A0A5K4EC89_SCHMA Loading...

Cytochrome c-like protein; Putative cytochrome c

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.

AlphaFold DB (A0A3Q0KE61), UniProt , Accession A0A5K4EC89, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 73 aa.

						>A0A5K4EC89_SCHMA|A0A5K4EC89
MGFSEGDIEKGKKLFVQRCSQCHTVEKGGPHKVGPNLSGLFGRKTGQAPGYTYTAANISKVLILSLLLRYHME
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.6	Very low	83.9	Confident	231 Å²	231	112.8 Å²	112.8	100%	1.138	64%	0.639	S	S	*	*				0	114.1	0	-89.3	64.7	117.9	0	0	108.7
2	G	70.2	Confident	84.9	Confident	72 Å²	72	114.3 Å²	114.3	74%	0.742	63%	0.633	S	S	*	*	P	Polyproline II helix	trans	-85.2	148.8	167.6	0	0	0	0	0	110.1
3	F	76	Confident	85.8	Confident	166 Å²	166	116.2 Å²	116.2	73%	0.728	63%	0.631	S	S	*	*	P	Polyproline II helix	trans	-83.8	134.1	167.1	-65.5	-84.9	0	0	0	108.1
4	S	85.5	Confident	86.6	Confident	107 Å²	107	113.3 Å²	113.3	75%	0.748	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-75.9	163.8	169.2	61.4	0	0	0	0	110.4
5	E	86.6	Confident	87.2	Confident	127 Å²	127	109.2 Å²	109.2	59%	0.593	59%	0.588	S	S	*	*	P	Polyproline II helix	trans	-59.4	141.5	172	-159.9	168	142.7	0	0	111.2
6	G	87.8	Confident	87.8	Confident	53 Å²	53	107.7 Å²	107.7	55%	0.546	58%	0.584	S	S	.	*			trans	-106.2	157.7	-177.4	0	0	0	0	0	112.3	I8	G6-I8 PolarHBondContact O-N 2.81Å
7	D	93.6	Very high	88.3	Confident	77 Å²	77	109.2 Å²	109.2	41%	0.412	59%	0.586	S	S	.	*			trans	-76.5	113.1	173	178.7	-33.9	0	0	0	110.1	E9 K10 G11	D7-E9 PolarHBondContact O-N 2.94Å; D7-E9 PolarHBondContact OD1-N 3.38Å; D7-E9 VanDerWaalsContact OD1-N 3.09Å; D7-K10 HydrophobicContact CB-CB 4.02Å; D7-K10 HydrophobicContact CB-CD 4.01Å; D7-K10 HydrophobicContact CB-CG 4.2Å; D7-K10 PolarHBondContact O-N 3.09Å; D7-K10 PolarHBondContact OD1-N 2.91Å; D7-K10 WeakPolarHBondContact OD2-CD 3.4Å; D7-K10 WeakPolarHBondContact OD2-CE 3.33Å; D7-K10 WeakPolarHBondContact OD2-CG 3.2Å; D7-K10 IonicContact OD2-NZ 2.81Å; D7-K10 PolarHBondContact OD2-NZ 3.1Å; D7-G11 PolarHBondContact O-N 3.44Å
8	I	92.5	Very high	88.8	Confident	133 Å²	133	114 Å²	114	68%	0.682	60%	0.595	S	S	*	*	H	α-helix	trans	-61.8	-41.7	-174.9	-64.4	176.2	0	0	0	111.6	G6 G11 K12	G6-I8 PolarHBondContact O-N 2.81Å; I8-G11 PolarHBondContact O-N 2.84Å; I8-K12 WeakPolarHBondContact O-CB 3.13Å; I8-K12 PolarHBondContact O-N 3.45Å
9	E	94.5	Very high	89.2	Confident	109 Å²	109	110.3 Å²	110.3	51%	0.509	58%	0.579	S	S	.	*	H	α-helix	trans	-70.3	-39.3	-177.8	-77.4	-60.3	117	0	0	111.5	D7 K12 K13	D7-E9 PolarHBondContact O-N 2.94Å; D7-E9 PolarHBondContact OD1-N 3.38Å; D7-E9 VanDerWaalsContact OD1-N 3.09Å; E9-K12 PolarHBondContact O-N 3.37Å; E9-K13 WeakPolarHBondContact O-CG 3.43Å; E9-K13 PolarHBondContact O-N 3.25Å; E9-K13 VanDerWaalsContact O-N 3.1Å
10	K	94.9	Very high	89.6	Confident	131 Å²	131	106.5 Å²	106.5	57%	0.57	56%	0.562	S	S	*	*	H	α-helix	trans	-65.2	-41.5	170.2	-71	178.8	-169.1	133.9	0	111.4	D7 K12 K13 L14	D7-K10 HydrophobicContact CB-CB 4.02Å; D7-K10 HydrophobicContact CB-CD 4.01Å; D7-K10 HydrophobicContact CB-CG 4.2Å; D7-K10 PolarHBondContact O-N 3.09Å; D7-K10 PolarHBondContact OD1-N 2.91Å; D7-K10 WeakPolarHBondContact OD2-CD 3.4Å; D7-K10 WeakPolarHBondContact OD2-CE 3.33Å; D7-K10 WeakPolarHBondContact OD2-CG 3.2Å; D7-K10 IonicContact OD2-NZ 2.81Å; D7-K10 PolarHBondContact OD2-NZ 3.1Å; K10-K12 VanDerWaalsContact C-N 3.33Å; K10-K12 PolarHBondContact O-N 3.25Å; K10-K13 PolarHBondContact O-N 3.4Å; K10-L14 WeakPolarHBondContact O-CB 3.47Å; K10-L14 WeakPolarHBondContact O-CG 3.3Å; K10-L14 PolarHBondContact O-N 3.43Å
11	G	93.6	Very high	89.9	Confident	35 Å²	35	108.6 Å²	108.6	36%	0.361	57%	0.569	S	S	.	*	H	α-helix	trans	-57.9	-44.9	176.2	0	0	0	0	0	112.2	D7 I8 L14 F15	D7-G11 PolarHBondContact O-N 3.44Å; I8-G11 PolarHBondContact O-N 2.84Å; G11-L14 PolarHBondContact O-N 3.48Å; G11-F15 WeakPolarHBondContact O-CB 3.47Å; G11-F15 PolarHBondContact O-N 2.87Å
