A0A5K4F2L0_SCHMA Loading...

LSDAT_euk domain-containing protein

AlphaFold DB (A0A5K4F298), UniProt , Accession A0A5K4F2L0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 141 aa.

						>A0A5K4F2L0_SCHMA|A0A5K4F2L0
MTEQIPFQRTSTLKHRISRTGSVGQDNNNNITGSINISSGINTGIQQQSSIRRASVMQKYMGEIEFTGLNQTARFCKLNSETPDSILRDILKRKWGLKPPTLIITVFGTDFEKKRKLKMIFKKGLWKAAESGSSALQVIQC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.9	Very low	50.5	Low	243 Å²	243	166.8 Å²	166.8	100%	1.197	84%	0.843	S	S	*	*				0	103	0	-65.2	178.6	179.8	0	0	106.2
2	T	55.5	Low	50.9	Low	146 Å²	146	162.3 Å²	162.3	90%	0.896	83%	0.83	S	S	*	*			trans	-140.8	99.4	-174	9.3	0	0	0	0	106.9
3	E	46.2	Very low	50.8	Low	189 Å²	189	163.1 Å²	163.1	88%	0.883	84%	0.836	S	S	*	*			trans	-86.3	137.3	163	-84.4	-149.3	106.5	0	0	108.8
4	Q	44.9	Very low	51.1	Low	173 Å²	173	165.1 Å²	165.1	81%	0.808	84%	0.835	S	S	*	*				-172.5	113	128.3	-104.1	-174	1.4	0	0	112.7
5	I	59.2	Low	50.9	Low	129 Å²	129	165.4 Å²	165.4	66%	0.662	83%	0.832	S	S	*	*			trans	68.5	108.7	138.3	-47.7	151.3	0	0	0	118.7
6	P	54.1	Low	50.3	Low	111 Å²	111	169.4 Å²	169.4	72%	0.721	83%	0.834	S	S	*	*			trans	-82.8	129.3	163.8	31.1	-28.4	0	0	0	111.9	Q8	P6-Q8 PolarHBondContact O-N 3.39Å
7	F	52.1	Low	50.8	Low	205 Å²	205	166.1 Å²	166.1	90%	0.899	82%	0.819	S	S	*	*			trans	-71.1	103.6	171.7	-128.9	-92.1	0	0	0	109.8	R9	F7-R9 PolarHBondContact O-N 3.25Å
8	Q	52	Low	50.5	Low	171 Å²	171	162.3 Å²	162.3	80%	0.799	81%	0.812	S	S	*	*			trans	-82.8	107.1	170.5	-72.6	-168.9	-3	0	0	110.2	P6	P6-Q8 PolarHBondContact O-N 3.39Å
9	R	50.2	Low	50.5	Low	239 Å²	239	165 Å²	165	90%	0.902	81%	0.811	S	S	*	*			trans	-98.9	94.1	169.6	-160.9	179.2	-167.5	-177.4	4.2	108.4	F7 S11	F7-R9 PolarHBondContact O-N 3.25Å; R9-S11 PolarHBondContact O-N 3.41Å
10	T	51.1	Low	50.4	Low	117 Å²	117	163.6 Å²	163.6	72%	0.718	81%	0.813	S	S	*	*			trans	-80.7	111	173.5	61	0	0	0	0	109.4
11	S	47.6	Very low	49.9	Very low	112 Å²	112	159.7 Å²	159.7	78%	0.783	81%	0.814	S	S	*	*			trans	-94.2	117.6	164.5	172.1	0	0	0	0	107.9	R9	R9-S11 PolarHBondContact O-N 3.41Å
12	T	54.5	Low	50.3	Low	113 Å²	113	153.6 Å²	153.6	69%	0.693	80%	0.796	S	S	*	*			trans	-95.5	107	170.4	57.3	0	0	0	0	109.2	K14	T12-K14 PolarHBondContact O-N 3.35Å
13	L	49.6	Very low	49.8	Very low	172 Å²	172	153.3 Å²	153.3	90%	0.901	79%	0.793	S	S	*	*			trans	-64.1	116.3	161.4	-90.7	154	0	0	0	108.7
14	K	55.2	Low	49.6	Very low	191 Å²	191	147.4 Å²	147.4	83%	0.83	78%	0.783	S	S	*	*			trans	-123.8	107.9	167.3	-82.1	-172.1	175	-177.8	0	110.8	T12	T12-K14 PolarHBondContact O-N 3.35Å
15	H	48.6	Very low	49.4	Very low	170 Å²	170	147 Å²	147	79%	0.787	78%	0.781	S	S	*	*			trans	42.2	112.2	149.5	-110.4	-84	0	0	0	120.2	I17	H15-I17 PolarHBondContact O-N 3.28Å
16	R	40.4	Very low	48.6	Very low	230 Å²	230	148.6 Å²	148.6	87%	0.868	79%	0.791	S	S	*	*			trans	-56.4	115.6	153.8	-172.3	-179.9	-172.2	177.7	2.8	108.9
17	I	59.9	Low	48.3	Very low	112 Å²	112	149.3 Å²	149.3	57%	0.574	79%	0.789	S	S	*	*			trans	-105.7	109.1	166.1	-59.8	174.1	0	0	0	106.8	H15 R19	H15-I17 PolarHBondContact O-N 3.28Å; I17-R19 HydrophobicContact CG2-CG 3.56Å; I17-R19 PolarHBondContact O-N 3.28Å
18	S	45.2	Very low	48	Very low	99 Å²	99	147.5 Å²	147.5	69%	0.692	79%	0.789	S	S	*	*			trans	-73.2	104.1	163.8	-59.2	0	0	0	0	107.7
19	R	49.5	Very low	47.7	Very low	213 Å²	213	146 Å²	146	80%	0.804	79%	0.786	S	S	*	*			trans	-94.1	98.7	171.3	-64	-168.7	-171.9	-146.4	1.3	109.2	I17	I17-R19 HydrophobicContact CG2-CG 3.56Å; I17-R19 PolarHBondContact O-N 3.28Å
