A0A5K4EF21_SCHMA Loading...

Tektin

AlphaFold DB (A0A3Q0KGI1), UniProt , Accession A0A5K4EF21, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 73 aa.

						>A0A5K4EF21_SCHMA|A0A5K4EF21
MRLLREIGELQESIDQLIQQLNNTQIIHQDLLNNKSRLEMDLSIKTNSIYIDREKCLGLRKTFPMNPSLIAPV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	79.6	Confident	95.2	Very high	195 Å²	195	120.2 Å²	120.2	96%	0.961	58%	0.581	S	S	*	*				0	-29.1	0	-61.5	-49.9	-118.6	0	0	115.1	L3 L4 R5	M1-L3 PolarHBondContact O-N 3.47Å; M1-L4 PolarHBondContact O-N 2.94Å; M1-L4 HydrophobicContact SD-CD1 4.16Å; M1-R5 PolarHBondContact O-N 3.39Å
2	R	93.6	Very high	95.5	Very high	188 Å²	188	119.9 Å²	119.9	71%	0.709	58%	0.578	S	S	*	*	H	α-helix	trans	-54.2	-52.1	-177.7	-178.4	178.9	172.3	177.2	-0.4	114.5	L4 R5 E6	R2-L4 VanDerWaalsContact C-N 3.33Å; R2-L4 PolarHBondContact O-N 3.44Å; R2-R5 WeakPolarHBondContact O-CB 3.28Å; R2-R5 PolarHBondContact O-N 3.33Å; R2-R5 VanDerWaalsContact O-N 3.14Å; R2-E6 PolarHBondContact O-N 3.45Å
3	L	95.8	Very high	95.7	Very high	130 Å²	130	115 Å²	115	68%	0.681	56%	0.564	S	S	*	*	H	α-helix	trans	-60.9	-39.5	-178.7	-72.4	173	0	0	0	112.9	M1 R5 E6 I7	M1-L3 PolarHBondContact O-N 3.47Å; L3-R5 VanDerWaalsContact C-N 3.31Å; L3-R5 PolarHBondContact O-N 3.06Å; L3-E6 PolarHBondContact O-N 3.09Å; L3-I7 VanDerWaalsContact O-CG1 3.28Å; L3-I7 WeakPolarHBondContact O-CG1 3.41Å; L3-I7 PolarHBondContact O-N 3.02Å
4	L	96.1	Very high	95.9	Very high	124 Å²	124	112.7 Å²	112.7	65%	0.649	55%	0.554	S	S	*	*	H	α-helix	trans	-64.2	-37.6	176.8	-71.2	171.9	0	0	0	111.9	M1 R2 G8	M1-L4 PolarHBondContact O-N 2.94Å; M1-L4 HydrophobicContact SD-CD1 4.16Å; R2-L4 VanDerWaalsContact C-N 3.33Å; R2-L4 PolarHBondContact O-N 3.44Å; L4-G8 PolarHBondContact O-N 3.14Å; L4-G8 VanDerWaalsContact O-N 3.09Å
5	R	96.6	Very high	96.1	Very high	161 Å²	161	110.3 Å²	110.3	61%	0.608	54%	0.544	S	S	*	.	H	α-helix	trans	-65.5	-46.7	175.3	-167.6	-175	74	-147.6	-0.9	111.3	M1 R2 L3 I7 G8 E9	M1-R5 PolarHBondContact O-N 3.39Å; R2-R5 WeakPolarHBondContact O-CB 3.28Å; R2-R5 PolarHBondContact O-N 3.33Å; R2-R5 VanDerWaalsContact O-N 3.14Å; L3-R5 VanDerWaalsContact C-N 3.31Å; L3-R5 PolarHBondContact O-N 3.06Å; R5-I7 VanDerWaalsContact C-N 3.33Å; R5-I7 PolarHBondContact O-N 2.89Å; R5-G8 WeakPolarHBondContact O-CA 3.45Å; R5-G8 PolarHBondContact O-N 3.2Å; R5-E9 WeakPolarHBondContact CD-OE1 3.3Å; R5-E9 HydrophobicContact CG-CG 4.48Å; R5-E9 WeakPolarHBondContact CG-OE1 3.34Å; R5-E9 IonicContact NE-OE1 3.57Å; R5-E9 PolarHBondContact NE-OE1 3.29Å; R5-E9 WeakPolarHBondContact O-CG 3.47Å; R5-E9 PolarHBondContact O-N 3.35Å
6	E	96.9	Very high	96.3	Very high	87 Å²	87	110 Å²	110	41%	0.407	54%	0.541	S	S	.	.	H	α-helix	trans	-62.1	-40.1	179.5	-170.4	168.8	-171.1	0	0	111.8	R2 L3 G8 E9 L10	R2-E6 PolarHBondContact O-N 3.45Å; L3-E6 PolarHBondContact O-N 3.09Å; E6-G8 VanDerWaalsContact C-N 3.33Å; E6-G8 PolarHBondContact O-N 2.94Å; E6-E9 PolarHBondContact O-N 3.44Å; E6-L10 WeakPolarHBondContact O-CB 3.25Å; E6-L10 VanDerWaalsContact O-CG 3.3Å; E6-L10 WeakPolarHBondContact O-CG 3.3Å; E6-L10 PolarHBondContact O-N 3.21Å
7	I	97.3	Very high	96.4	Very high	108 Å²	108	110.1 Å²	110.1	55%	0.554	54%	0.543	S	S	*	.	H	α-helix	trans	-61.8	-41.4	172.1	-69.5	166.6	0	0	0	111.2	L3 R5 L10 Q11	L3-I7 VanDerWaalsContact O-CG1 3.28Å; L3-I7 WeakPolarHBondContact O-CG1 3.41Å; L3-I7 PolarHBondContact O-N 3.02Å; R5-I7 VanDerWaalsContact C-N 3.33Å; R5-I7 PolarHBondContact O-N 2.89Å; I7-L10 PolarHBondContact O-N 3.41Å; I7-Q11 PolarHBondContact O-N 3.31Å
8	G	97.6	Very high	96.6	Very high	40 Å²	40	108.7 Å²	108.7	41%	0.412	54%	0.538	S	S	.	.	H	α-helix	trans	-63.2	-46	176.2	0	0	0	0	0	113	L4 R5 E6 L10 Q11 E12	L4-G8 PolarHBondContact O-N 3.14Å; L4-G8 VanDerWaalsContact O-N 3.09Å; R5-G8 WeakPolarHBondContact O-CA 3.45Å; R5-G8 PolarHBondContact O-N 3.2Å; E6-G8 VanDerWaalsContact C-N 3.33Å; E6-G8 PolarHBondContact O-N 2.94Å; G8-L10 VanDerWaalsContact C-N 3.32Å; G8-L10 PolarHBondContact O-N 2.95Å; G8-Q11 PolarHBondContact O-N 3.43Å; G8-E12 PolarHBondContact O-N 3.4Å
9	E	98	Very high	96.7	Very high	90 Å²	90	109.8 Å²	109.8	42%	0.421	54%	0.541	S	S	.	.	H	α-helix	trans	-61.7	-39.6	176.7	-70	166	-171.6	0	0	111.3	R5 E6 S13	R5-E9 WeakPolarHBondContact CD-OE1 3.3Å; R5-E9 HydrophobicContact CG-CG 4.48Å; R5-E9 WeakPolarHBondContact CG-OE1 3.34Å; R5-E9 IonicContact NE-OE1 3.57Å; R5-E9 PolarHBondContact NE-OE1 3.29Å; R5-E9 WeakPolarHBondContact O-CG 3.47Å; R5-E9 PolarHBondContact O-N 3.35Å; E6-E9 PolarHBondContact O-N 3.44Å; E9-S13 WeakPolarHBondContact O-CB 3.5Å; E9-S13 PolarHBondContact O-N 3Å; E9-S13 PolarHBondContact O-OG 2.93Å