12	K	95.5	Very high	92.3	Very high	131 Å²	131	99.9 Å²	99.9	57%	0.57	53%	0.53	S	S	*	.	H	α-helix	trans	-60.3	-48.2	174.9	-176.5	179	178.1	-177.9	0	111.8	I8 E9 K10 L14 F15 V16	I8-K12 WeakPolarHBondContact O-CB 3.13Å; I8-K12 PolarHBondContact O-N 3.45Å; E9-K12 PolarHBondContact O-N 3.37Å; K10-K12 VanDerWaalsContact C-N 3.33Å; K10-K12 PolarHBondContact O-N 3.25Å; K12-L14 PolarHBondContact O-N 2.84Å; K12-F15 PolarHBondContact O-N 3.5Å; K12-V16 WeakPolarHBondContact O-CG2 3.48Å; K12-V16 PolarHBondContact O-N 2.68Å
13	K	96.7	Very high	93.6	Very high	138 Å²	138	98.8 Å²	98.8	60%	0.6	51%	0.505	S	S	*	.	H	α-helix	trans	-59.1	-46	177.1	-73	175.2	-177.8	176.1	0	111.7	E9 K10 F15 V16 Q17	E9-K13 WeakPolarHBondContact O-CG 3.43Å; E9-K13 PolarHBondContact O-N 3.25Å; E9-K13 VanDerWaalsContact O-N 3.1Å; K10-K13 PolarHBondContact O-N 3.4Å; K13-F15 VanDerWaalsContact C-N 3.35Å; K13-F15 PolarHBondContact O-N 3.44Å; K13-V16 PolarHBondContact O-N 3.35Å; K13-Q17 WeakPolarHBondContact O-CB 3.39Å; K13-Q17 VanDerWaalsContact O-CG 3.3Å; K13-Q17 WeakPolarHBondContact O-CG 3.42Å; K13-Q17 PolarHBondContact O-N 2.87Å
14	L	96.6	Very high	94.6	Very high	76 Å²	76	91.9 Å²	91.9	40%	0.398	48%	0.477	S	S	.	.	H	α-helix	trans	-62.9	-41.1	177.4	-72	171.7	0	0	0	112	K10 G11 K12 Q17 R18	K10-L14 WeakPolarHBondContact O-CB 3.47Å; K10-L14 WeakPolarHBondContact O-CG 3.3Å; K10-L14 PolarHBondContact O-N 3.43Å; G11-L14 PolarHBondContact O-N 3.48Å; K12-L14 PolarHBondContact O-N 2.84Å; L14-Q17 PolarHBondContact O-N 2.86Å; L14-R18 WeakPolarHBondContact O-CB 3.44Å; L14-R18 PolarHBondContact O-N 3.25Å
15	F	96.3	Very high	95.1	Very high	52 Å²	52	90.3 Å²	90.3	23%	0.228	46%	0.462	C	S	.	.	H	α-helix	trans	-61.8	-46.5	177.3	-172.7	-86.1	0	0	0	111.3	G11 K12 K13 Q17 R18 C19 S20 H23 V25 L37	G11-F15 WeakPolarHBondContact O-CB 3.47Å; G11-F15 PolarHBondContact O-N 2.87Å; K12-F15 PolarHBondContact O-N 3.5Å; K13-F15 VanDerWaalsContact C-N 3.35Å; K13-F15 PolarHBondContact O-N 3.44Å; F15-Q17 VanDerWaalsContact C-N 3.33Å; F15-Q17 PolarHBondContact O-N 3.48Å; F15-R18 PolarHBondContact O-N 2.87Å; F15-C19 HydrophobicContact CD1-CB 4.3Å; F15-C19 HydrophobicContact CD2-CB 3.52Å; F15-C19 HydrophobicContact CE1-CB 4.27Å; F15-C19 HydrophobicContact CE2-CB 3.49Å; F15-C19 VanDerWaalsContact CE2-CB 3.49Å; F15-C19 HydrophobicContact CG-CB 3.93Å; F15-C19 HydrophobicContact CZ-CB 3.87Å; F15-C19 CarbonylContact O-C 3.56Å; F15-C19 WeakPolarHBondContact O-CA 3.34Å; F15-C19 WeakPolarHBondContact O-CB 3.34Å; F15-C19 PolarHBondContact O-N 3Å; F15-S20 PolarHBondContact O-N 3.32Å; F15-H23 HydrophobicContact CZ-CB 4.12Å; F15-V25 HydrophobicContact CE1-CG1 3.95Å; F15-V25 HydrophobicContact CE2-CG1 3.75Å; F15-V25 HydrophobicContact CZ-CG1 3.4Å; F15-V25 VanDerWaalsContact CZ-CG1 3.4Å; F15-L37 HydrophobicContact CE2-CD1 4.01Å; F15-L37 HydrophobicContact CZ-CD1 4.4Å
16	V	96.2	Very high	95.5	Very high	85 Å²	85	90.8 Å²	90.8	52%	0.515	47%	0.465	S	S	.	.	H	α-helix	trans	-59	-47.4	176.7	174.2	0	0	0	0	110.4	K12 K13 S20	K12-V16 WeakPolarHBondContact O-CG2 3.48Å; K12-V16 PolarHBondContact O-N 2.68Å; K13-V16 PolarHBondContact O-N 3.35Å; V16-S20 PolarHBondContact O-OG 3.01Å
17	Q	97.3	Very high	95.8	Very high	133 Å²	133	97.3 Å²	97.3	62%	0.621	48%	0.478	S	S	*	.	H	α-helix	trans	-70	-34.9	-176.3	-71.9	175.3	-21.6	0	0	114.1	K13 L14 F15	K13-Q17 WeakPolarHBondContact O-CB 3.39Å; K13-Q17 VanDerWaalsContact O-CG 3.3Å; K13-Q17 WeakPolarHBondContact O-CG 3.42Å; K13-Q17 PolarHBondContact O-N 2.87Å; L14-Q17 PolarHBondContact O-N 2.86Å; F15-Q17 VanDerWaalsContact C-N 3.33Å; F15-Q17 PolarHBondContact O-N 3.48Å
18	R	96.7	Very high	95.7	Very high	196 Å²	196	97.5 Å²	97.5	74%	0.74	50%	0.498	S	S	*	.	H	α-helix	trans	-117.3	-22.6	-166.4	-58	-175.3	178.9	-173.3	-0.9	114.9	L14 F15	L14-R18 WeakPolarHBondContact O-CB 3.44Å; L14-R18 PolarHBondContact O-N 3.25Å; F15-R18 PolarHBondContact O-N 2.87Å