20	T	49.1	Very low	47.5	Very low	137 Å²	137	142.4 Å²	142.4	84%	0.84	79%	0.785	S	S	*	*			trans	-69.6	118.7	155.1	49.2	0	0	0	0	107.5	S22	T20-S22 PolarHBondContact O-N 3.48Å
21	G	41	Very low	47	Very low	82 Å²	82	144.5 Å²	144.5	85%	0.845	79%	0.79	S	S	*	*			trans	-73.5	113.9	177	0	0	0	0	0	111
22	S	49.8	Very low	46.8	Very low	115 Å²	115	145.8 Å²	145.8	80%	0.804	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-80.4	134.4	165.4	178.1	0	0	0	0	109.4	T20 G24	T20-S22 PolarHBondContact O-N 3.48Å; S22-G24 PolarHBondContact O-N 3.35Å
23	V	46.4	Very low	46.1	Very low	140 Å²	140	143.4 Å²	143.4	85%	0.848	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-71.7	121.5	168.3	175.7	0	0	0	0	107.8
24	G	41.1	Very low	45.6	Very low	65 Å²	65	140.4 Å²	140.4	67%	0.67	79%	0.785	S	S	*	*	P	Polyproline II helix	trans	-91.2	134.2	174.1	0	0	0	0	0	111	S22	S22-G24 PolarHBondContact O-N 3.35Å
25	Q	41.8	Very low	45	Very low	164 Å²	164	138.3 Å²	138.3	77%	0.766	78%	0.781	S	S	*	*			trans	-92.1	113.1	-179.9	176.3	179.1	-11.9	0	0	109
26	D	41.9	Very low	44.7	Very low	163 Å²	163	136.4 Å²	136.4	87%	0.872	78%	0.777	S	S	*	*			trans	-88.3	106.7	172.2	-73.5	-32.6	0	0	0	109.5
27	N	47.1	Very low	44.8	Very low	125 Å²	125	133 Å²	133	67%	0.668	77%	0.774	S	S	*	*			trans	-78.1	120.8	168.5	-80.5	-27.1	0	0	0	109.5
28	N	46.5	Very low	43.9	Very low	168 Å²	168	132.9 Å²	132.9	90%	0.898	78%	0.783	S	S	*	*			trans	-110.4	115.6	165.5	-98.9	-18.5	0	0	0	110
29	N	44.7	Very low	43.7	Very low	138 Å²	138	133.5 Å²	133.5	74%	0.738	79%	0.788	S	S	*	*			trans	-75.3	128.8	174.9	-68.1	-30.1	0	0	0	110.4
30	N	45.4	Very low	43.4	Very low	165 Å²	165	126.6 Å²	126.6	88%	0.882	78%	0.782	S	S	*	*			trans	-135.5	109.9	153.1	-91.4	-19.7	0	0	0	108.1
31	I	41.8	Very low	43	Very low	161 Å²	161	127 Å²	127	83%	0.826	78%	0.778	S	S	*	*			trans	-96	112	175.4	-65.7	168.3	0	0	0	106.8
32	T	42.9	Very low	42.9	Very low	139 Å²	139	131.5 Å²	131.5	85%	0.853	78%	0.782	S	S	*	*			trans	-151.3	118	160.5	-41.2	0	0	0	0	111
33	G	40.6	Very low	42.8	Very low	63 Å²	63	131 Å²	131	65%	0.649	78%	0.775	S	S	*	*			trans	62.2	92.2	140.7	0	0	0	0	0	120
34	S	38.5	Very low	42.6	Very low	109 Å²	109	128.4 Å²	128.4	76%	0.762	78%	0.777	S	S	*	*				31.4	139.2	124.5	64.2	0	0	0	0	122.6
35	I	43.6	Very low	43	Very low	146 Å²	146	132.3 Å²	132.3	75%	0.749	78%	0.78	S	S	*	*			trans	119	103.2	145.1	-55	166.3	0	0	0	116.1
36	N	42.6	Very low	43.3	Very low	131 Å²	131	133.3 Å²	133.3	70%	0.701	79%	0.785	S	S	*	*			trans	47.3	120.9	134.4	-58.4	-13	0	0	0	124.3
37	I	41.4	Very low	43.5	Very low	157 Å²	157	133.9 Å²	133.9	81%	0.805	78%	0.783	S	S	*	*				46.9	112.7	120.2	-47.6	161.8	0	0	0	117.5
38	S	41.8	Very low	43.2	Very low	110 Å²	110	136.9 Å²	136.9	77%	0.769	79%	0.793	S	S	*	*				-171.3	149.4	119.7	-161	0	0	0	0	112.3
39	S	39.5	Very low	42.9	Very low	113 Å²	113	132.9 Å²	132.9	79%	0.79	78%	0.778	S	S	*	*			trans	-47.4	152.4	178.3	52.6	0	0	0	0	117.5
40	G	44.7	Very low	42.7	Very low	67 Å²	67	130.6 Å²	130.6	69%	0.691	77%	0.773	S	S	*	*			trans	136.3	124.7	139.5	0	0	0	0	0	116.5
41	I	39.3	Very low	42.8	Very low	147 Å²	147	128.6 Å²	128.6	75%	0.754	76%	0.761	S	S	*	*			trans	87.4	95.3	151.1	-49.6	167.3	0	0	0	115.8	T43	I41-T43 HydrophobicContact CG2-CG2 3.71Å; I41-T43 PolarHBondContact O-N 3.16Å
42	N	40.2	Very low	43	Very low	175 Å²	175	131.5 Å²	131.5	94%	0.936	76%	0.761	S	S	*	*			trans	-69.9	105.4	154.3	-70.8	-41.3	0	0	0	108.9
43	T	47.9	Very low	43.3	Very low	105 Å²	105	133.8 Å²	133.8	64%	0.644	75%	0.754	S	S	*	*			trans	-118.8	117.4	158	44.6	0	0	0	0	108.1	I41 I45	I41-T43 HydrophobicContact CG2-CG2 3.71Å; I41-T43 PolarHBondContact O-N 3.16Å; T43-I45 PolarHBondContact O-N 3.47Å
