.24Å
101	I	64.5	Low	80.8	Confident	59 Å²	59	76.8 Å²	76.8	30%	0.303	41%	0.41	S	S	.	.	T	Hydrogen-bonded Turn	trans	-87.8	-19.3	-159.6	-72.1	171.7	0	0	0	114	K39 Q97 K99	K39-I101 HydrophobicContact CD-CD1 3.91Å; K39-I101 HydrophobicContact CD-CG2 3.77Å; Q97-I101 WeakPolarHBondContact O-CD1 3.36Å; Q97-I101 WeakPolarHBondContact O-CG1 3.42Å; K99-I101 PolarHBondContact O-N 3.35Å
102	Y	64.5	Low	81	Confident	51 Å²	51	79.3 Å²	79.3	20%	0.2	42%	0.418	C	S	.	.			trans	-129.8	100.4	-168.1	-64.5	-73.6	0	0	0	113.5	V32 G35 L36 K39	V32-Y102 HydrophobicContact CG1-CD1 4.01Å; V32-Y102 HydrophobicContact CG1-CG 3.9Å; V32-Y102 HydrophobicContact CG2-CD1 4.42Å; G35-Y102 WeakPolarHBondContact CA-OH 3.35Å; G35-Y102 PolarHBondContact O-OH 3.49Å; L36-Y102 HydrophobicContact CB-CE2 4.11Å; L36-Y102 HydrophobicContact CD1-CD2 4.04Å; L36-Y102 HydrophobicContact CD1-CE2 3.67Å; L36-Y102 PolarHBondContact N-OH 2.8Å; K39-Y102 HydrophobicContact CD-CE2 4.44Å; K39-Y102 WeakPolarHBondContact CD-OH 3.42Å; K39-Y102 WeakPolarHBondContact CE-OH 3.35Å
103	L	69.3	Low	81.3	Confident	173 Å²	173	76.3 Å²	76.3	91%	0.906	40%	0.403	S	S	*	.			trans	-116.9	58.7	166.3	-168.3	73.6	0	0	0	109.5
104	E	82	Confident	81.2	Confident	75 Å²	75	71.9 Å²	71.9	35%	0.35	39%	0.391	S	S	.	.			trans	-72.2	128.7	167.2	-173.3	73.3	-177.4	0	0	107.8	P28 V32 G106 V107	P28-E104 HydrophobicContact CB-CG 3.58Å; V32-E104 HydrophobicContact CG2-CB 3.5Å; V32-E104 VanDerWaalsContact CG2-CB 3.5Å; V32-E104 HydrophobicContact CG2-CG 4.13Å; E104-G106 PolarHBondContact O-N 3.49Å; E104-V107 HydrophobicContact CB-CB 4.47Å; E104-V107 HydrophobicContact CB-CG2 4.14Å; E104-V107 HydrophobicContact CG-CG2 4.19Å; E104-V107 PolarHBondContact O-N 3.34Å
105	P	86.1	Confident	80.6	Confident	109 Å²	109	74.9 Å²	74.9	71%	0.708	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.1	128.4	-177.3	24.1	-33.8	0	0	0	110.8
106	G	88.6	Confident	79.8	Confident	62 Å²	62	80.2 Å²	80.2	64%	0.639	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	83.8	7.5	177.6	0	0	0	0	0	115.8	E104	E104-G106 PolarHBondContact O-N 3.49Å
107	V	91.6	Very high	77.9	Confident	13 Å²	13	86.4 Å²	86.4	8%	0.079	49%	0.487	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	119	168.5	-175.2	0	0	0	0	109.2	A23 P28 L29 V32 E104	A23-V107 HydrophobicContact CB-CB 4.49Å; A23-V107 HydrophobicContact CB-CG2 4.06Å; P28-V107 HydrophobicContact CB-CG2 3.91Å; P28-V107 HydrophobicContact CG-CG2 4.38Å; L29-V107 HydrophobicContact CD1-CG1 4Å; V32-V107 HydrophobicContact CG1-CG1 4.44Å; V32-V107 HydrophobicContact CG2-CB 4.5Å; V32-V107 HydrophobicContact CG2-CG1 4.43Å; V32-V107 HydrophobicContact CG2-CG2 4.25Å; E104-V107 HydrophobicContact CB-CB 4.47Å; E104-V107 HydrophobicContact CB-CG2 4.14Å; E104-V107 HydrophobicContact CG-CG2 4.19Å; E104-V107 PolarHBondContact O-N 3.34Å
108	N	91.1	Very high	77.7	Confident	111 Å²	111	85.8 Å²	85.8	59%	0.594	49%	0.488	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.4	128.7	174.4	-70.1	-16.8	0	0	0	109.9	L21 T22	L21-N108 WeakPolarHBondContact CA-O 3.37Å; T22-N108 PolarHBondContact N-O 3.03Å; T22-N108 PolarHBondContact O-N 2.75Å; T22-N108 WeakPolarHBondContact OG1-CB 3.24Å; T22-N108 PolarHBondContact OG1-O 2.73Å