19	C	97	Very high	95.9	Very high	44 Å²	44	92 Å²	92	30%	0.297	48%	0.475	S	S	.	.	T	Hydrogen-bonded Turn	trans	-119.8	-35	-169.1	-50.7	0	0	0	0	112.6	F15 Q21 C22 H23	F15-C19 HydrophobicContact CD1-CB 4.3Å; F15-C19 HydrophobicContact CD2-CB 3.52Å; F15-C19 HydrophobicContact CE1-CB 4.27Å; F15-C19 HydrophobicContact CE2-CB 3.49Å; F15-C19 VanDerWaalsContact CE2-CB 3.49Å; F15-C19 HydrophobicContact CG-CB 3.93Å; F15-C19 HydrophobicContact CZ-CB 3.87Å; F15-C19 CarbonylContact O-C 3.56Å; F15-C19 WeakPolarHBondContact O-CA 3.34Å; F15-C19 WeakPolarHBondContact O-CB 3.34Å; F15-C19 PolarHBondContact O-N 3Å; C19-Q21 PolarHBondContact O-N 3.15Å; C19-Q21 VanDerWaalsContact O-N 3.15Å; C19-C22 PolarHBondContact O-N 3.35Å; C19-H23 PolarHBondContact O-N 3.27Å
20	S	96	Very high	96	Very high	34 Å²	34	91.3 Å²	91.3	24%	0.238	48%	0.48	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.8	-20.7	-168.1	76.9	0	0	0	0	114.8	F15 V16 C22 K32	F15-S20 PolarHBondContact O-N 3.32Å; V16-S20 PolarHBondContact O-OG 3.01Å; S20-C22 VanDerWaalsContact C-N 3.27Å; S20-C22 PolarHBondContact O-N 2.93Å; S20-K32 PolarHBondContact O-NZ 2.87Å
21	Q	97	Very high	96.1	Very high	151 Å²	151	88.2 Å²	88.2	71%	0.706	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.2	-36.5	174.3	-63.3	-174.7	23.3	0	0	111.1	C19 K32	C19-Q21 PolarHBondContact O-N 3.15Å; C19-Q21 VanDerWaalsContact O-N 3.15Å; Q21-K32 WeakPolarHBondContact O-CD 3.06Å
22	C	97.7	Very high	96.2	Very high	48 Å²	48	91.5 Å²	91.5	32%	0.324	47%	0.471	S	S	.	.	T	Hydrogen-bonded Turn	trans	-105.2	-20.6	-176.6	-60	0	0	0	0	113.6	C19 S20 K32 V33 G34	C19-C22 PolarHBondContact O-N 3.35Å; S20-C22 VanDerWaalsContact C-N 3.27Å; S20-C22 PolarHBondContact O-N 2.93Å; C22-K32 WeakPolarHBondContact O-CB 3.49Å; C22-V33 HydrophobicContact CB-CB 4.25Å; C22-G34 CarbonylContact O-C 3.58Å; C22-G34 VanDerWaalsContact O-CA 3.3Å; C22-G34 WeakPolarHBondContact O-CA 3.45Å; C22-G34 PolarHBondContact O-N 3.03Å
23	H	97.8	Very high	96.2	Very high	49 Å²	49	90.8 Å²	90.8	23%	0.227	48%	0.478	C	S	.	.			trans	-130.3	153.8	-170.5	-65.3	-77.4	0	0	0	113.6	F15 C19 P35 L37	F15-H23 HydrophobicContact CZ-CB 4.12Å; C19-H23 PolarHBondContact O-N 3.27Å; H23-P35 PolarHBondContact ND1-O 2.87Å; H23-L37 HydrophobicContact CB-CD1 3.69Å; H23-L37 HydrophobicContact CB-CG 3.95Å
24	T	96.9	Very high	96.2	Very high	21 Å²	21	84.5 Å²	84.5	13%	0.129	45%	0.452	C	S	.	.			trans	-118.3	157.7	168.3	57.2	0	0	0	0	109.4	P30 K32 N36 L37	T24-P30 HydrophobicContact CG2-CG 4.32Å; T24-P30 WeakPolarHBondContact CG2-O 3.37Å; T24-P30 PolarHBondContact OG1-O 2.95Å; T24-K32 HydrophobicContact CG2-CD 4.36Å; T24-K32 HydrophobicContact CG2-CG 4.25Å; T24-N36 VanDerWaalsContact OG1-CG 3.31Å; T24-N36 PolarHBondContact OG1-ND2 3.44Å; T24-L37 PolarHBondContact O-N 3.45Å
25	V	95.4	Very high	96.1	Very high	73 Å²	73	81.6 Å²	81.6	44%	0.442	44%	0.438	S	S	.	.			trans	-121.6	-11.8	179.6	-65.9	0	0	0	0	113.6	F15 L37 S38	F15-V25 HydrophobicContact CE1-CG1 3.95Å; F15-V25 HydrophobicContact CE2-CG1 3.75Å; F15-V25 HydrophobicContact CZ-CG1 3.4Å; F15-V25 VanDerWaalsContact CZ-CG1 3.4Å; V25-L37 HydrophobicContact CG1-CB 4.33Å; V25-S38 WeakPolarHBondContact O-CB 3.41Å
26	E	94.9	Very high	96.1	Very high	137 Å²	137	79.6 Å²	79.6	64%	0.64	43%	0.43	S	S	*	.	S	Bend	trans	-69.3	137.1	-179.6	-60.7	-52.4	138.8	0	0	111.6	G28 G29 N36	E26-G28 PolarHBondContact O-N 2.77Å; E26-G29 PolarHBondContact O-N 3.14Å; E26-N36 PolarHBondContact O-ND2 2.66Å
27	K	93.8	Very high	96.1	Very high	190 Å²	190	77.3 Å²	77.3	83%	0.826	41%	0.414	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.8	122.7	177.2	-173.9	-180	179	-176.7	0	109.8	G29 S38	K27-G29 PolarHBondContact O-N 3.44Å; K27-S38 WeakPolarHBondContact CA-OG 3.36Å
28	G	93.2	Very high	95.9	Very high	82 Å²	82	72.7 Å²	72.7	85%	0.845	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.1	3.6	-175.9	0	0	0	0	0	114.6	E26	E26-G28 PolarHBondContact O-N 2.77Å
29	G	95.5	Very high	95.5	Very high	18 Å²	18	66 Å²	66	19%	0.186	39%	0.389	C	S	.	.	P	Polyproline II helix	trans	-66.4	163.4	174.8	0	0	0	0	0	113.2	E26 K27 N36	E26-G29 PolarHBondContact O-N 3.14Å; K27-G29 PolarHBondContact O-N 3.44Å; G29-N36 VanDerWaalsContact C-ND2 3.26Å; G29-N36 WeakPolarHBondContact CA-ND2 3.47Å; G29-N36 PolarHBondContact N-ND2 3.47Å; G29-N36 PolarHBondContact O-ND2 3.33Å