44	G	41	Very low	43.8	Very low	86 Å²	86	135.1 Å²	135.1	89%	0.887	76%	0.759	S	S	*	*			trans	-62.5	106.6	177.2	0	0	0	0	0	110.2
45	I	49.1	Very low	44.2	Very low	146 Å²	146	133.5 Å²	133.5	75%	0.749	75%	0.748	S	S	*	*			trans	-99.3	106.9	160.9	-61.4	-174.3	0	0	0	105.7	T43 Q47	T43-I45 PolarHBondContact O-N 3.47Å; I45-Q47 VanDerWaalsContact C-N 3.27Å; I45-Q47 PolarHBondContact O-N 2.93Å
46	Q	48.3	Very low	44.6	Very low	186 Å²	186	129.1 Å²	129.1	87%	0.869	73%	0.728	S	S	*	*			trans	-54.5	96.5	163.4	-75.9	-179.2	-19.2	0	0	107.8	Q48	Q46-Q48 PolarHBondContact O-N 3.34Å
47	Q	45.8	Very low	45.1	Very low	175 Å²	175	124.4 Å²	124.4	82%	0.818	70%	0.702	S	S	*	*			trans	-77.2	80.9	173.5	-146.6	172.2	46.7	0	0	106.8	I45 S49	I45-Q47 VanDerWaalsContact C-N 3.27Å; I45-Q47 PolarHBondContact O-N 2.93Å; Q47-S49 PolarHBondContact O-N 3.48Å
48	Q	42.2	Very low	45.8	Very low	187 Å²	187	124.3 Å²	124.3	87%	0.874	70%	0.698	S	S	*	*			trans	-71.2	71.7	166	-161.2	174.4	62.5	0	0	107	Q46 S50	Q46-Q48 PolarHBondContact O-N 3.34Å; Q48-S50 PolarHBondContact O-N 3.48Å
49	S	39.4	Very low	47	Very low	85 Å²	85	127 Å²	127	59%	0.594	70%	0.696	S	S	*	*			trans	-71.4	87.7	171.9	61.6	0	0	0	0	107.6	Q47 I51	Q47-S49 PolarHBondContact O-N 3.48Å; S49-I51 PolarHBondContact O-N 2.96Å
50	S	41.5	Very low	48.8	Very low	90 Å²	90	126 Å²	126	63%	0.629	68%	0.675	S	S	*	*			trans	-62.5	94.1	154.6	176.9	0	0	0	0	106.2	Q48 R52	Q48-S50 PolarHBondContact O-N 3.48Å; S50-R52 PolarHBondContact O-N 3.03Å
51	I	47.7	Very low	50.8	Low	122 Å²	122	126.3 Å²	126.3	63%	0.626	66%	0.66	S	S	*	*			trans	-63.3	88.6	163.6	-59.4	175.4	0	0	0	105	S49 R53	S49-I51 PolarHBondContact O-N 2.96Å; I51-R53 HydrophobicContact CG2-CG 3.76Å; I51-R53 PolarHBondContact O-N 3.01Å
52	R	44.3	Very low	53.2	Low	222 Å²	222	120.6 Å²	120.6	84%	0.838	64%	0.637	S	S	*	*			trans	-66.4	82.9	162.4	-79.3	-164.6	-86.4	-108.6	2.4	106.2	S50 A54	S50-R52 PolarHBondContact O-N 3.03Å; R52-A54 PolarHBondContact O-N 3.2Å
53	R	49.3	Very low	55.7	Low	188 Å²	188	118 Å²	118	71%	0.709	62%	0.619	S	S	*	*			trans	-52.7	114.8	172.7	-67.4	-175.6	-172.8	102.9	-0.6	106.2	I51 S55	I51-R53 HydrophobicContact CG2-CG 3.76Å; I51-R53 PolarHBondContact O-N 3.01Å; R53-S55 PolarHBondContact O-N 3.33Å
54	A	50.9	Low	57.7	Low	90 Å²	90	116.6 Å²	116.6	74%	0.744	61%	0.607	S	S	*	*			trans	-47.2	128.8	165.1	0	0	0	0	0	106.8	R52 V56	R52-A54 PolarHBondContact O-N 3.2Å; A54-V56 PolarHBondContact O-N 3.04Å
55	S	46.9	Very low	60.2	Low	76 Å²	76	119.1 Å²	119.1	53%	0.531	60%	0.596	S	S	.	*			trans	-52.2	103.5	-169	47.9	0	0	0	0	110.2	R53 M57 Q58	R53-S55 PolarHBondContact O-N 3.33Å; S55-M57 PolarHBondContact O-N 2.83Å; S55-Q58 PolarHBondContact O-N 2.97Å
56	V	53.4	Low	62.1	Low	54 Å²	54	116.6 Å²	116.6	33%	0.327	58%	0.58	S	S	.	*	G	3₁₀ helix	trans	-56.7	-18.8	-175.4	174.7	0	0	0	0	112	A54 Q58 K59 Y60	A54-V56 PolarHBondContact O-N 3.04Å; V56-Q58 VanDerWaalsContact C-N 3.27Å; V56-Q58 PolarHBondContact O-N 3.26Å; V56-K59 PolarHBondContact O-N 2.6Å; V56-Y60 HydrophobicContact CG1-CD2 4.09Å; V56-Y60 HydrophobicContact CG1-CE2 3.95Å
57	M	52.2	Low	64	Low	31 Å²	31	114.6 Å²	114.6	15%	0.153	58%	0.58	C	S	.	*	G	3₁₀ helix	trans	-47	-43.5	174.2	-60.3	-87.1	97.9	0	0	113.5	S55 K59 L78 T82 I86 I90	S55-M57 PolarHBondContact O-N 2.83Å; M57-K59 PolarHBondContact O-N 3.3Å; M57-L78 HydrophobicContact CE-CB 3.97Å; M57-L78 HydrophobicContact CE-CD2 3.33Å; M57-L78 HydrophobicContact CE-CG 4.23Å; M57-L78 HydrophobicContact SD-CD2 3.39Å; M57-L78 WeakPolarHBondContact SD-CD2 3.25Å; M57-T82 HydrophobicContact CE-CG2 3.94Å; M57-T82 WeakPolarHBondContact CE-OG1 3.34Å; M57-T82 HydrophobicContact SD-CG2 3.87Å; M57-I86 HydrophobicContact SD-CG2 3.84Å; M57-I90 HydrophobicContact SD-CD1 4.45Å