10	L	98	Very high	96.8	Very high	101 Å²	101	110.6 Å²	110.6	53%	0.529	54%	0.543	S	S	.	.	H	α-helix	trans	-66.6	-41.6	174.9	-74.9	172.8	0	0	0	112.1	E6 I7 G8 S13 I14	E6-L10 WeakPolarHBondContact O-CB 3.25Å; E6-L10 VanDerWaalsContact O-CG 3.3Å; E6-L10 WeakPolarHBondContact O-CG 3.3Å; E6-L10 PolarHBondContact O-N 3.21Å; I7-L10 PolarHBondContact O-N 3.41Å; G8-L10 VanDerWaalsContact C-N 3.32Å; G8-L10 PolarHBondContact O-N 2.95Å; L10-S13 PolarHBondContact O-N 3.24Å; L10-I14 WeakPolarHBondContact O-CB 3.33Å; L10-I14 VanDerWaalsContact O-CG1 3.25Å; L10-I14 WeakPolarHBondContact O-CG1 3.43Å; L10-I14 PolarHBondContact O-N 2.89Å
11	Q	98.3	Very high	96.9	Very high	98 Å²	98	110.1 Å²	110.1	46%	0.458	54%	0.542	S	S	.	.	H	α-helix	trans	-62.6	-45.8	177.2	-174.7	61.3	54.5	0	0	111.1	I7 G8 S13 I14 D15	I7-Q11 PolarHBondContact O-N 3.31Å; G8-Q11 PolarHBondContact O-N 3.43Å; Q11-S13 VanDerWaalsContact C-N 3.31Å; Q11-S13 PolarHBondContact O-N 3.45Å; Q11-I14 PolarHBondContact O-N 2.94Å; Q11-D15 PolarHBondContact NE2-OD1 2.91Å; Q11-D15 VanDerWaalsContact O-CG 3.24Å; Q11-D15 PolarHBondContact O-N 3.19Å
12	E	98.4	Very high	97.8	Very high	117 Å²	117	104.4 Å²	104.4	55%	0.547	52%	0.516	S	S	.	.	H	α-helix	trans	-59.7	-43.4	175.8	-173.8	-178.5	179	0	0	111.5	G8 I14 D15 Q16	G8-E12 PolarHBondContact O-N 3.4Å; E12-I14 VanDerWaalsContact C-N 3.34Å; E12-I14 PolarHBondContact O-N 2.99Å; E12-D15 PolarHBondContact O-N 3.38Å; E12-Q16 VanDerWaalsContact O-CG 3.3Å; E12-Q16 WeakPolarHBondContact O-CG 3.43Å; E12-Q16 PolarHBondContact O-N 3Å; E12-Q16 PolarHBondContact OE1-NE2 2.95Å
13	S	98.4	Very high	98	Very high	56 Å²	56	100 Å²	100	39%	0.392	51%	0.506	S	S	.	.	H	α-helix	trans	-62.2	-41.5	177.1	-59	0	0	0	0	111.9	E9 L10 Q11 Q16 L17	E9-S13 WeakPolarHBondContact O-CB 3.5Å; E9-S13 PolarHBondContact O-N 3Å; E9-S13 PolarHBondContact O-OG 2.93Å; L10-S13 PolarHBondContact O-N 3.24Å; Q11-S13 VanDerWaalsContact C-N 3.31Å; Q11-S13 PolarHBondContact O-N 3.45Å; S13-Q16 PolarHBondContact O-N 2.8Å; S13-L17 WeakPolarHBondContact O-CB 3.41Å; S13-L17 VanDerWaalsContact O-CG 3.27Å; S13-L17 WeakPolarHBondContact O-CG 3.36Å; S13-L17 PolarHBondContact O-N 2.97Å
14	I	98.7	Very high	98.2	Very high	83 Å²	83	97.6 Å²	97.6	43%	0.426	50%	0.497	S	S	.	.	H	α-helix	trans	-62.6	-46.3	176.1	-72.3	165.1	0	0	0	110.3	L10 Q11 E12 Q16 L17 I18	L10-I14 WeakPolarHBondContact O-CB 3.33Å; L10-I14 VanDerWaalsContact O-CG1 3.25Å; L10-I14 WeakPolarHBondContact O-CG1 3.43Å; L10-I14 PolarHBondContact O-N 2.89Å; Q11-I14 PolarHBondContact O-N 2.94Å; E12-I14 VanDerWaalsContact C-N 3.34Å; E12-I14 PolarHBondContact O-N 2.99Å; I14-Q16 VanDerWaalsContact C-N 3.34Å; I14-Q16 PolarHBondContact O-N 3.28Å; I14-L17 PolarHBondContact O-N 3.36Å; I14-I18 HydrophobicContact CG2-CD1 3.75Å; I14-I18 HydrophobicContact CG2-CG1 4.42Å; I14-I18 WeakPolarHBondContact O-CG1 3.27Å; I14-I18 PolarHBondContact O-N 3.45Å
15	D	98.8	Very high	98.3	Very high	76 Å²	76	96.9 Å²	96.9	41%	0.406	49%	0.491	S	S	.	.	H	α-helix	trans	-62.8	-42	-179.3	-66.2	-20	0	0	0	111.2	Q11 E12 I18 Q19	Q11-D15 PolarHBondContact NE2-OD1 2.91Å; Q11-D15 VanDerWaalsContact O-CG 3.24Å; Q11-D15 PolarHBondContact O-N 3.19Å; E12-D15 PolarHBondContact O-N 3.38Å; D15-I18 PolarHBondContact O-N 3.41Å; D15-Q19 WeakPolarHBondContact O-CG 3.48Å; D15-Q19 PolarHBondContact O-N 3.38Å
16	Q	98.7	Very high	98.4	Very high	106 Å²	106	94 Å²	94	50%	0.495	49%	0.486	S	S	.	.	H	α-helix	trans	-62.3	-44.6	174.6	-71.7	176.5	9.3	0	0	112.1	E12 S13 I14 I18 Q19 Q20	E12-Q16 VanDerWaalsContact O-CG 3.3Å; E12-Q16 WeakPolarHBondContact O-CG 3.43Å; E12-Q16 PolarHBondContact O-N 3Å; E12-Q16 PolarHBondContact OE1-NE2 2.95Å; S13-Q16 PolarHBondContact O-N 2.8Å; I14-Q16 VanDerWaalsContact C-N 3.34Å; I14-Q16 PolarHBondContact O-N 3.28Å; Q16-I18 PolarHBondContact O-N 3.32Å; Q16-Q19 PolarHBondContact O-N 3.41Å; Q16-Q20 WeakPolarHBondContact O-CB 3.45Å; Q16-Q20 PolarHBondContact O-N 3.44Å
17	L	98.8	Very high	98.5	Very high	111 Å²	111	95.2 Å²	95.2	58%	0.581	49%	0.494	S	S	*	.	H	α-helix	trans	-64.3	-40	178.2	-74.5	171.2	0	0	0	112	S13 I14 Q20 L21	S13-L17 WeakPolarHBondContact O-CB 3.41Å; S13-L17 VanDerWaalsContact O-CG 3.27Å; S13-L17 WeakPolarHBondContact O-CG 3.36Å; S13-L17 PolarHBondContact O-N 2.97Å; I14-L17 PolarHBondContact O-N 3.36Å; L17-Q20 PolarHBondContact O-N 3.45Å; L17-L21 VanDerWaalsContact O-CB 3.32Å; L17-L21 WeakPolarHBondContact O-CB 3.36Å; L17-L21 PolarHBondContact O-N 3.39Å