30	P	96	Very high	95.2	Very high	94 Å²	94	65.6 Å²	65.6	61%	0.61	38%	0.383	S	S	*	.	P	Polyproline II helix	trans	-69.6	152.8	-176.2	30	-35.8	0	0	0	112	T24	T24-P30 HydrophobicContact CG2-CG 4.32Å; T24-P30 WeakPolarHBondContact CG2-O 3.37Å; T24-P30 PolarHBondContact OG1-O 2.95Å
31	H	97	Very high	94.9	Very high	65 Å²	65	69.3 Å²	69.3	30%	0.301	40%	0.395	S	S	.	.	P	Polyproline II helix	trans	-71.7	152.1	158.2	-55.4	-36.1	0	0	0	109.9	N36 P49 Y51	H31-N36 WeakPolarHBondContact ND1-CB 3.42Å; H31-N36 PolarHBondContact ND1-N 2.78Å; H31-P49 PolarHBondContact NE2-O 3.49Å; H31-Y51 HydrophobicContact CB-CD2 3.74Å; H31-Y51 HydrophobicContact CB-CE2 4.3Å; H31-Y51 AromaticContact CD2-CD2 3.95Å; H31-Y51 AromaticContact CG-CD2 3.71Å; H31-Y51 PolarHBondContact NE2-N 3.45Å
32	K	96.1	Very high	94.3	Very high	104 Å²	104	64.5 Å²	64.5	45%	0.452	39%	0.386	S	S	.	.			trans	-117.1	-134.8	168.5	-55.7	-179.4	176.3	-177.7	0	108.2	S20 Q21 C22 T24 G34	S20-K32 PolarHBondContact O-NZ 2.87Å; Q21-K32 WeakPolarHBondContact O-CD 3.06Å; C22-K32 WeakPolarHBondContact O-CB 3.49Å; T24-K32 HydrophobicContact CG2-CD 4.36Å; T24-K32 HydrophobicContact CG2-CG 4.25Å; K32-G34 PolarHBondContact N-O 2.76Å; K32-G34 PolarHBondContact O-N 3.47Å
33	V	96.5	Very high	93.8	Very high	116 Å²	116	64.4 Å²	64.4	70%	0.703	38%	0.379	S	S	*	.	S	Bend	trans	-59.2	-27.9	168	-177	0	0	0	0	111.5	C22 Y51	C22-V33 HydrophobicContact CB-CB 4.25Å; V33-Y51 PolarHBondContact O-OH 2.81Å
34	G	95.3	Very high	93.3	Very high	6 Å²	6	66.5 Å²	66.5	6%	0.062	39%	0.387	C	S	.	.	S	Bend	trans	-120.4	168.4	173.2	0	0	0	0	0	112.9	C22 K32 Y51	C22-G34 CarbonylContact O-C 3.58Å; C22-G34 VanDerWaalsContact O-CA 3.3Å; C22-G34 WeakPolarHBondContact O-CA 3.45Å; C22-G34 PolarHBondContact O-N 3.03Å; K32-G34 PolarHBondContact N-O 2.76Å; K32-G34 PolarHBondContact O-N 3.47Å; G34-Y51 WeakPolarHBondContact CA-OH 3.3Å
35	P	96	Very high	92.9	Very high	16 Å²	16	66.5 Å²	66.5	10%	0.104	39%	0.388	C	S	.	.			trans	-66.6	159.9	178.7	28.4	-38.4	0	0	0	112.7	H23 L37 A48 Y51 Y53	H23-P35 PolarHBondContact ND1-O 2.87Å; P35-L37 HydrophobicContact CG-CD2 4.45Å; P35-A48 HydrophobicContact CB-CB 3.79Å; P35-Y51 HydrophobicContact CB-CD1 3.81Å; P35-Y51 HydrophobicContact CB-CD2 4.04Å; P35-Y51 HydrophobicContact CB-CE1 4.25Å; P35-Y51 HydrophobicContact CB-CE2 4.45Å; P35-Y51 HydrophobicContact CB-CG 3.68Å; P35-Y51 HydrophobicContact CG-CD1 4.24Å; P35-Y51 HydrophobicContact CG-CE1 4.28Å; P35-Y53 HydrophobicContact CB-CE1 4.3Å; P35-Y53 WeakPolarHBondContact CB-OH 3.43Å; P35-Y53 HydrophobicContact CG-CE1 3.92Å; P35-Y53 WeakPolarHBondContact CG-OH 3.33Å
36	N	96.1	Very high	92.5	Very high	10 Å²	10	63.9 Å²	63.9	5%	0.053	38%	0.375	C	S	.	.			trans	-69.4	133.8	168.5	-175.8	-40.4	0	0	0	109.6	T24 E26 G29 H31 S38 R43	T24-N36 VanDerWaalsContact OG1-CG 3.31Å; T24-N36 PolarHBondContact OG1-ND2 3.44Å; E26-N36 PolarHBondContact O-ND2 2.66Å; G29-N36 VanDerWaalsContact C-ND2 3.26Å; G29-N36 WeakPolarHBondContact CA-ND2 3.47Å; G29-N36 PolarHBondContact N-ND2 3.47Å; G29-N36 PolarHBondContact O-ND2 3.33Å; H31-N36 WeakPolarHBondContact ND1-CB 3.42Å; H31-N36 PolarHBondContact ND1-N 2.78Å; N36-S38 WeakPolarHBondContact OD1-CA 3.45Å; N36-S38 WeakPolarHBondContact OD1-CB 3.44Å; N36-S38 PolarHBondContact OD1-N 3.01Å; N36-R43 PolarHBondContact O-NH1 3.19Å; N36-R43 PolarHBondContact O-NH2 3.33Å; N36-R43 VanDerWaalsContact O-NH2 3.12Å
37	L	95.3	Very high	92.2	Very high	37 Å²	37	62.4 Å²	62.4	19%	0.194	37%	0.369	C	S	.	.			trans	-98.1	3.9	-175.7	-55.5	-176.2	0	0	0	113.6	F15 H23 T24 V25 P35 G39 L40	F15-L37 HydrophobicContact CE2-CD1 4.01Å; F15-L37 HydrophobicContact CZ-CD1 4.4Å; H23-L37 HydrophobicContact CB-CD1 3.69Å; H23-L37 HydrophobicContact CB-CG 3.95Å; T24-L37 PolarHBondContact O-N 3.45Å; V25-L37 HydrophobicContact CG1-CB 4.33Å; P35-L37 HydrophobicContact CG-CD2 4.45Å; L37-G39 PolarHBondContact O-N 3.26Å; L37-L40 HydrophobicContact CB-CB 4.24Å; L37-L40 HydrophobicContact CB-CD2 4.25Å; L37-L40 HydrophobicContact CD1-CD2 4.45Å; L37-L40 HydrophobicContact CD2-CD1 4.06Å; L37-L40 HydrophobicContact CD2-CD2 4Å; L37-L40 HydrophobicContact CD2-CG 4.49Å; L37-L40 HydrophobicContact CG-CD2 4.45Å; L37-L40 WeakPolarHBondContact O-CB 3.11Å; L37-L40 PolarHBondContact O-N 2.91Å