109	C	89.9	Confident	77.7	Confident	61 Å²	61	89.5 Å²	89.5	41%	0.412	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	121.3	-179.9	-59.1	0	0	0	0	109.9	L21	L21-C109 HydrophobicContact CD2-CB 4Å; L21-C109 WeakPolarHBondContact CD2-SG 3.3Å
110	D	89.9	Confident	77.9	Confident	78 Å²	78	88.2 Å²	88.2	42%	0.417	51%	0.511	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	133.8	172.6	179.2	48.5	0	0	0	109.2	V19 T20 K112	V19-D110 CarbonylContact C-O 3.56Å; V19-D110 WeakPolarHBondContact CA-O 2.93Å; T20-D110 PolarHBondContact N-O 2.77Å; T20-D110 PolarHBondContact O-N 3.1Å; D110-K112 WeakPolarHBondContact OD2-CE 3.49Å
111	V	89.3	Confident	78.4	Confident	35 Å²	35	83.6 Å²	83.6	21%	0.212	50%	0.496	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	116.8	-177	-178.6	0	0	0	0	108.6	V17 V19 T95 K99	V17-V111 HydrophobicContact CG1-CG1 3.48Å; V17-V111 VanDerWaalsContact CG1-CG1 3.48Å; V19-V111 HydrophobicContact CG1-CG2 4.3Å; V19-V111 HydrophobicContact CG2-CG1 4.45Å; V19-V111 HydrophobicContact CG2-CG2 4.24Å; T95-V111 HydrophobicContact CG2-CG1 4Å; K99-V111 HydrophobicContact CG-CB 4.35Å; K99-V111 HydrophobicContact CG-CG2 3.96Å
112	K	88.7	Confident	79.2	Confident	94 Å²	94	85.2 Å²	85.2	41%	0.409	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	130.9	179	-63.9	-165.8	169	-149.1	0	110.8	V17 R18 D110	V17-K112 CarbonylContact C-O 3.57Å; V17-K112 WeakPolarHBondContact CA-O 3.43Å; R18-K112 PolarHBondContact N-O 2.79Å; R18-K112 PolarHBondContact O-N 2.78Å; D110-K112 WeakPolarHBondContact OD2-CE 3.49Å
113	V	86.9	Confident	80.2	Confident	27 Å²	27	87.5 Å²	87.5	16%	0.164	53%	0.529	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.1	142.6	172.6	-174.5	0	0	0	0	108.6	N15 V17 G115 D116	N15-V113 HydrophobicContact CB-CG1 3.83Å; V17-V113 HydrophobicContact CG2-CG1 4.49Å; V17-V113 HydrophobicContact CG2-CG2 4.25Å; V113-G115 PolarHBondContact O-N 2.74Å; V113-D116 PolarHBondContact O-N 3.37Å; V113-D116 VanDerWaalsContact O-N 3.1Å
114	A	79.2	Confident	81	Confident	56 Å²	56	81.4 Å²	81.4	46%	0.463	50%	0.502	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.7	110.6	174.3	0	0	0	0	0	109.4	W16	W16-A114 HydrophobicContact CB-CB 4.03Å; W16-A114 VanDerWaalsContact O-CB 3.29Å; W16-A114 WeakPolarHBondContact O-CB 3.31Å; W16-A114 PolarHBondContact O-N 2.74Å
115	G	68.2	Low	80.9	Confident	75 Å²	75	81.8 Å²	81.8	77%	0.773	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	135.8	-30.4	-172.4	0	0	0	0	0	112.4	V113	V113-G115 PolarHBondContact O-N 2.74Å
116	D	61.8	Low	80.5	Confident	114 Å²	114	79.6 Å²	79.6	61%	0.61	50%	0.497	S	S	*	.			trans	-85.5	115.1	176.8	-60.5	-34.2	0	0	0	110	V113	V113-D116 PolarHBondContact O-N 3.37Å; V113-D116 VanDerWaalsContact O-N 3.1Å
117	L	40.6	Very low	79.8	Confident	229 Å²	229	81.2 Å²	81.2	100%	1.199	49%	0.485	S	S	*	.			trans	-76.5	0	170.6	-96.4	154.6	0	0	0	110.8

Retrieved 117 of 117 residues in 91.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).