18	I	98.8	Very high	98.6	Very high	86 Å²	86	95.3 Å²	95.3	44%	0.441	49%	0.492	S	S	.	.	H	α-helix	trans	-62.7	-45.2	175.7	-71	169.2	0	0	0	110.5	I14 D15 Q16 L21 N22	I14-I18 HydrophobicContact CG2-CD1 3.75Å; I14-I18 HydrophobicContact CG2-CG1 4.42Å; I14-I18 WeakPolarHBondContact O-CG1 3.27Å; I14-I18 PolarHBondContact O-N 3.45Å; D15-I18 PolarHBondContact O-N 3.41Å; Q16-I18 PolarHBondContact O-N 3.32Å; I18-L21 PolarHBondContact O-N 3.03Å; I18-N22 PolarHBondContact O-N 3.02Å; I18-N22 PolarHBondContact O-ND2 3.24Å
19	Q	98.7	Very high	98.6	Very high	130 Å²	130	98 Å²	98	61%	0.607	49%	0.494	S	S	*	.	H	α-helix	trans	-61.5	-45.5	176.3	-73.3	-175.9	6.4	0	0	111.8	D15 Q16 L21 N22 N23	D15-Q19 WeakPolarHBondContact O-CG 3.48Å; D15-Q19 PolarHBondContact O-N 3.38Å; Q16-Q19 PolarHBondContact O-N 3.41Å; Q19-L21 VanDerWaalsContact C-N 3.33Å; Q19-L21 PolarHBondContact O-N 2.92Å; Q19-N22 PolarHBondContact O-N 3.49Å; Q19-N23 WeakPolarHBondContact O-CB 3.45Å; Q19-N23 VanDerWaalsContact O-CG 3.25Å; Q19-N23 PolarHBondContact O-N 3.24Å; Q19-N23 PolarHBondContact O-ND2 2.98Å
20	Q	98.7	Very high	98.7	Very high	125 Å²	125	97.8 Å²	97.8	58%	0.584	50%	0.496	S	S	*	.	H	α-helix	trans	-63.6	-39.5	179	-172.3	176.3	6.6	0	0	112.1	Q16 L17 N23 T24	Q16-Q20 WeakPolarHBondContact O-CB 3.45Å; Q16-Q20 PolarHBondContact O-N 3.44Å; L17-Q20 PolarHBondContact O-N 3.45Å; Q20-N23 PolarHBondContact O-N 2.88Å; Q20-T24 WeakPolarHBondContact O-CB 3.34Å; Q20-T24 PolarHBondContact O-N 3.19Å; Q20-T24 PolarHBondContact O-OG1 3.48Å
21	L	98.8	Very high	98.7	Very high	100 Å²	100	98.3 Å²	98.3	52%	0.524	50%	0.498	S	S	.	.	H	α-helix	trans	-61.9	-50.1	176.1	179.2	62.3	0	0	0	110.9	L17 I18 Q19 N23 T24 Q25	L17-L21 VanDerWaalsContact O-CB 3.32Å; L17-L21 WeakPolarHBondContact O-CB 3.36Å; L17-L21 PolarHBondContact O-N 3.39Å; I18-L21 PolarHBondContact O-N 3.03Å; Q19-L21 VanDerWaalsContact C-N 3.33Å; Q19-L21 PolarHBondContact O-N 2.92Å; L21-N23 VanDerWaalsContact C-N 3.35Å; L21-N23 PolarHBondContact O-N 3.06Å; L21-T24 PolarHBondContact O-N 2.95Å; L21-Q25 HydrophobicContact CD1-CG 4.35Å; L21-Q25 WeakPolarHBondContact O-CG 3.32Å; L21-Q25 PolarHBondContact O-N 3.42Å
22	N	98.8	Very high	98.7	Very high	76 Å²	76	97.2 Å²	97.2	41%	0.406	50%	0.495	S	S	.	.	H	α-helix	trans	-59.2	-45.7	178.5	-72.6	-32.4	0	0	0	111.6	I18 Q19 T24 Q25 I26	I18-N22 PolarHBondContact O-N 3.02Å; I18-N22 PolarHBondContact O-ND2 3.24Å; Q19-N22 PolarHBondContact O-N 3.49Å; N22-T24 VanDerWaalsContact C-N 3.32Å; N22-T24 PolarHBondContact O-N 3Å; N22-Q25 PolarHBondContact O-N 3.49Å; N22-I26 WeakPolarHBondContact O-CG1 3.37Å; N22-I26 PolarHBondContact O-N 2.88Å
23	N	98.8	Very high	98.8	Very high	95 Å²	95	95.7 Å²	95.7	51%	0.508	49%	0.491	S	S	.	.	H	α-helix	trans	-60.6	-43	177.3	-71.6	-17.3	0	0	0	111.7	Q19 Q20 L21 Q25 I26 I27	Q19-N23 WeakPolarHBondContact O-CB 3.45Å; Q19-N23 VanDerWaalsContact O-CG 3.25Å; Q19-N23 PolarHBondContact O-N 3.24Å; Q19-N23 PolarHBondContact O-ND2 2.98Å; Q20-N23 PolarHBondContact O-N 2.88Å; L21-N23 VanDerWaalsContact C-N 3.35Å; L21-N23 PolarHBondContact O-N 3.06Å; N23-Q25 VanDerWaalsContact C-N 3.35Å; N23-I26 PolarHBondContact O-N 2.81Å; N23-I27 VanDerWaalsContact O-CG1 3.31Å; N23-I27 WeakPolarHBondContact O-CG1 3.31Å; N23-I27 PolarHBondContact O-N 3.41Å
24	T	98.6	Very high	98.8	Very high	80 Å²	80	96 Å²	96	49%	0.491	49%	0.488	S	S	.	.	H	α-helix	trans	-65.3	-39.6	178.1	-58.8	0	0	0	0	111.5	Q20 L21 N22 I27 H28	Q20-T24 WeakPolarHBondContact O-CB 3.34Å; Q20-T24 PolarHBondContact O-N 3.19Å; Q20-T24 PolarHBondContact O-OG1 3.48Å; L21-T24 PolarHBondContact O-N 2.95Å; N22-T24 VanDerWaalsContact C-N 3.32Å; N22-T24 PolarHBondContact O-N 3Å; T24-I27 PolarHBondContact O-N 3.34Å; T24-H28 VanDerWaalsContact O-CB 3.28Å; T24-H28 WeakPolarHBondContact O-CB 3.28Å; T24-H28 PolarHBondContact O-N 2.97Å
25	Q	98.8	Very high	98.8	Very high	108 Å²	108	97.6 Å²	97.6	51%	0.505	49%	0.492	S	S	.	.	H	α-helix	trans	-64.3	-41.7	176.8	-74.6	174.9	-39.1	0	0	112.1	L21 N22 N23 H28 Q29	L21-Q25 HydrophobicContact CD1-CG 4.35Å; L21-Q25 WeakPolarHBondContact O-CG 3.32Å; L21-Q25 PolarHBondContact O-N 3.42Å; N22-Q25 PolarHBondContact O-N 3.49Å; N23-Q25 VanDerWaalsContact C-N 3.35Å; Q25-H28 PolarHBondContact O-N 3.49Å; Q25-Q29 PolarHBondContact O-N 3.28Å
26	I	98.8	Very high	98.8	Very high	100 Å²	100	97.5 Å²	97.5	51%	0.513	50%	0.497	S	S	.	.	H	α-helix	trans	-60.9	-51.5	175.3	-68.1	165.6	0	0	0	110.4	N22 N23 H28 Q29 D30	N22-I26 WeakPolarHBondContact O-CG1 3.37Å; N22-I26 PolarHBondContact O-N 2.88Å; N23-I26 PolarHBondContact O-N 2.81Å; I26-H28 VanDerWaalsContact C-N 3.26Å; I26-H28 PolarHBondContact O-N 3.42Å; I26-Q29 PolarHBondContact O-N 3.46Å; I26-Q29 VanDerWaalsContact O-N 3.12Å; I26-D30 PolarHBondContact O-N 2.95Å