38	S	92.9	Very high	92.1	Very high	36 Å²	36	53.6 Å²	53.6	25%	0.252	33%	0.331	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.3	127.7	165.5	172.7	0	0	0	0	109.7	V25 K27 N36 L40 R43	V25-S38 WeakPolarHBondContact O-CB 3.41Å; K27-S38 WeakPolarHBondContact CA-OG 3.36Å; N36-S38 WeakPolarHBondContact OD1-CA 3.45Å; N36-S38 WeakPolarHBondContact OD1-CB 3.44Å; N36-S38 PolarHBondContact OD1-N 3.01Å; S38-L40 PolarHBondContact O-N 3.12Å; S38-R43 PolarHBondContact O-NH1 2.99Å
39	G	89.8	Confident	91.9	Very high	55 Å²	55	55.1 Å²	55.1	57%	0.567	33%	0.326	S	S	*	.	T	Hydrogen-bonded Turn	trans	65.6	21	-176.9	0	0	0	0	0	113.9	L37 F41 R43	L37-G39 PolarHBondContact O-N 3.26Å; G39-F41 PolarHBondContact O-N 3.3Å; G39-R43 WeakPolarHBondContact O-CB 3.4Å
40	L	90.7	Very high	91.8	Very high	36 Å²	36	58 Å²	58	19%	0.188	36%	0.355	C	S	.	.			trans	-59.6	-45.4	179.7	178.9	68.7	0	0	0	112.2	L37 S38 G42 R43 L64	L37-L40 HydrophobicContact CB-CB 4.24Å; L37-L40 HydrophobicContact CB-CD2 4.25Å; L37-L40 HydrophobicContact CD1-CD2 4.45Å; L37-L40 HydrophobicContact CD2-CD1 4.06Å; L37-L40 HydrophobicContact CD2-CD2 4Å; L37-L40 HydrophobicContact CD2-CG 4.49Å; L37-L40 HydrophobicContact CG-CD2 4.45Å; L37-L40 WeakPolarHBondContact O-CB 3.11Å; L37-L40 PolarHBondContact O-N 2.91Å; S38-L40 PolarHBondContact O-N 3.12Å; L40-G42 PolarHBondContact O-N 3.47Å; L40-R43 VanDerWaalsContact O-CB 3.31Å; L40-R43 WeakPolarHBondContact O-CB 3.47Å; L40-R43 PolarHBondContact O-N 3.42Å; L40-R43 VanDerWaalsContact O-N 3.1Å; L40-L64 HydrophobicContact CD1-CD1 4.21Å; L40-L64 HydrophobicContact CD1-CD2 3.86Å; L40-L64 HydrophobicContact CD1-CG 4.49Å; L40-L64 HydrophobicContact CD2-CD2 3.8Å; L40-L64 HydrophobicContact CG-CB 4.46Å; L40-L64 HydrophobicContact CG-CD2 3.76Å
41	F	88.2	Confident	91.7	Very high	112 Å²	112	56.4 Å²	56.4	49%	0.491	34%	0.338	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71	128.6	-179	-62.1	-77.6	0	0	0	111	G39 R43 L64 L66	G39-F41 PolarHBondContact O-N 3.3Å; F41-R43 VanDerWaalsContact C-N 3.27Å; F41-L64 CarbonylContact C-O 3.53Å; F41-L64 WeakPolarHBondContact CA-O 3.38Å; F41-L66 HydrophobicContact CB-CB 4Å; F41-L66 HydrophobicContact CB-CD1 3.19Å; F41-L66 HydrophobicContact CB-CG 4.21Å; F41-L66 HydrophobicContact CD1-CD1 4.48Å; F41-L66 HydrophobicContact CD2-CD1 4.32Å; F41-L66 HydrophobicContact CG-CD1 3.81Å
42	G	84.5	Confident	91.5	Very high	50 Å²	50	59.4 Å²	59.4	52%	0.515	36%	0.361	S	S	.	.	T	Hydrogen-bonded Turn	trans	86.2	-12.1	-171.2	0	0	0	0	0	114	L40 L64	L40-G42 PolarHBondContact O-N 3.47Å; G42-L64 PolarHBondContact N-O 3.44Å
43	R	88.2	Confident	91.3	Very high	45 Å²	45	56.3 Å²	56.3	17%	0.17	35%	0.347	C	S	.	.	P	Polyproline II helix	trans	-83.4	145.1	176.3	-167.7	175.8	70	-167.9	0.2	110.8	N36 S38 G39 L40 F41 Q47 L64	N36-R43 PolarHBondContact O-NH1 3.19Å; N36-R43 PolarHBondContact O-NH2 3.33Å; N36-R43 VanDerWaalsContact O-NH2 3.12Å; S38-R43 PolarHBondContact O-NH1 2.99Å; G39-R43 WeakPolarHBondContact O-CB 3.4Å; L40-R43 VanDerWaalsContact O-CB 3.31Å; L40-R43 WeakPolarHBondContact O-CB 3.47Å; L40-R43 PolarHBondContact O-N 3.42Å; L40-R43 VanDerWaalsContact O-N 3.1Å; F41-R43 VanDerWaalsContact C-N 3.27Å; R43-Q47 HydrophobicContact CG-CB 4.2Å; R43-L64 PolarHBondContact O-N 3.33Å; R43-L64 VanDerWaalsContact O-N 3.14Å
44	K	86.8	Confident	91	Very high	93 Å²	93	55.2 Å²	55.2	40%	0.404	34%	0.341	S	S	.	.	B	Isolated β-bridge	trans	-71.1	147.6	168.9	-72.7	174.9	176.3	-176.8	0	110.7	Q47 V61 L62 I63	K44-Q47 HydrophobicContact CB-CG 4.04Å; K44-V61 HydrophobicContact CB-CG1 4.47Å; K44-V61 HydrophobicContact CD-CG1 3.77Å; K44-V61 HydrophobicContact CG-CG1 4.21Å; K44-L62 CarbonylContact C-O 3.43Å; K44-L62 VanDerWaalsContact CA-O 3.28Å; K44-L62 WeakPolarHBondContact CA-O 3.33Å; K44-I63 HydrophobicContact CG-CG1 3.96Å