58	Q	57.2	Low	66.1	Low	155 Å²	155	110.1 Å²	110.1	72%	0.724	58%	0.581	S	S	*	*	G	3₁₀ helix	trans	-72.1	-29.4	-174.1	-75.6	-176.8	-54.4	0	0	113	S55 V56 Y60	S55-Q58 PolarHBondContact O-N 2.97Å; V56-Q58 VanDerWaalsContact C-N 3.27Å; V56-Q58 PolarHBondContact O-N 3.26Å; Q58-Y60 PolarHBondContact O-N 3.23Å; Q58-Y60 VanDerWaalsContact O-N 3.15Å
59	K	65.4	Low	67.9	Low	166 Å²	166	105.9 Å²	105.9	72%	0.722	56%	0.564	S	S	*	*	G	3₁₀ helix	trans	-67.8	-16.3	-176.2	-172.8	166.3	177.1	171.3	0	112.9	V56 M57	V56-K59 PolarHBondContact O-N 2.6Å; M57-K59 PolarHBondContact O-N 3.3Å
60	Y	77.5	Confident	70.2	Confident	92 Å²	92	109.8 Å²	109.8	36%	0.361	58%	0.578	S	S	.	*	G	3₁₀ helix	trans	-137.5	34.4	-170.8	-57.5	-70.5	0	0	0	113.4	V56 Q58 C76 K77	V56-Y60 HydrophobicContact CG1-CD2 4.09Å; V56-Y60 HydrophobicContact CG1-CE2 3.95Å; Q58-Y60 PolarHBondContact O-N 3.23Å; Q58-Y60 VanDerWaalsContact O-N 3.15Å; Y60-C76 WeakPolarHBondContact O-CA 3.31Å; Y60-K77 VanDerWaalsContact CB-CB 3.44Å; Y60-K77 HydrophobicContact CD1-CD 4.39Å; Y60-K77 HydrophobicContact CD2-CD 3.97Å; Y60-K77 HydrophobicContact CE2-CD 4.48Å; Y60-K77 HydrophobicContact CG-CB 4.16Å; Y60-K77 HydrophobicContact CG-CD 3.92Å; Y60-K77 PolarHBondContact O-N 2.82Å
61	M	86.8	Confident	72.3	Confident	75 Å²	75	111.6 Å²	111.6	37%	0.369	58%	0.577	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.3	134.4	169.5	-173.4	162.3	68.7	0	0	109.9	F75 C76 I90	M61-F75 WeakPolarHBondContact CA-O 3.26Å; M61-C76 HydrophobicContact CB-CB 4.22Å; M61-C76 HydrophobicContact CG-CB 3.98Å; M61-C76 HydrophobicContact SD-CB 4.17Å; M61-I90 HydrophobicContact SD-CG2 4.39Å
62	G	89.9	Confident	74.3	Confident	27 Å²	27	109.7 Å²	109.7	28%	0.278	57%	0.571	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-172.3	-167.8	-176.5	0	0	0	0	0	113.8	F75	G62-F75 VanDerWaalsContact C-CE1 3.49Å; G62-F75 PolarHBondContact N-O 3.5Å; G62-F75 WeakPolarHBondContact O-CD1 3.42Å; G62-F75 PolarHBondContact O-N 2.86Å
63	E	92.2	Very high	76.5	Confident	119 Å²	119	100.9 Å²	100.9	56%	0.556	55%	0.546	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.1	141	176.6	-73.2	-175.1	174.6	0	0	109.5	T72 A73 R74	E63-T72 HydrophobicContact CB-CG2 3.76Å; E63-T72 HydrophobicContact CG-CG2 4.28Å; E63-A73 CarbonylContact C-O 3.54Å; E63-A73 VanDerWaalsContact CA-O 3.31Å; E63-A73 WeakPolarHBondContact CA-O 3.37Å; E63-R74 HydrophobicContact CG-CG 3.64Å; E63-R74 WeakPolarHBondContact OE1-CG 3.42Å; E63-R74 IonicContact OE1-CZ 3.57Å; E63-R74 IonicContact OE1-NE 2.85Å; E63-R74 PolarHBondContact OE1-NE 2.83Å; E63-R74 IonicContact OE1-NH2 2.75Å
64	I	91.1	Very high	78.5	Confident	77 Å²	77	97.9 Å²	97.9	40%	0.395	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	124.3	174.6	-175.7	170.9	0	0	0	108.7	F66 T72 A73 F75	I64-F66 HydrophobicContact CD1-CE1 4.25Å; I64-F66 HydrophobicContact CD1-CZ 4.48Å; I64-F66 HydrophobicContact CG2-CE2 4.01Å; I64-F66 HydrophobicContact CG2-CZ 3.95Å; I64-T72 CarbonylContact O-C 3.56Å; I64-T72 WeakPolarHBondContact O-CA 3.35Å; I64-A73 HydrophobicContact CG2-CB 3.94Å; I64-A73 PolarHBondContact N-O 2.91Å; I64-A73 PolarHBondContact O-N 2.93Å; I64-F75 HydrophobicContact CB-CD1 4.27Å; I64-F75 HydrophobicContact CB-CE1 4.28Å; I64-F75 HydrophobicContact CG2-CD1 4.22Å