27	I	98.7	Very high	98.8	Very high	114 Å²	114	99.3 Å²	99.3	59%	0.585	50%	0.5	S	S	*	.	H	α-helix	trans	-59.5	-40.1	178.7	-67.1	165.6	0	0	0	110.9	N23 T24 D30 L31	N23-I27 VanDerWaalsContact O-CG1 3.31Å; N23-I27 WeakPolarHBondContact O-CG1 3.31Å; N23-I27 PolarHBondContact O-N 3.41Å; T24-I27 PolarHBondContact O-N 3.34Å; I27-D30 PolarHBondContact O-N 3.31Å; I27-L31 WeakPolarHBondContact O-CB 3.48Å; I27-L31 PolarHBondContact O-N 3.39Å
28	H	98.8	Very high	98.8	Very high	109 Å²	109	99.1 Å²	99.1	51%	0.505	50%	0.499	S	S	.	.	H	α-helix	trans	-62.9	-43.8	177.3	-173	70.5	0	0	0	111.7	T24 Q25 I26 D30 L31 L32	T24-H28 VanDerWaalsContact O-CB 3.28Å; T24-H28 WeakPolarHBondContact O-CB 3.28Å; T24-H28 PolarHBondContact O-N 2.97Å; Q25-H28 PolarHBondContact O-N 3.49Å; I26-H28 VanDerWaalsContact C-N 3.26Å; I26-H28 PolarHBondContact O-N 3.42Å; H28-D30 PolarHBondContact O-N 3.34Å; H28-L31 PolarHBondContact O-N 3.45Å; H28-L32 WeakPolarHBondContact O-CG 3.38Å; H28-L32 PolarHBondContact O-N 2.99Å
29	Q	98.9	Very high	98.8	Very high	98 Å²	98	100.1 Å²	100.1	46%	0.458	50%	0.502	S	S	.	.	H	α-helix	trans	-64.2	-40.8	177.7	-170.4	58.3	56.9	0	0	111.9	Q25 I26 L31 L32 N33	Q25-Q29 PolarHBondContact O-N 3.28Å; I26-Q29 PolarHBondContact O-N 3.46Å; I26-Q29 VanDerWaalsContact O-N 3.12Å; Q29-L31 VanDerWaalsContact C-N 3.31Å; Q29-L31 PolarHBondContact O-N 3Å; Q29-L32 PolarHBondContact O-N 3.12Å; Q29-N33 PolarHBondContact NE2-OD1 3.35Å; Q29-N33 VanDerWaalsContact O-CG 3.26Å; Q29-N33 PolarHBondContact O-N 2.96Å; Q29-N33 PolarHBondContact O-ND2 3.05Å
30	D	98.8	Very high	98.8	Very high	84 Å²	84	99.3 Å²	99.3	45%	0.449	50%	0.499	S	S	.	.	H	α-helix	trans	-62.8	-39.5	174.8	-74.6	-19	0	0	0	111.8	I26 I27 H28 N33 N34	I26-D30 PolarHBondContact O-N 2.95Å; I27-D30 PolarHBondContact O-N 3.31Å; H28-D30 PolarHBondContact O-N 3.34Å; D30-N33 PolarHBondContact O-N 2.89Å; D30-N34 WeakPolarHBondContact O-CB 3.35Å; D30-N34 VanDerWaalsContact O-CG 3.25Å; D30-N34 PolarHBondContact O-N 3.18Å; D30-N34 PolarHBondContact O-ND2 2.87Å
31	L	98.9	Very high	98.8	Very high	112 Å²	112	96.7 Å²	96.7	59%	0.586	49%	0.489	S	S	*	.	H	α-helix	trans	-64.7	-41	176	-173.8	62.9	0	0	0	111.8	I27 H28 Q29 N34 K35	I27-L31 WeakPolarHBondContact O-CB 3.48Å; I27-L31 PolarHBondContact O-N 3.39Å; H28-L31 PolarHBondContact O-N 3.45Å; Q29-L31 VanDerWaalsContact C-N 3.31Å; Q29-L31 PolarHBondContact O-N 3Å; L31-N34 PolarHBondContact O-N 3Å; L31-K35 WeakPolarHBondContact O-CB 3.44Å; L31-K35 PolarHBondContact O-N 3.24Å
32	L	98.9	Very high	98.8	Very high	75 Å²	75	97.4 Å²	97.4	39%	0.393	49%	0.493	S	S	.	.	H	α-helix	trans	-62.1	-43.4	174.8	-70.3	175.8	0	0	0	111.7	H28 Q29 K35 S36	H28-L32 WeakPolarHBondContact O-CG 3.38Å; H28-L32 PolarHBondContact O-N 2.99Å; Q29-L32 PolarHBondContact O-N 3.12Å; L32-K35 PolarHBondContact O-N 3.36Å; L32-S36 PolarHBondContact O-N 2.86Å
33	N	98.9	Very high	98.8	Very high	86 Å²	86	97.3 Å²	97.3	46%	0.46	50%	0.498	S	S	.	.	H	α-helix	trans	-63	-44.8	176.6	-67.9	-21.8	0	0	0	111.4	Q29 D30 S36 R37	Q29-N33 PolarHBondContact NE2-OD1 3.35Å; Q29-N33 VanDerWaalsContact O-CG 3.26Å; Q29-N33 PolarHBondContact O-N 2.96Å; Q29-N33 PolarHBondContact O-ND2 3.05Å; D30-N33 PolarHBondContact O-N 2.89Å; N33-S36 PolarHBondContact O-N 2.75Å; N33-R37 PolarHBondContact O-N 3.38Å
34	N	98.8	Very high	98.8	Very high	62 Å²	62	96.8 Å²	96.8	33%	0.332	49%	0.494	S	S	.	.	H	α-helix	trans	-63.3	-42	177	-74.6	-32.7	0	0	0	111.8	D30 L31 R37 L38	D30-N34 WeakPolarHBondContact O-CB 3.35Å; D30-N34 VanDerWaalsContact O-CG 3.25Å; D30-N34 PolarHBondContact O-N 3.18Å; D30-N34 PolarHBondContact O-ND2 2.87Å; L31-N34 PolarHBondContact O-N 3Å; N34-R37 PolarHBondContact O-N 3.05Å; N34-R37 PolarHBondContact OD1-NH1 3.4Å; N34-R37 PolarHBondContact OD1-NH2 3.39Å; N34-L38 WeakPolarHBondContact O-CG 2.85Å; N34-L38 PolarHBondContact O-N 2.96Å
35	K	98.8	Very high	98.8	Very high	117 Å²	117	99.4 Å²	99.4	51%	0.509	50%	0.499	S	S	.	.	H	α-helix	trans	-58.6	-51	175.2	176.2	-178.2	168.9	-179.9	0	110.9	L31 L32 R37 L38 E39	L31-K35 WeakPolarHBondContact O-CB 3.44Å; L31-K35 PolarHBondContact O-N 3.24Å; L32-K35 PolarHBondContact O-N 3.36Å; K35-R37 VanDerWaalsContact C-N 3.3Å; K35-R37 PolarHBondContact O-N 3.3Å; K35-L38 PolarHBondContact O-N 3.42Å; K35-L38 VanDerWaalsContact O-N 3.15Å; K35-E39 WeakPolarHBondContact CE-OE1 3.33Å; K35-E39 HydrophobicContact CG-CG 4.41Å; K35-E39 IonicContact NZ-OE1 2.99Å; K35-E39 WeakPolarHBondContact O-CG 3.41Å; K35-E39 PolarHBondContact O-N 2.91Å