45	T	88.4	Confident	90.7	Very high	22 Å²	22	58.9 Å²	58.9	14%	0.135	37%	0.37	C	S	.	.	T	Hydrogen-bonded Turn	trans	-57.6	149.8	173	54.2	0	0	0	0	111.2	Q47 N57 V61 L62 L64	T45-Q47 VanDerWaalsContact C-N 3.32Å; T45-Q47 WeakPolarHBondContact O-CG 3.28Å; T45-Q47 PolarHBondContact O-N 2.72Å; T45-N57 WeakPolarHBondContact CB-O 3.46Å; T45-N57 PolarHBondContact OG1-O 3.28Å; T45-V61 WeakPolarHBondContact OG1-CA 3.42Å; T45-V61 PolarHBondContact OG1-N 3.23Å; T45-L62 HydrophobicContact CG2-CB 3.83Å; T45-L62 PolarHBondContact N-O 3.41Å; T45-L62 PolarHBondContact OG1-N 3.16Å; T45-L64 HydrophobicContact CG2-CD1 3.66Å
46	G	87.7	Confident	90.3	Very high	18 Å²	18	61.3 Å²	61.3	19%	0.186	39%	0.391	C	S	.	.	T	Hydrogen-bonded Turn	trans	74.4	13.6	177.9	0	0	0	0	0	115.9	Y53 N57	G46-Y53 VanDerWaalsContact C-CE2 3.42Å; G46-Y53 WeakPolarHBondContact O-CD2 3.45Å; G46-N57 WeakPolarHBondContact CA-OD1 3.38Å; G46-N57 PolarHBondContact N-OD1 3.02Å
47	Q	88.7	Confident	89.7	Confident	106 Å²	106	63.7 Å²	63.7	50%	0.495	40%	0.404	S	S	.	.			trans	-119.8	15.7	-171	-56.3	-157.2	7	0	0	116.1	R43 K44 T45 P49	R43-Q47 HydrophobicContact CG-CB 4.2Å; K44-Q47 HydrophobicContact CB-CG 4.04Å; T45-Q47 VanDerWaalsContact C-N 3.32Å; T45-Q47 WeakPolarHBondContact O-CG 3.28Å; T45-Q47 PolarHBondContact O-N 2.72Å; Q47-P49 VanDerWaalsContact O-CD 3.27Å; Q47-P49 WeakPolarHBondContact O-CD 3.49Å
48	A	90.8	Very high	89	Confident	5 Å²	5	66.3 Å²	66.3	4%	0.041	42%	0.418	C	S	.	.			trans	-66.2	121.3	168.2	0	0	0	0	0	109.1	P35 G50 Y51 Y53	P35-A48 HydrophobicContact CB-CB 3.79Å; A48-G50 PolarHBondContact O-N 3.45Å; A48-Y51 PolarHBondContact O-N 3.28Å; A48-Y53 HydrophobicContact CB-CE2 4.15Å; A48-Y53 WeakPolarHBondContact CB-OH 3.18Å; A48-Y53 PolarHBondContact N-OH 3.05Å; A48-Y53 VanDerWaalsContact N-OH 3.16Å
49	P	90.2	Very high	88.2	Confident	113 Å²	113	68.9 Å²	68.9	73%	0.734	44%	0.435	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.2	134.6	-179.2	-22.4	33.6	0	0	0	110.9	H31 Q47 Y51	H31-P49 PolarHBondContact NE2-O 3.49Å; Q47-P49 VanDerWaalsContact O-CD 3.27Å; Q47-P49 WeakPolarHBondContact O-CD 3.49Å; P49-Y51 VanDerWaalsContact C-N 3.32Å; P49-Y51 PolarHBondContact O-N 3Å
50	G	92	Very high	87.6	Confident	78 Å²	78	73.2 Å²	73.2	80%	0.804	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.9	-2	176.7	0	0	0	0	0	115.9	A48	A48-G50 PolarHBondContact O-N 3.45Å
51	Y	94.8	Very high	86.8	Confident	61 Å²	61	75 Å²	75	24%	0.239	45%	0.451	C	S	.	.			trans	-98.9	138.3	176.5	-170.2	-96.9	0	0	0	112.2	H31 V33 G34 P35 A48 P49 Y53	H31-Y51 HydrophobicContact CB-CD2 3.74Å; H31-Y51 HydrophobicContact CB-CE2 4.3Å; H31-Y51 AromaticContact CD2-CD2 3.95Å; H31-Y51 AromaticContact CG-CD2 3.71Å; H31-Y51 PolarHBondContact NE2-N 3.45Å; V33-Y51 PolarHBondContact O-OH 2.81Å; G34-Y51 WeakPolarHBondContact CA-OH 3.3Å; P35-Y51 HydrophobicContact CB-CD1 3.81Å; P35-Y51 HydrophobicContact CB-CD2 4.04Å; P35-Y51 HydrophobicContact CB-CE1 4.25Å; P35-Y51 HydrophobicContact CB-CE2 4.45Å; P35-Y51 HydrophobicContact CB-CG 3.68Å; P35-Y51 HydrophobicContact CG-CD1 4.24Å; P35-Y51 HydrophobicContact CG-CE1 4.28Å; A48-Y51 PolarHBondContact O-N 3.28Å; P49-Y51 VanDerWaalsContact C-N 3.32Å; P49-Y51 PolarHBondContact O-N 3Å; Y51-Y53 AromaticContact CD1-CD1 3.91Å; Y51-Y53 HydrophobicContact CD1-CD1 3.91Å; Y51-Y53 AromaticContact CD1-CD2 3.7Å; Y51-Y53 HydrophobicContact CD1-CD2 3.7Å; Y51-Y53 AromaticContact CD1-CE1 3.8Å; Y51-Y53 HydrophobicContact CD1-CE1 3.8Å; Y51-Y53 AromaticContact CD1-CE2 3.56Å; Y51-Y53 HydrophobicContact CD1-CE2 3.56Å; Y51-Y53 AromaticContact CD1-CG 3.87Å; Y51-Y53 HydrophobicContact CD1-CG 3.87Å; Y51-Y53 AromaticContact CD1-CZ 3.61Å; Y51-Y53 HydrophobicContact CE1-CD1 4.09Å; Y51-Y53 HydrophobicContact CE1-CE1 4.16Å; Y51-Y53 HydrophobicContact CE1-CG 4.31Å; Y51-Y53 HydrophobicContact CG-CE2 4.18Å; Y51-Y53 WeakPolarHBondContact O-CD2 3.31Å
52	T	93.5	Very high	86.3	Confident	129 Å²	129	74.4 Å²	74.4	79%	0.791	45%	0.452	S	S	*	.			trans	-89.1	115.1	176.3	-59.7	0	0	0	0	110.5