65	E	92.8	Very high	80.5	Confident	139 Å²	139	98.3 Å²	98.3	65%	0.65	52%	0.52	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.3	126.8	170.8	-173	-179.1	168.3	0	0	108.9	T67	E65-T67 PolarHBondContact O-N 3.29Å
66	F	90.1	Very high	82.6	Confident	93 Å²	93	96.1 Å²	96.1	41%	0.408	50%	0.504	S	S	.	.			trans	-88.1	108.3	179.9	-67.1	-81.6	0	0	0	109.9	I64 G68 L69 Q71 A73	I64-F66 HydrophobicContact CD1-CE1 4.25Å; I64-F66 HydrophobicContact CD1-CZ 4.48Å; I64-F66 HydrophobicContact CG2-CE2 4.01Å; I64-F66 HydrophobicContact CG2-CZ 3.95Å; F66-G68 PolarHBondContact O-N 2.87Å; F66-G68 VanDerWaalsContact O-N 3.16Å; F66-L69 HydrophobicContact CB-CB 3.97Å; F66-L69 HydrophobicContact CB-CD1 4.11Å; F66-L69 HydrophobicContact CB-CG 4.43Å; F66-L69 CarbonylContact O-C 3.43Å; F66-L69 PolarHBondContact O-N 3.41Å; F66-Q71 PolarHBondContact N-O 2.99Å; F66-A73 HydrophobicContact CE2-CB 3.78Å; F66-A73 HydrophobicContact CZ-CB 4.49Å
67	T	87.2	Confident	84.4	Confident	144 Å²	144	99.1 Å²	99.1	88%	0.883	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.6	124.7	178.5	57.2	0	0	0	0	111.4	E65 L69	E65-T67 PolarHBondContact O-N 3.29Å; T67-L69 VanDerWaalsContact C-N 3.34Å
68	G	90.9	Very high	86.1	Confident	81 Å²	81	100.6 Å²	100.6	84%	0.835	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	87.5	-4.7	-178.1	0	0	0	0	0	115.2	F66	F66-G68 PolarHBondContact O-N 2.87Å; F66-G68 VanDerWaalsContact O-N 3.16Å
69	L	80.1	Confident	87.6	Confident	97 Å²	97	97 Å²	97	51%	0.508	51%	0.506	S	S	.	.	S	Bend	trans	-123.3	108.3	169.2	-56.7	173.6	0	0	0	105.2	F66 T67 Q71	F66-L69 HydrophobicContact CB-CB 3.97Å; F66-L69 HydrophobicContact CB-CD1 4.11Å; F66-L69 HydrophobicContact CB-CG 4.43Å; F66-L69 CarbonylContact O-C 3.43Å; F66-L69 PolarHBondContact O-N 3.41Å; T67-L69 VanDerWaalsContact C-N 3.34Å; L69-Q71 HydrophobicContact CB-CB 4.49Å; L69-Q71 PolarHBondContact O-N 3.29Å
70	N	86.2	Confident	88.7	Confident	167 Å²	167	95.3 Å²	95.3	89%	0.893	52%	0.515	S	S	*	.			trans	-66.2	59.6	180	-64.4	-30.1	0	0	0	112.1
71	Q	86.5	Confident	89.3	Confident	128 Å²	128	98.9 Å²	98.9	60%	0.598	54%	0.535	S	S	*	.			trans	-144.3	128.8	-167.9	-71	-175.3	83.2	0	0	108.1	F66 L69	F66-Q71 PolarHBondContact N-O 2.99Å; L69-Q71 HydrophobicContact CB-CB 4.49Å; L69-Q71 PolarHBondContact O-N 3.29Å
72	T	88.5	Confident	89.4	Confident	83 Å²	83	96.7 Å²	96.7	51%	0.509	53%	0.526	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	133.3	175.8	-54.2	0	0	0	0	108.5	E63 I64	E63-T72 HydrophobicContact CB-CG2 3.76Å; E63-T72 HydrophobicContact CG-CG2 4.28Å; I64-T72 CarbonylContact O-C 3.56Å; I64-T72 WeakPolarHBondContact O-CA 3.35Å
73	A	90.6	Very high	89.5	Confident	37 Å²	37	99 Å²	99	31%	0.306	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	140.1	174.4	0	0	0	0	0	111.1	E63 I64 F66	E63-A73 CarbonylContact C-O 3.54Å; E63-A73 VanDerWaalsContact CA-O 3.31Å; E63-A73 WeakPolarHBondContact CA-O 3.37Å; I64-A73 HydrophobicContact CG2-CB 3.94Å; I64-A73 PolarHBondContact N-O 2.91Å; I64-A73 PolarHBondContact O-N 2.93Å; F66-A73 HydrophobicContact CE2-CB 3.78Å; F66-A73 HydrophobicContact CZ-CB 4.49Å
74	R	91.9	Very high	89.5	Confident	125 Å²	125	98.3 Å²	98.3	47%	0.472	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.1	138.2	171.5	-71.9	170.2	177.8	173.7	1.5	109.9	E63 W95	E63-R74 HydrophobicContact CG-CG 3.64Å; E63-R74 WeakPolarHBondContact OE1-CG 3.42Å; E63-R74 IonicContact OE1-CZ 3.57Å; E63-R74 IonicContact OE1-NE 2.85Å; E63-R74 PolarHBondContact OE1-NE 2.83Å; E63-R74 IonicContact OE1-NH2 2.75Å; R74-W95 HydrophobicContact CB-CD2 4.16Å; R74-W95 HydrophobicContact CB-CZ2 3.96Å; R74-W95 PolarHBondContact NH1-O 3.2Å; R74-W95 VanDerWaalsContact NH1-O 3.1Å