36	S	98.8	Very high	98.8	Very high	73 Å²	73	98.3 Å²	98.3	51%	0.51	50%	0.5	S	S	.	.	H	α-helix	trans	-59.3	-41.3	-180	-178.7	0	0	0	0	112.1	L32 N33 E39 M40	L32-S36 PolarHBondContact O-N 2.86Å; N33-S36 PolarHBondContact O-N 2.75Å; S36-E39 PolarHBondContact O-N 3.33Å; S36-M40 PolarHBondContact O-N 3.35Å
37	R	98.8	Very high	98.8	Very high	144 Å²	144	97.9 Å²	97.9	54%	0.543	50%	0.498	S	S	.	.	H	α-helix	trans	-61.9	-45.5	175.1	-173.5	174.8	66.7	-128.8	-6	112.1	N33 N34 K35 M40 D41	N33-R37 PolarHBondContact O-N 3.38Å; N34-R37 PolarHBondContact O-N 3.05Å; N34-R37 PolarHBondContact OD1-NH1 3.4Å; N34-R37 PolarHBondContact OD1-NH2 3.39Å; K35-R37 VanDerWaalsContact C-N 3.3Å; K35-R37 PolarHBondContact O-N 3.3Å; R37-M40 PolarHBondContact O-N 3.38Å; R37-D41 PolarHBondContact O-N 2.78Å
38	L	98.9	Very high	98.8	Very high	108 Å²	108	95.4 Å²	95.4	57%	0.565	49%	0.491	S	S	*	.	H	α-helix	trans	-65.7	-37.8	178.8	-71.6	172	0	0	0	112.5	N34 K35 M40 D41 L42	N34-L38 WeakPolarHBondContact O-CG 2.85Å; N34-L38 PolarHBondContact O-N 2.96Å; K35-L38 PolarHBondContact O-N 3.42Å; K35-L38 VanDerWaalsContact O-N 3.15Å; L38-M40 VanDerWaalsContact C-N 3.35Å; L38-D41 PolarHBondContact O-N 2.87Å; L38-L42 VanDerWaalsContact O-CB 3.29Å; L38-L42 WeakPolarHBondContact O-CB 3.41Å; L38-L42 PolarHBondContact O-N 2.92Å
39	E	98.9	Very high	98.7	Very high	107 Å²	107	94.5 Å²	94.5	50%	0.5	49%	0.489	S	S	.	.	H	α-helix	trans	-63.2	-41.3	174.7	-73.6	173.6	159.5	0	0	111.5	K35 S36 L42 S43	K35-E39 WeakPolarHBondContact CE-OE1 3.33Å; K35-E39 HydrophobicContact CG-CG 4.41Å; K35-E39 IonicContact NZ-OE1 2.99Å; K35-E39 WeakPolarHBondContact O-CG 3.41Å; K35-E39 PolarHBondContact O-N 2.91Å; S36-E39 PolarHBondContact O-N 3.33Å; E39-L42 PolarHBondContact O-N 3.15Å; E39-S43 WeakPolarHBondContact O-CB 3.4Å; E39-S43 PolarHBondContact O-N 2.99Å
40	M	98.8	Very high	98.7	Very high	113 Å²	113	96.3 Å²	96.3	56%	0.557	49%	0.493	S	S	*	.	H	α-helix	trans	-63.6	-48.1	174.4	-176.1	61.6	177.2	0	0	111.8	S36 R37 L38 L42 S43 I44	S36-M40 PolarHBondContact O-N 3.35Å; R37-M40 PolarHBondContact O-N 3.38Å; L38-M40 VanDerWaalsContact C-N 3.35Å; M40-L42 VanDerWaalsContact C-N 3.28Å; M40-L42 PolarHBondContact O-N 2.99Å; M40-S43 WeakPolarHBondContact O-CB 3.39Å; M40-S43 PolarHBondContact O-N 3.45Å; M40-S43 VanDerWaalsContact O-N 3.15Å; M40-I44 HydrophobicContact CE-CD1 4.01Å; M40-I44 HydrophobicContact CE-CG1 4.2Å; M40-I44 HydrophobicContact CG-CD1 4.15Å; M40-I44 WeakPolarHBondContact O-CG1 3.29Å; M40-I44 PolarHBondContact O-N 3.15Å
41	D	98.9	Very high	98.6	Very high	69 Å²	69	95.3 Å²	95.3	37%	0.369	49%	0.487	S	S	.	.	H	α-helix	trans	-59.7	-40.7	178.2	-76	-14.6	0	0	0	111.7	R37 L38 I44 K45	R37-D41 PolarHBondContact O-N 2.78Å; L38-D41 PolarHBondContact O-N 2.87Å; D41-I44 PolarHBondContact O-N 3.35Å; D41-K45 WeakPolarHBondContact O-CB 3.39Å; D41-K45 VanDerWaalsContact O-CG 3.25Å; D41-K45 WeakPolarHBondContact O-CG 3.5Å; D41-K45 PolarHBondContact O-N 3.3Å
42	L	98.8	Very high	98.5	Very high	116 Å²	116	92.7 Å²	92.7	61%	0.607	47%	0.474	S	S	*	.	H	α-helix	trans	-65.3	-40.1	177.2	-170.3	131.5	0	0	0	111.6	L38 E39 M40 K45 T46	L38-L42 VanDerWaalsContact O-CB 3.29Å; L38-L42 WeakPolarHBondContact O-CB 3.41Å; L38-L42 PolarHBondContact O-N 2.92Å; E39-L42 PolarHBondContact O-N 3.15Å; M40-L42 VanDerWaalsContact C-N 3.28Å; M40-L42 PolarHBondContact O-N 2.99Å; L42-K45 PolarHBondContact O-N 3.5Å; L42-T46 VanDerWaalsContact O-CB 3.29Å; L42-T46 WeakPolarHBondContact O-CB 3.5Å; L42-T46 PolarHBondContact O-N 2.96Å; L42-T46 PolarHBondContact O-OG1 3.45Å
43	S	98.8	Very high	98.3	Very high	74 Å²	74	97.2 Å²	97.2	52%	0.517	49%	0.485	S	S	.	.	H	α-helix	trans	-61.2	-48.7	173.9	-177.1	0	0	0	0	111.7	E39 M40 K45 T46 N47	E39-S43 WeakPolarHBondContact O-CB 3.4Å; E39-S43 PolarHBondContact O-N 2.99Å; M40-S43 WeakPolarHBondContact O-CB 3.39Å; M40-S43 PolarHBondContact O-N 3.45Å; M40-S43 VanDerWaalsContact O-N 3.15Å; S43-K45 PolarHBondContact O-N 3.41Å; S43-T46 PolarHBondContact O-N 2.95Å; S43-N47 WeakPolarHBondContact O-CB 3.33Å; S43-N47 PolarHBondContact O-N 3.38Å
44	I	98.8	Very high	98.2	Very high	83 Å²	83	99.1 Å²	99.1	43%	0.426	49%	0.492	S	S	.	.	H	α-helix	trans	-59.2	-46.9	177.1	-66.6	168.4	0	0	0	110.9	M40 D41 N47 S48	M40-I44 HydrophobicContact CE-CD1 4.01Å; M40-I44 HydrophobicContact CE-CG1 4.2Å; M40-I44 HydrophobicContact CG-CD1 4.15Å; M40-I44 WeakPolarHBondContact O-CG1 3.29Å; M40-I44 PolarHBondContact O-N 3.15Å; D41-I44 PolarHBondContact O-N 3.35Å; I44-N47 PolarHBondContact O-N 3.3Å; I44-S48 WeakPolarHBondContact O-CB 3.25Å; I44-S48 PolarHBondContact O-N 2.92Å; I44-S48 PolarHBondContact O-OG 2.91Å