53	Y	91.8	Very high	85.9	Confident	38 Å²	38	77.1 Å²	77.1	15%	0.149	45%	0.454	C	S	.	.			trans	-98.8	158.3	-179	-72.9	-88.3	0	0	0	112.7	P35 G46 A48 Y51 N57	P35-Y53 HydrophobicContact CB-CE1 4.3Å; P35-Y53 WeakPolarHBondContact CB-OH 3.43Å; P35-Y53 HydrophobicContact CG-CE1 3.92Å; P35-Y53 WeakPolarHBondContact CG-OH 3.33Å; G46-Y53 VanDerWaalsContact C-CE2 3.42Å; G46-Y53 WeakPolarHBondContact O-CD2 3.45Å; A48-Y53 HydrophobicContact CB-CE2 4.15Å; A48-Y53 WeakPolarHBondContact CB-OH 3.18Å; A48-Y53 PolarHBondContact N-OH 3.05Å; A48-Y53 VanDerWaalsContact N-OH 3.16Å; Y51-Y53 AromaticContact CD1-CD1 3.91Å; Y51-Y53 HydrophobicContact CD1-CD1 3.91Å; Y51-Y53 AromaticContact CD1-CD2 3.7Å; Y51-Y53 HydrophobicContact CD1-CD2 3.7Å; Y51-Y53 AromaticContact CD1-CE1 3.8Å; Y51-Y53 HydrophobicContact CD1-CE1 3.8Å; Y51-Y53 AromaticContact CD1-CE2 3.56Å; Y51-Y53 HydrophobicContact CD1-CE2 3.56Å; Y51-Y53 AromaticContact CD1-CG 3.87Å; Y51-Y53 HydrophobicContact CD1-CG 3.87Å; Y51-Y53 AromaticContact CD1-CZ 3.61Å; Y51-Y53 HydrophobicContact CE1-CD1 4.09Å; Y51-Y53 HydrophobicContact CE1-CE1 4.16Å; Y51-Y53 HydrophobicContact CE1-CG 4.31Å; Y51-Y53 HydrophobicContact CG-CE2 4.18Å; Y51-Y53 WeakPolarHBondContact O-CD2 3.31Å; Y53-N57 HydrophobicContact CD1-CB 4.16Å; Y53-N57 WeakPolarHBondContact CD1-OD1 3.33Å
54	T	89.4	Confident	85	Confident	94 Å²	94	77.9 Å²	77.9	58%	0.577	46%	0.461	S	S	*	.			trans	-72.7	150.7	166.7	65.2	0	0	0	0	110.7	A56 N57 I58	T54-A56 PolarHBondContact O-N 3.29Å; T54-N57 PolarHBondContact O-N 3.1Å; T54-N57 PolarHBondContact OG1-N 3Å; T54-I58 PolarHBondContact O-N 2.74Å
55	A	88.1	Confident	84	Confident	82 Å²	82	76.6 Å²	76.6	68%	0.678	46%	0.464	S	S	*	.	H	α-helix	trans	-54.8	-36.8	177.1	0	0	0	0	0	112.4	N57 I58 S59	A55-N57 PolarHBondContact O-N 3.46Å; A55-I58 PolarHBondContact O-N 3.02Å; A55-S59 WeakPolarHBondContact O-CB 3.44Å; A55-S59 PolarHBondContact O-N 2.8Å; A55-S59 PolarHBondContact O-OG 2.83Å
56	A	88.2	Confident	82.3	Confident	67 Å²	67	78.8 Å²	78.8	55%	0.554	47%	0.474	S	S	*	.	H	α-helix	trans	-64.5	-35.1	177.9	0	0	0	0	0	113.5	T54 S59 K60	T54-A56 PolarHBondContact O-N 3.29Å; A56-S59 PolarHBondContact O-OG 3.18Å; A56-K60 WeakPolarHBondContact O-CG 2.97Å; A56-K60 PolarHBondContact O-N 3.29Å
57	N	83.3	Confident	80.6	Confident	61 Å²	61	83.7 Å²	83.7	33%	0.326	50%	0.496	S	S	.	.	H	α-helix	trans	-73.5	-37.4	178.8	-164.5	-80.9	0	0	0	111.6	T45 G46 Y53 T54 A55	T45-N57 WeakPolarHBondContact CB-O 3.46Å; T45-N57 PolarHBondContact OG1-O 3.28Å; G46-N57 WeakPolarHBondContact CA-OD1 3.38Å; G46-N57 PolarHBondContact N-OD1 3.02Å; Y53-N57 HydrophobicContact CD1-CB 4.16Å; Y53-N57 WeakPolarHBondContact CD1-OD1 3.33Å; T54-N57 PolarHBondContact O-N 3.1Å; T54-N57 PolarHBondContact OG1-N 3Å; A55-N57 PolarHBondContact O-N 3.46Å
58	I	80.8	Confident	78.8	Confident	92 Å²	92	83 Å²	83	47%	0.472	50%	0.495	S	S	.	.	H	α-helix	trans	-67.7	-45.2	177.5	-62	170.6	0	0	0	110.5	T54 A55 K60 V61	T54-I58 PolarHBondContact O-N 2.74Å; A55-I58 PolarHBondContact O-N 3.02Å; I58-K60 VanDerWaalsContact C-N 3.3Å; I58-K60 PolarHBondContact O-N 3.42Å; I58-V61 WeakPolarHBondContact O-CG2 3.27Å; I58-V61 PolarHBondContact O-N 2.97Å
59	S	77.1	Confident	76.5	Confident	89 Å²	89	91.5 Å²	91.5	62%	0.622	53%	0.526	S	S	*	.	H	α-helix	trans	-70	-24	-174.3	66.2	0	0	0	0	114.2	A55 A56 V61	A55-S59 WeakPolarHBondContact O-CB 3.44Å; A55-S59 PolarHBondContact O-N 2.8Å; A55-S59 PolarHBondContact O-OG 2.83Å; A56-S59 PolarHBondContact O-OG 3.18Å; S59-V61 VanDerWaalsContact C-N 3.33Å; S59-V61 PolarHBondContact O-N 3.38Å
60	K	76.4	Confident	74.1	Confident	146 Å²	146	96.5 Å²	96.5	64%	0.635	53%	0.532	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.7	-24.5	179.9	-87.3	-82	-176.7	176.7	0	114.2	A56 I58 L62	A56-K60 WeakPolarHBondContact O-CG 2.97Å; A56-K60 PolarHBondContact O-N 3.29Å; I58-K60 VanDerWaalsContact C-N 3.3Å; I58-K60 PolarHBondContact O-N 3.42Å; K60-L62 HydrophobicContact CB-CG 4.23Å; K60-L62 HydrophobicContact CD-CD1 4.46Å; K60-L62 WeakPolarHBondContact O-CG 3.48Å; K60-L62 PolarHBondContact O-N 2.95Å