75	F	92.7	Very high	89.6	Confident	99 Å²	99	97.2 Å²	97.2	43%	0.434	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.3	152.8	176.5	71	-89.5	0	0	0	111.4	M61 G62 I64	M61-F75 WeakPolarHBondContact CA-O 3.26Å; G62-F75 VanDerWaalsContact C-CE1 3.49Å; G62-F75 PolarHBondContact N-O 3.5Å; G62-F75 WeakPolarHBondContact O-CD1 3.42Å; G62-F75 PolarHBondContact O-N 2.86Å; I64-F75 HydrophobicContact CB-CD1 4.27Å; I64-F75 HydrophobicContact CB-CE1 4.28Å; I64-F75 HydrophobicContact CG2-CD1 4.22Å
76	C	91.4	Very high	89.5	Confident	29 Å²	29	93.7 Å²	93.7	20%	0.196	52%	0.521	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.4	129.5	170.8	-178.5	0	0	0	0	108.8	Y60 M61 W95	Y60-C76 WeakPolarHBondContact O-CA 3.31Å; M61-C76 HydrophobicContact CB-CB 4.22Å; M61-C76 HydrophobicContact CG-CB 3.98Å; M61-C76 HydrophobicContact SD-CB 4.17Å; C76-W95 HydrophobicContact CB-CZ2 4.17Å
77	K	90.6	Very high	89.6	Confident	118 Å²	118	92.6 Å²	92.6	51%	0.513	52%	0.518	S	S	.	.			trans	-81	125	172.1	-173.9	-177.2	177.9	177.8	0	109.5	Y60	Y60-K77 VanDerWaalsContact CB-CB 3.44Å; Y60-K77 HydrophobicContact CD1-CD 4.39Å; Y60-K77 HydrophobicContact CD2-CD 3.97Å; Y60-K77 HydrophobicContact CE2-CD 4.48Å; Y60-K77 HydrophobicContact CG-CB 4.16Å; Y60-K77 HydrophobicContact CG-CD 3.92Å; Y60-K77 PolarHBondContact O-N 2.82Å
78	L	88.6	Confident	89.8	Confident	62 Å²	62	92.8 Å²	92.8	33%	0.325	50%	0.503	S	S	.	.			trans	-109	151.5	175.4	-50.4	179.8	0	0	0	111.6	M57 T82 L87 I90	M57-L78 HydrophobicContact CE-CB 3.97Å; M57-L78 HydrophobicContact CE-CD2 3.33Å; M57-L78 HydrophobicContact CE-CG 4.23Å; M57-L78 HydrophobicContact SD-CD2 3.39Å; M57-L78 WeakPolarHBondContact SD-CD2 3.25Å; L78-T82 HydrophobicContact CD2-CG2 4.46Å; L78-L87 HydrophobicContact CD1-CD1 3.98Å; L78-I90 HydrophobicContact CD2-CD1 3.89Å
79	N	88	Confident	89.8	Confident	79 Å²	79	92.1 Å²	92.1	42%	0.422	48%	0.48	S	S	.	.			trans	-84.7	154.4	167.8	-65.2	-15.4	0	0	0	109.3	E81 T82	N79-E81 PolarHBondContact O-N 3.48Å; N79-T82 PolarHBondContact N-OG1 3.18Å; N79-T82 VanDerWaalsContact O-CB 3.23Å; N79-T82 WeakPolarHBondContact O-CB 3.31Å; N79-T82 PolarHBondContact O-N 2.96Å; N79-T82 PolarHBondContact O-OG1 2.94Å
80	S	89.6	Confident	90.4	Very high	130 Å²	130	88.1 Å²	88.1	91%	0.909	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.9	-26	176.8	50.2	0	0	0	0	113.9	T82	S80-T82 VanDerWaalsContact C-N 3.31Å
81	E	90.4	Very high	90.7	Very high	168 Å²	168	82.4 Å²	82.4	79%	0.785	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.1	0.7	177.5	-62.6	172.6	-172.9	0	0	113.2	N79 P83	N79-E81 PolarHBondContact O-N 3.48Å; E81-P83 WeakPolarHBondContact O-CD 3.31Å
82	T	88.8	Confident	91	Very high	28 Å²	28	83.1 Å²	83.1	17%	0.172	43%	0.43	C	S	.	.			trans	-69.7	121.3	-177.9	-49.9	0	0	0	0	109.2	M57 L78 N79 S80 I86	M57-T82 HydrophobicContact CE-CG2 3.94Å; M57-T82 WeakPolarHBondContact CE-OG1 3.34Å; M57-T82 HydrophobicContact SD-CG2 3.87Å; L78-T82 HydrophobicContact CD2-CG2 4.46Å; N79-T82 PolarHBondContact N-OG1 3.18Å; N79-T82 VanDerWaalsContact O-CB 3.23Å; N79-T82 WeakPolarHBondContact O-CB 3.31Å; N79-T82 PolarHBondContact O-N 2.96Å; N79-T82 PolarHBondContact O-OG1 2.94Å; S80-T82 VanDerWaalsContact C-N 3.31Å; T82-I86 HydrophobicContact CG2-CB 3.91Å; T82-I86 HydrophobicContact CG2-CG1 4.44Å; T82-I86 HydrophobicContact CG2-CG2 3.98Å