45	K	98.7	Very high	97.9	Very high	136 Å²	136	103 Å²	103	59%	0.591	51%	0.505	S	S	*	.	H	α-helix	trans	-64	-42.9	179.6	-74	172	-171	-68.3	0	111.6	D41 L42 S43 N47 S48 I49	D41-K45 WeakPolarHBondContact O-CB 3.39Å; D41-K45 VanDerWaalsContact O-CG 3.25Å; D41-K45 WeakPolarHBondContact O-CG 3.5Å; D41-K45 PolarHBondContact O-N 3.3Å; L42-K45 PolarHBondContact O-N 3.5Å; S43-K45 PolarHBondContact O-N 3.41Å; K45-N47 VanDerWaalsContact C-N 3.34Å; K45-N47 PolarHBondContact O-N 3.43Å; K45-S48 PolarHBondContact O-N 2.91Å; K45-I49 VanDerWaalsContact O-CG1 3.31Å; K45-I49 WeakPolarHBondContact O-CG1 3.33Å; K45-I49 PolarHBondContact O-N 2.88Å
46	T	98.7	Very high	97.6	Very high	84 Å²	84	99.7 Å²	99.7	52%	0.515	50%	0.496	S	S	.	.	H	α-helix	trans	-59.7	-47.1	177.2	-60.3	0	0	0	0	110.6	L42 S43 S48 I49 Y50	L42-T46 VanDerWaalsContact O-CB 3.29Å; L42-T46 WeakPolarHBondContact O-CB 3.5Å; L42-T46 PolarHBondContact O-N 2.96Å; L42-T46 PolarHBondContact O-OG1 3.45Å; S43-T46 PolarHBondContact O-N 2.95Å; T46-S48 PolarHBondContact O-N 3.49Å; T46-I49 PolarHBondContact O-N 2.73Å; T46-Y50 WeakPolarHBondContact O-CB 3.44Å; T46-Y50 PolarHBondContact O-N 3.48Å
47	N	98.4	Very high	97.2	Very high	91 Å²	91	99.4 Å²	99.4	49%	0.487	49%	0.489	S	S	.	.	H	α-helix	trans	-63	-41.9	176.1	-175.6	49.5	0	0	0	112.3	S43 I44 K45 I49 Y50 I51	S43-N47 WeakPolarHBondContact O-CB 3.33Å; S43-N47 PolarHBondContact O-N 3.38Å; I44-N47 PolarHBondContact O-N 3.3Å; K45-N47 VanDerWaalsContact C-N 3.34Å; K45-N47 PolarHBondContact O-N 3.43Å; N47-I49 PolarHBondContact O-N 3.42Å; N47-Y50 PolarHBondContact O-N 2.89Å; N47-I51 WeakPolarHBondContact O-CG1 3.4Å; N47-I51 PolarHBondContact O-N 3.45Å
48	S	98.2	Very high	96.5	Very high	63 Å²	63	94.7 Å²	94.7	44%	0.441	49%	0.485	S	S	.	.	H	α-helix	trans	-63	-43.4	178.6	-57.9	0	0	0	0	111.9	I44 K45 T46 I51 D52	I44-S48 WeakPolarHBondContact O-CB 3.25Å; I44-S48 PolarHBondContact O-N 2.92Å; I44-S48 PolarHBondContact O-OG 2.91Å; K45-S48 PolarHBondContact O-N 2.91Å; T46-S48 PolarHBondContact O-N 3.49Å; S48-I51 PolarHBondContact O-N 3.24Å; S48-D52 WeakPolarHBondContact O-CB 3.29Å; S48-D52 PolarHBondContact O-N 2.97Å
49	I	97.7	Very high	95.9	Very high	90 Å²	90	95.3 Å²	95.3	46%	0.462	49%	0.489	S	S	.	.	H	α-helix	trans	-65.4	-40.9	176.5	-69.7	167.4	0	0	0	110.8	K45 T46 N47 D52 R53	K45-I49 VanDerWaalsContact O-CG1 3.31Å; K45-I49 WeakPolarHBondContact O-CG1 3.33Å; K45-I49 PolarHBondContact O-N 2.88Å; T46-I49 PolarHBondContact O-N 2.73Å; N47-I49 PolarHBondContact O-N 3.42Å; I49-D52 PolarHBondContact O-N 3.37Å; I49-R53 WeakPolarHBondContact O-CB 3.31Å; I49-R53 WeakPolarHBondContact O-CG 3.32Å; I49-R53 PolarHBondContact O-N 3.42Å
50	Y	98	Very high	95.3	Very high	136 Å²	136	96.4 Å²	96.4	53%	0.533	49%	0.488	S	S	.	.	H	α-helix	trans	-60.8	-50.6	176	176	-101.9	0	0	0	111.1	T46 N47 D52 R53 E54	T46-Y50 WeakPolarHBondContact O-CB 3.44Å; T46-Y50 PolarHBondContact O-N 3.48Å; N47-Y50 PolarHBondContact O-N 2.89Å; Y50-D52 VanDerWaalsContact C-N 3.29Å; Y50-D52 PolarHBondContact O-N 2.87Å; Y50-R53 PolarHBondContact O-N 3.22Å; Y50-E54 HydrophobicContact CD1-CG 4.48Å; Y50-E54 HydrophobicContact CD2-CG 3.88Å; Y50-E54 HydrophobicContact CE1-CG 4.13Å; Y50-E54 HydrophobicContact CE2-CG 3.46Å; Y50-E54 VanDerWaalsContact CE2-CG 3.46Å; Y50-E54 HydrophobicContact CG-CG 4.37Å; Y50-E54 WeakPolarHBondContact O-CG 3.48Å; Y50-E54 PolarHBondContact O-N 3.13Å
51	I	97.7	Very high	94.6	Very high	62 Å²	62	99 Å²	99	32%	0.318	50%	0.496	S	S	.	.	H	α-helix	trans	-57.2	-45.5	175.9	-70.5	167.2	0	0	0	110.8	N47 S48 R53 E54 K55 C56	N47-I51 WeakPolarHBondContact O-CG1 3.4Å; N47-I51 PolarHBondContact O-N 3.45Å; S48-I51 PolarHBondContact O-N 3.24Å; I51-R53 VanDerWaalsContact C-N 3.33Å; I51-R53 PolarHBondContact O-N 3.44Å; I51-E54 PolarHBondContact O-N 2.75Å; I51-K55 HydrophobicContact CG2-CD 4.4Å; I51-K55 WeakPolarHBondContact O-CA 3.45Å; I51-K55 WeakPolarHBondContact O-CB 3.37Å; I51-K55 PolarHBondContact O-N 3.36Å; I51-C56 PolarHBondContact O-N 2.95Å
52	D	96.4	Very high	93.7	Very high	58 Å²	58	99 Å²	99	31%	0.31	50%	0.499	S	S	.	.	I	π-helix	trans	-60.7	-43.1	-179.6	-177	57.5	0	0	0	112	S48 I49 Y50 C56 L57 R60	S48-D52 WeakPolarHBondContact O-CB 3.29Å; S48-D52 PolarHBondContact O-N 2.97Å; I49-D52 PolarHBondContact O-N 3.37Å; Y50-D52 VanDerWaalsContact C-N 3.29Å; Y50-D52 PolarHBondContact O-N 2.87Å; D52-C56 CarbonylContact O-C 3.5Å; D52-C56 PolarHBondContact O-N 2.94Å; D52-C56 VanDerWaalsContact O-N 3.13Å; D52-C56 WeakPolarHBondContact OD1-CB 3.48Å; D52-L57 WeakPolarHBondContact O-CB 3.39Å; D52-L57 PolarHBondContact O-N 3.47Å; D52-R60 IonicContact OD1-CZ 3.78Å; D52-R60 IonicContact OD1-NE 2.63Å; D52-R60 IonicContact OD1-NH1 3.93Å; D52-R60 IonicContact OD1-NH2 3.56Å; D52-R60 PolarHBondContact OD1-NH2 3.35Å; D52-R60 IonicContact OD2-CZ 3.18Å; D52-R60 IonicContact OD2-NH1 3.91Å; D52-R60 IonicContact OD2-NH2 2.69Å; D52-R60 PolarHBondContact OD2-NH2 3.24Å