61	V	73.1	Confident	71.4	Confident	75 Å²	75	99.9 Å²	99.9	46%	0.455	53%	0.526	S	S	.	.			trans	35.9	47.9	179.5	-160	0	0	0	0	113.8	K44 T45 I58 S59	K44-V61 HydrophobicContact CB-CG1 4.47Å; K44-V61 HydrophobicContact CD-CG1 3.77Å; K44-V61 HydrophobicContact CG-CG1 4.21Å; T45-V61 WeakPolarHBondContact OG1-CA 3.42Å; T45-V61 PolarHBondContact OG1-N 3.23Å; I58-V61 WeakPolarHBondContact O-CG2 3.27Å; I58-V61 PolarHBondContact O-N 2.97Å; S59-V61 VanDerWaalsContact C-N 3.33Å; S59-V61 PolarHBondContact O-N 3.38Å
62	L	79.1	Confident	68.4	Low	99 Å²	99	105 Å²	105	52%	0.518	55%	0.554	S	S	.	*			trans	-84.5	136	179.4	-60.8	176.2	0	0	0	109.4	K44 T45 K60	K44-L62 CarbonylContact C-O 3.43Å; K44-L62 VanDerWaalsContact CA-O 3.28Å; K44-L62 WeakPolarHBondContact CA-O 3.33Å; T45-L62 HydrophobicContact CG2-CB 3.83Å; T45-L62 PolarHBondContact N-O 3.41Å; T45-L62 PolarHBondContact OG1-N 3.16Å; K60-L62 HydrophobicContact CB-CG 4.23Å; K60-L62 HydrophobicContact CD-CD1 4.46Å; K60-L62 WeakPolarHBondContact O-CG 3.48Å; K60-L62 PolarHBondContact O-N 2.95Å
63	I	75.5	Confident	65.8	Low	106 Å²	106	111.5 Å²	111.5	54%	0.544	58%	0.576	S	S	.	*	B	Isolated β-bridge	trans	-82.9	120.7	167.1	-61.7	174.7	0	0	0	106.7	K44 S65	K44-I63 HydrophobicContact CG-CG1 3.96Å; I63-S65 VanDerWaalsContact C-N 3.34Å; I63-S65 PolarHBondContact O-N 3.24Å
64	L	69.1	Low	64.5	Low	61 Å²	61	115.2 Å²	115.2	32%	0.319	60%	0.597	S	S	.	*			trans	-73.5	94.6	172.3	-81	93.2	0	0	0	108.4	L40 F41 G42 R43 T45 L66	L40-L64 HydrophobicContact CD1-CD1 4.21Å; L40-L64 HydrophobicContact CD1-CD2 3.86Å; L40-L64 HydrophobicContact CD1-CG 4.49Å; L40-L64 HydrophobicContact CD2-CD2 3.8Å; L40-L64 HydrophobicContact CG-CB 4.46Å; L40-L64 HydrophobicContact CG-CD2 3.76Å; F41-L64 CarbonylContact C-O 3.53Å; F41-L64 WeakPolarHBondContact CA-O 3.38Å; G42-L64 PolarHBondContact N-O 3.44Å; R43-L64 PolarHBondContact O-N 3.33Å; R43-L64 VanDerWaalsContact O-N 3.14Å; T45-L64 HydrophobicContact CG2-CD1 3.66Å; L64-L66 PolarHBondContact O-N 3.47Å
65	S	65.1	Low	63.2	Low	67 Å²	67	116.3 Å²	116.3	47%	0.469	60%	0.598	S	S	.	*			trans	-61.2	131.4	-169.6	61.5	0	0	0	0	112.9	I63 L67	I63-S65 VanDerWaalsContact C-N 3.34Å; I63-S65 PolarHBondContact O-N 3.24Å; S65-L67 PolarHBondContact O-N 2.91Å
66	L	54.3	Low	61.8	Low	68 Å²	68	118.2 Å²	118.2	36%	0.356	59%	0.594	S	S	.	*			trans	-90	61.3	173.6	-172.6	86.3	0	0	0	110.4	F41 L64 L68 R69	F41-L66 HydrophobicContact CB-CB 4Å; F41-L66 HydrophobicContact CB-CD1 3.19Å; F41-L66 HydrophobicContact CB-CG 4.21Å; F41-L66 HydrophobicContact CD1-CD1 4.48Å; F41-L66 HydrophobicContact CD2-CD1 4.32Å; F41-L66 HydrophobicContact CG-CD1 3.81Å; L64-L66 PolarHBondContact O-N 3.47Å; L66-L68 PolarHBondContact O-N 3.41Å; L66-R69 HydrophobicContact CD1-CG 3.85Å; L66-R69 HydrophobicContact CD2-CB 3.89Å; L66-R69 HydrophobicContact CD2-CG 3.82Å; L66-R69 HydrophobicContact CG-CB 4.06Å; L66-R69 HydrophobicContact CG-CG 3.87Å
67	L	51.3	Low	60.2	Low	121 Å²	121	121.2 Å²	121.2	63%	0.634	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.7	4	172.7	-90	162.4	0	0	0	113.1	S65	S65-L67 PolarHBondContact O-N 2.91Å
68	L	50.2	Low	58.8	Low	92 Å²	92	124.9 Å²	124.9	48%	0.482	61%	0.613	S	S	.	*	T	Hydrogen-bonded Turn	trans	-102.1	1.3	-174.2	-75.2	159.2	0	0	0	114.8	L66	L66-L68 PolarHBondContact O-N 3.41Å
69	R	43.7	Very low	57.3	Low	183 Å²	183	127.1 Å²	127.1	69%	0.691	62%	0.622	S	S	*	*	S	Bend	trans	-94.8	3.6	178.4	-82.8	-160.8	-141.4	-117.5	-1.5	115.4	L66	L66-R69 HydrophobicContact CD1-CG 3.85Å; L66-R69 HydrophobicContact CD2-CB 3.89Å; L66-R69 HydrophobicContact CD2-CG 3.82Å; L66-R69 HydrophobicContact CG-CB 4.06Å; L66-R69 HydrophobicContact CG-CG 3.87Å
70	Y	38.5	Very low	55.9	Low	218 Å²	218	129.9 Å²	129.9	86%	0.855	62%	0.622	S	S	*	*	S	Bend	trans	-98.8	3.6	-172.9	-116.3	-84.9	0	0	0	116.1
71	H	36.6	Very low	54.4	Low	148 Å²	148	128.6 Å²	128.6	69%	0.685	62%	0.621	S	S	*	*			trans	-126	35.8	179.2	-76.6	-4.1	0	0	0	113.8
72	M	31.7	Very low	52.8	Low	169 Å²	169	133.1 Å²	133.1	83%	0.833	64%	0.635	S	S	*	*			trans	-102	64.9	164.4	-69.7	-85.8	-63.2	0	0	108.8
73	E	38.5	Very low	50.4	Low	265 Å²	265	136.2 Å²	136.2	100%	1.238	65%	0.646	S	S	*	*			trans	-131.4	0	149.9	-76.2	-169.6	152.9	0	0	107.4

Retrieved 73 of 73 residues in 45.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).