83	P	92	Very high	91.1	Very high	75 Å²	75	87.6 Å²	87.6	49%	0.487	44%	0.437	S	S	.	.			trans	-71.2	147.3	-179.5	27.8	-32.5	0	0	0	111.3	E81 S85 I86	E81-P83 WeakPolarHBondContact O-CD 3.31Å; P83-S85 PolarHBondContact O-N 3.46Å; P83-I86 HydrophobicContact CG-CG1 3.92Å; P83-I86 WeakPolarHBondContact O-CB 3.37Å; P83-I86 PolarHBondContact O-N 3.15Å
84	D	91.6	Very high	91.2	Very high	105 Å²	105	92.3 Å²	92.3	56%	0.561	45%	0.451	S	S	*	.	H	α-helix	trans	-58.3	-23.4	-178.3	-64.7	-6.5	0	0	0	114.1	I86 L87 R88	D84-I86 PolarHBondContact O-N 2.92Å; D84-L87 PolarHBondContact O-N 3.38Å; D84-R88 VanDerWaalsContact CB-NH1 3.31Å; D84-R88 WeakPolarHBondContact O-CG 3.49Å; D84-R88 PolarHBondContact O-N 3.12Å
85	S	92.8	Very high	91.2	Very high	55 Å²	55	89.1 Å²	89.1	39%	0.385	44%	0.439	S	S	.	.	H	α-helix	trans	-58.5	-38.6	174.5	53	0	0	0	0	111.8	P83 R88 D89	P83-S85 PolarHBondContact O-N 3.46Å; S85-R88 PolarHBondContact O-N 3.36Å; S85-D89 WeakPolarHBondContact O-CB 3.39Å; S85-D89 PolarHBondContact O-N 2.98Å
86	I	91.5	Very high	91.2	Very high	65 Å²	65	87.3 Å²	87.3	33%	0.333	45%	0.448	S	S	.	.	H	α-helix	trans	-69.6	-41.3	177	-59.7	-63.9	0	0	0	110.4	M57 T82 P83 D84 D89 I90	M57-I86 HydrophobicContact SD-CG2 3.84Å; T82-I86 HydrophobicContact CG2-CB 3.91Å; T82-I86 HydrophobicContact CG2-CG1 4.44Å; T82-I86 HydrophobicContact CG2-CG2 3.98Å; P83-I86 HydrophobicContact CG-CG1 3.92Å; P83-I86 WeakPolarHBondContact O-CB 3.37Å; P83-I86 PolarHBondContact O-N 3.15Å; D84-I86 PolarHBondContact O-N 2.92Å; I86-D89 WeakPolarHBondContact O-CB 3.42Å; I86-D89 PolarHBondContact O-N 3.45Å; I86-I90 HydrophobicContact CG2-CD1 3.98Å; I86-I90 VanDerWaalsContact O-CG1 3.29Å; I86-I90 WeakPolarHBondContact O-CG1 3.23Å; I86-I90 PolarHBondContact O-N 2.98Å
87	L	91.3	Very high	91.2	Very high	69 Å²	69	89.8 Å²	89.8	36%	0.361	46%	0.459	S	S	.	.	H	α-helix	trans	-60.1	-47.3	174.8	177	61	0	0	0	110.9	L78 D84 D89 I90 L91	L78-L87 HydrophobicContact CD1-CD1 3.98Å; D84-L87 PolarHBondContact O-N 3.38Å; L87-D89 VanDerWaalsContact C-N 3.3Å; L87-D89 PolarHBondContact O-N 2.98Å; L87-I90 PolarHBondContact O-N 2.85Å; L87-L91 HydrophobicContact CD1-CD1 4.21Å; L87-L91 HydrophobicContact CD1-CG 4.16Å; L87-L91 HydrophobicContact CG-CD1 4.16Å; L87-L91 HydrophobicContact CG-CG 4.49Å; L87-L91 VanDerWaalsContact O-CG 3.31Å; L87-L91 WeakPolarHBondContact O-CG 3.45Å; L87-L91 PolarHBondContact O-N 2.98Å
88	R	90.8	Very high	91.2	Very high	149 Å²	149	90.8 Å²	90.8	56%	0.562	46%	0.463	S	S	*	.	H	α-helix	trans	-58.2	-42.4	176	-73.5	-172.5	-73.1	-91.2	4.4	112	D84 S85 L91 K92	D84-R88 VanDerWaalsContact CB-NH1 3.31Å; D84-R88 WeakPolarHBondContact O-CG 3.49Å; D84-R88 PolarHBondContact O-N 3.12Å; S85-R88 PolarHBondContact O-N 3.36Å; R88-L91 PolarHBondContact O-N 2.7Å; R88-K92 VanDerWaalsContact O-CB 3.25Å; R88-K92 WeakPolarHBondContact O-CB 3.44Å; R88-K92 PolarHBondContact O-N 2.89Å
89	D	91.9	Very high	91.2	Very high	67 Å²	67	91.9 Å²	91.9	36%	0.358	47%	0.474	S	S	.	.	H	α-helix	trans	-64.1	-40.8	176.2	-92.4	14.7	0	0	0	112.7	S85 I86 L87 R93 K94	S85-D89 WeakPolarHBondContact O-CB 3.39Å; S85-D89 PolarHBondContact O-N 2.98Å; I86-D89 WeakPolarHBondContact O-CB 3.42Å; I86-D89 PolarHBondContact O-N 3.45Å; L87-D89 VanDerWaalsContact C-N 3.3Å; L87-D89 PolarHBondContact O-N 2.98Å; D89-R93 WeakPolarHBondContact O-CA 3.34Å; D89-R93 VanDerWaalsContact O-CB 3.23Å; D89-R93 WeakPolarHBondContact O-CB 3.42Å; D89-R93 PolarHBondContact O-N 3.05Å; D89-R93 IonicContact OD2-CZ 3.67Å; D89-R93 IonicContact OD2-NH2 3.65Å; D89-R93 PolarHBondContact OD2-NH2 2.8Å; D89-K94 PolarHBondContact O-N 3.42Å