53	R	95.5	Very high	92.7	Very high	169 Å²	169	101.2 Å²	101.2	64%	0.638	50%	0.504	S	S	*	.	I	π-helix	trans	-67.3	-48.2	178	-75.6	178.5	176.5	-177.3	-0.4	112.7	I49 Y50 I51	I49-R53 WeakPolarHBondContact O-CB 3.31Å; I49-R53 WeakPolarHBondContact O-CG 3.32Å; I49-R53 PolarHBondContact O-N 3.42Å; Y50-R53 PolarHBondContact O-N 3.22Å; I51-R53 VanDerWaalsContact C-N 3.33Å; I51-R53 PolarHBondContact O-N 3.44Å
54	E	95.7	Very high	91.8	Very high	127 Å²	127	99.5 Å²	99.5	59%	0.593	49%	0.491	S	S	*	.	I	π-helix	trans	-80.4	-31	-172	-62	-56.8	99.3	0	0	113.1	Y50 I51	Y50-E54 HydrophobicContact CD1-CG 4.48Å; Y50-E54 HydrophobicContact CD2-CG 3.88Å; Y50-E54 HydrophobicContact CE1-CG 4.13Å; Y50-E54 HydrophobicContact CE2-CG 3.46Å; Y50-E54 VanDerWaalsContact CE2-CG 3.46Å; Y50-E54 HydrophobicContact CG-CG 4.37Å; Y50-E54 WeakPolarHBondContact O-CG 3.48Å; Y50-E54 PolarHBondContact O-N 3.13Å; I51-E54 PolarHBondContact O-N 2.75Å
55	K	91.8	Very high	90.4	Very high	142 Å²	142	102.9 Å²	102.9	62%	0.617	51%	0.507	S	S	*	.	I	π-helix	trans	-117.8	-37.4	-169.8	-56.6	-174.7	179.5	178.6	0	113.7	I51 L59	I51-K55 HydrophobicContact CG2-CD 4.4Å; I51-K55 WeakPolarHBondContact O-CA 3.45Å; I51-K55 WeakPolarHBondContact O-CB 3.37Å; I51-K55 PolarHBondContact O-N 3.36Å; K55-L59 WeakPolarHBondContact O-CD1 3.49Å
56	C	93.1	Very high	89	Confident	48 Å²	48	100 Å²	100	32%	0.324	50%	0.498	S	S	.	.	I	π-helix	trans	-99.4	-32.4	-170.1	-56.2	0	0	0	0	113.6	I51 D52 G58 L59 R60	I51-C56 PolarHBondContact O-N 2.95Å; D52-C56 CarbonylContact O-C 3.5Å; D52-C56 PolarHBondContact O-N 2.94Å; D52-C56 VanDerWaalsContact O-N 3.13Å; D52-C56 WeakPolarHBondContact OD1-CB 3.48Å; C56-G58 PolarHBondContact O-N 2.69Å; C56-L59 PolarHBondContact O-N 3.01Å; C56-R60 PolarHBondContact O-N 3.38Å
57	L	89.7	Confident	87.4	Confident	68 Å²	68	100.8 Å²	100.8	36%	0.356	51%	0.505	S	S	.	.	H	α-helix	trans	-62.8	-41.4	-172.5	-176.8	64.5	0	0	0	112.1	D52 R60 K61	D52-L57 WeakPolarHBondContact O-CB 3.39Å; D52-L57 PolarHBondContact O-N 3.47Å; L57-R60 PolarHBondContact O-N 3.39Å; L57-K61 WeakPolarHBondContact O-CG 3.48Å; L57-K61 PolarHBondContact O-N 3.11Å; L57-K61 VanDerWaalsContact O-N 3.1Å
58	G	85.6	Confident	86	Confident	45 Å²	45	100.9 Å²	100.9	46%	0.464	51%	0.512	S	S	.	.	H	α-helix	trans	-61.1	-47.9	175.3	0	0	0	0	0	112.2	C56 R60 K61 T62	C56-G58 PolarHBondContact O-N 2.69Å; G58-R60 VanDerWaalsContact C-N 3.31Å; G58-R60 PolarHBondContact O-N 2.95Å; G58-K61 WeakPolarHBondContact O-CB 3.36Å; G58-K61 PolarHBondContact O-N 3.26Å; G58-K61 VanDerWaalsContact O-N 3.16Å; G58-T62 PolarHBondContact O-N 2.63Å; G58-T62 PolarHBondContact O-OG1 3.46Å
59	L	86.6	Confident	84.4	Confident	121 Å²	121	104.5 Å²	104.5	63%	0.634	53%	0.526	S	S	*	.	H	α-helix	trans	-61.3	-38.4	177.8	-62.2	175.1	0	0	0	112.2	K55 C56 T62 F63	K55-L59 WeakPolarHBondContact O-CD1 3.49Å; C56-L59 PolarHBondContact O-N 3.01Å; L59-T62 CarbonylContact O-C 3.55Å; L59-T62 PolarHBondContact O-N 3.04Å; L59-T62 PolarHBondContact O-OG1 3.16Å; L59-F63 WeakPolarHBondContact O-CB 3.23Å; L59-F63 PolarHBondContact O-N 3.1Å; L59-F63 VanDerWaalsContact O-N 3.11Å
60	R	86.2	Confident	82.9	Confident	130 Å²	130	105.7 Å²	105.7	49%	0.491	53%	0.532	S	S	.	.	H	α-helix	trans	-66	-37.1	175.9	-78.9	-175.3	-68.4	155.1	1.7	112.7	D52 C56 L57 G58 T62 F63	D52-R60 IonicContact OD1-CZ 3.78Å; D52-R60 IonicContact OD1-NE 2.63Å; D52-R60 IonicContact OD1-NH1 3.93Å; D52-R60 IonicContact OD1-NH2 3.56Å; D52-R60 PolarHBondContact OD1-NH2 3.35Å; D52-R60 IonicContact OD2-CZ 3.18Å; D52-R60 IonicContact OD2-NH1 3.91Å; D52-R60 IonicContact OD2-NH2 2.69Å; D52-R60 PolarHBondContact OD2-NH2 3.24Å; C56-R60 PolarHBondContact O-N 3.38Å; L57-R60 PolarHBondContact O-N 3.39Å; G58-R60 VanDerWaalsContact C-N 3.31Å; G58-R60 PolarHBondContact O-N 2.95Å; R60-T62 PolarHBondContact O-N 3.33Å; R60-F63 WeakPolarHBondContact O-CB 3.48Å; R60-F63 PolarHBondContact O-N 3.45Å
61	K	83.4	Confident	81.2	Confident	166 Å²	166	102.2 Å²	102.2	72%	0.722	53%	0.531	S	S	*	.	H	α-helix	trans	-64.8	-28.5	177.4	-75.5	177.6	177.3	-177.6	0	112.7	L57 G58	L57-K61 WeakPolarHBondContact O-CG 3.48Å; L57-K61 PolarHBondContact O-N 3.11Å; L57-K61 VanDerWaalsContact O-N 3.1Å; G58-K61 WeakPolarHBondContact O-CB 3.36Å; G58-K61 PolarHBondContact O-N 3.26Å; G58-K61 VanDerWaalsContact O-N 3.16Å
62	T	80.7	Confident	79.6	Confident	69 Å²	69	105.2 Å²	105.2	42%	0.423	56%	0.555	S	S	.	*	T	Hydrogen-bonded Turn	trans	-102.3	11.5	178.3	61.7	0	0	0	0	112	G58 L59 R60 P64 M65	G58-T62 PolarHBondContact O-N 2.63Å; G58-T62 PolarHBondContact O-OG1 3.46Å; L59-T62 CarbonylContact O-C 3.55Å; L59-T62 PolarHBondContact O-N 3.04Å; L59-T62 PolarHBondContact O-OG1 3.16Å; R60-T62 PolarHBondContact O-N 3.33Å; T62-P64 CarbonylContact O-C 3.2Å; T62-M65 WeakPolarHBondContact CB-SD 3.22Å; T62-M65 HydrophobicContact CG2-SD 4.39Å; T62-M65 VanDerWaalsContact O-CA 3.23Å; T62-M65 WeakPolarHBondContact O-CA 3.43Å; T62-M65 PolarHBondContact O-N 3.4Å; T62-M65 PolarHBondContact OG1-SD 3.15Å
63	F	76.2	Confident	78.1	Confident	163 Å²	163	112.8 Å²	112.8	72%	0.715	60%	0.603	S	S	*	*			trans	-85.6	137.5	179.6	-172.4	-89.6	0	0	0	111.5	L59 R60	L59-F63 WeakPolarHBondContact O-CB 3.23Å; L59-F63 PolarHBondContact O-N 3.1Å; L59-F63 VanDerWaalsContact O-N 3.11Å; R60-F63 WeakPolarHBondContact O-CB 3.48Å; R60-F63 PolarHBondContact O-N 3.45Å
64	P	80.5	Confident	77.2	Confident	39 Å²	39	110 Å²	110	25%	0.253	60%	0.601	S	S	.	*	S	Bend	cis	-81.4	133.7	-9.8	29.7	-27	0	0	0	110.5	T62 N66 I70	T62-P64 CarbonylContact O-C 3.2Å; P64-N66 PolarHBondContact O-N 3.05Å; P64-I70 HydrophobicContact CB-CD1 4.49Å; P64-I70 HydrophobicContact CB-CG1 4.38Å; P64-I70 HydrophobicContact CG-CD1 3.1Å; P64-I70 HydrophobicContact CG-CG1 3.3Å
65	M	69.3	Low	76.3	Confident	154 Å²	154	109.1 Å²	109.1	76%	0.759	60%	0.601	S	S	*	*	S	Bend	trans	-64.5	-11.7	-176.3	-155.8	83.7	171.3	0	0	112.7	T62	T62-M65 WeakPolarHBondContact CB-SD 3.22Å; T62-M65 HydrophobicContact CG2-SD 4.39Å; T62-M65 VanDerWaalsContact O-CA 3.23Å; T62-M65 WeakPolarHBondContact O-CA 3.43Å; T62-M65 PolarHBondContact O-N 3.4Å; T62-M65 PolarHBondContact OG1-SD 3.15Å
66	N	69.5	Low	75.4	Confident	76 Å²	76	107.2 Å²	107.2	41%	0.406	60%	0.6	S	S	.	*			trans	-128.6	107.4	179.5	-166.8	-14.6	0	0	0	110.3	P64 S68 L69	P64-N66 PolarHBondContact O-N 3.05Å; N66-S68 PolarHBondContact O-N 2.86Å; N66-S68 VanDerWaalsContact O-N 3.1Å; N66-S68 VanDerWaalsContact OD1-CB 3.22Å; N66-S68 WeakPolarHBondContact OD1-CB 3.44Å; N66-S68 PolarHBondContact OD1-N 3.11Å; N66-S68 VanDerWaalsContact OD1-N 3.11Å; N66-S68 PolarHBondContact OD1-OG 3.1Å; N66-L69 HydrophobicContact CB-CD1 3.94Å; N66-L69 HydrophobicContact CB-CG 4.17Å; N66-L69 WeakPolarHBondContact O-CB 3.45Å; N66-L69 PolarHBondContact O-N 3.18Å
67	P	64.6	Low	74.4	Confident	100 Å²	100	110.7 Å²	110.7	65%	0.649	62%	0.617	S	S	*	*	G	3₁₀ helix	trans	-54.4	-27.7	176.4	-23.5	32.1	0	0	0	113.3	L69 I70	P67-L69 PolarHBondContact O-N 3.12Å; P67-L69 VanDerWaalsContact O-N 3.15Å; P67-I70 PolarHBondContact O-N 3.2Å; P67-I70 VanDerWaalsContact O-N 3.12Å
68	S	69.2	Low	73.4	Confident	93 Å²	93	113.4 Å²	113.4	65%	0.65	63%	0.633	S	S	*	*	G	3₁₀ helix	trans	-64.6	-15.5	178.8	-41.4	0	0	0	0	113.9	N66	N66-S68 PolarHBondContact O-N 2.86Å; N66-S68 VanDerWaalsContact O-N 3.1Å; N66-S68 VanDerWaalsContact OD1-CB 3.22Å; N66-S68 WeakPolarHBondContact OD1-CB 3.44Å; N66-S68 PolarHBondContact OD1-N 3.11Å; N66-S68 VanDerWaalsContact OD1-N 3.11Å; N66-S68 PolarHBondContact OD1-OG 3.1Å
69	L	65	Low	72.6	Confident	138 Å²	138	117.9 Å²	117.9	72%	0.723	64%	0.644	S	S	*	*	G	3₁₀ helix	trans	-86.8	-9.5	177.1	-67.1	170.3	0	0	0	113.4	N66 P67	N66-L69 HydrophobicContact CB-CD1 3.94Å; N66-L69 HydrophobicContact CB-CG 4.17Å; N66-L69 WeakPolarHBondContact O-CB 3.45Å; N66-L69 PolarHBondContact O-N 3.18Å; P67-L69 PolarHBondContact O-N 3.12Å; P67-L69 VanDerWaalsContact O-N 3.15Å
70	I	65.8	Low	71.6	Confident	115 Å²	115	117.7 Å²	117.7	59%	0.59	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.4	-17.2	-179.7	-30	173.3	0	0	0	112.2	P64 P67	P64-I70 HydrophobicContact CB-CD1 4.49Å; P64-I70 HydrophobicContact CB-CG1 4.38Å; P64-I70 HydrophobicContact CG-CD1 3.1Å; P64-I70 HydrophobicContact CG-CG1 3.3Å; P67-I70 PolarHBondContact O-N 3.2Å; P67-I70 VanDerWaalsContact O-N 3.12Å
71	A	62.2	Low	70.5	Confident	63 Å²	63	116.8 Å²	116.8	52%	0.521	66%	0.657	S	S	.	*	S	Bend	trans	-74.4	131.5	177.8	0	0	0	0	0	109.8	V73	A71-V73 PolarHBondContact O-N 3.36Å
72	P	63.8	Low	69.4	Low	125 Å²	125	112.7 Å²	112.7	81%	0.812	65%	0.651	S	S	*	*			trans	-64.5	134.4	168.6	14	-6.1	0	0	0	108.6
73	V	66.1	Low	68.4	Low	217 Å²	217	116.6 Å²	116.6	100%	1.315	67%	0.672	S	S	*	*			trans	-60.5	0	170.8	-172.4	0	0	0	0	109.9	A71	A71-V73 PolarHBondContact O-N 3.36Å

Retrieved 73 of 73 residues in 37.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).