90	I	92.5	Very high	91.3	Very high	13 Å²	13	90.5 Å²	90.5	7%	0.067	47%	0.469	C	S	.	.	I	π-helix	trans	-62.3	-53.1	175.8	-68.7	163.1	0	0	0	109.6	M57 M61 L78 I86 L87 K92 K94 W95	M57-I90 HydrophobicContact SD-CD1 4.45Å; M61-I90 HydrophobicContact SD-CG2 4.39Å; L78-I90 HydrophobicContact CD2-CD1 3.89Å; I86-I90 HydrophobicContact CG2-CD1 3.98Å; I86-I90 VanDerWaalsContact O-CG1 3.29Å; I86-I90 WeakPolarHBondContact O-CG1 3.23Å; I86-I90 PolarHBondContact O-N 2.98Å; L87-I90 PolarHBondContact O-N 2.85Å; I90-K92 PolarHBondContact O-N 3.04Å; I90-K94 WeakPolarHBondContact O-CA 3.48Å; I90-K94 WeakPolarHBondContact O-CB 3.38Å; I90-K94 PolarHBondContact O-N 2.9Å; I90-K94 VanDerWaalsContact O-N 3.11Å; I90-W95 HydrophobicContact CG2-CD2 4.07Å; I90-W95 HydrophobicContact CG2-CE3 4.5Å; I90-W95 HydrophobicContact CG2-CH2 4.38Å; I90-W95 HydrophobicContact CG2-CZ2 3.95Å; I90-W95 PolarHBondContact O-N 3.22Å
91	L	92.3	Very high	91.3	Very high	46 Å²	46	89.4 Å²	89.4	24%	0.241	46%	0.458	C	S	.	.	I	π-helix	trans	-58.9	-46.5	-178.3	-64.3	176.9	0	0	0	111.6	L87 R88 W95 G96 L97	L87-L91 HydrophobicContact CD1-CD1 4.21Å; L87-L91 HydrophobicContact CD1-CG 4.16Å; L87-L91 HydrophobicContact CG-CD1 4.16Å; L87-L91 HydrophobicContact CG-CG 4.49Å; L87-L91 VanDerWaalsContact O-CG 3.31Å; L87-L91 WeakPolarHBondContact O-CG 3.45Å; L87-L91 PolarHBondContact O-N 2.98Å; R88-L91 PolarHBondContact O-N 2.7Å; L91-W95 HydrophobicContact CD2-CE3 3.51Å; L91-W95 HydrophobicContact CD2-CZ3 3.5Å; L91-G96 PolarHBondContact O-N 2.9Å; L91-L97 HydrophobicContact CB-CD1 4.27Å; L91-L97 HydrophobicContact CD2-CD1 3.91Å; L91-L97 VanDerWaalsContact O-CB 3.31Å; L91-L97 WeakPolarHBondContact O-CB 3.39Å; L91-L97 WeakPolarHBondContact O-CG 3.46Å; L91-L97 PolarHBondContact O-N 3.46Å
92	K	92.5	Very high	91.3	Very high	143 Å²	143	85.5 Å²	85.5	62%	0.622	44%	0.441	S	S	*	.	I	π-helix	trans	-80.5	-54.3	-175.2	-173.6	179.6	179.6	-177.9	0	113.1	R88 I90 G96	R88-K92 VanDerWaalsContact O-CB 3.25Å; R88-K92 WeakPolarHBondContact O-CB 3.44Å; R88-K92 PolarHBondContact O-N 2.89Å; I90-K92 PolarHBondContact O-N 3.04Å; K92-G96 VanDerWaalsContact O-CA 3.25Å; K92-G96 WeakPolarHBondContact O-CA 3.25Å; K92-G96 PolarHBondContact O-N 3.02Å
93	R	92.3	Very high	91.3	Very high	178 Å²	178	89.1 Å²	89.1	67%	0.672	46%	0.459	S	S	*	.	I	π-helix	trans	-90.1	-36.7	-168.2	-178.9	169	53.8	161.3	-5.8	112.8	D89	D89-R93 WeakPolarHBondContact O-CA 3.34Å; D89-R93 VanDerWaalsContact O-CB 3.23Å; D89-R93 WeakPolarHBondContact O-CB 3.42Å; D89-R93 PolarHBondContact O-N 3.05Å; D89-R93 IonicContact OD2-CZ 3.67Å; D89-R93 IonicContact OD2-NH2 3.65Å; D89-R93 PolarHBondContact OD2-NH2 2.8Å
94	K	90.8	Very high	91.3	Very high	136 Å²	136	87.3 Å²	87.3	59%	0.591	44%	0.444	S	S	*	.	I	π-helix	trans	-87.5	-42.8	-180	-64.3	-65.2	-173.3	178.7	0	112.2	D89 I90	D89-K94 PolarHBondContact O-N 3.42Å; I90-K94 WeakPolarHBondContact O-CA 3.48Å; I90-K94 WeakPolarHBondContact O-CB 3.38Å; I90-K94 PolarHBondContact O-N 2.9Å; I90-K94 VanDerWaalsContact O-N 3.11Å
95	W	93	Very high	91.3	Very high	57 Å²	57	85.6 Å²	85.6	22%	0.216	44%	0.438	C	S	.	.	S	Bend	trans	-95.1	-10.7	-178.4	-63.3	-10.5	0	0	0	114	R74 C76 I90 L91 L97	R74-W95 HydrophobicContact CB-CD2 4.16Å; R74-W95 HydrophobicContact CB-CZ2 3.96Å; R74-W95 PolarHBondContact NH1-O 3.2Å; R74-W95 VanDerWaalsContact NH1-O 3.1Å; C76-W95 HydrophobicContact CB-CZ2 4.17Å; I90-W95 HydrophobicContact CG2-CD2 4.07Å; I90-W95 HydrophobicContact CG2-CE3 4.5Å; I90-W95 HydrophobicContact CG2-CH2 4.38Å; I90-W95 HydrophobicContact CG2-CZ2 3.95Å; I90-W95 PolarHBondContact O-N 3.22Å; L91-W95 HydrophobicContact CD2-CE3 3.51Å; L91-W95 HydrophobicContact CD2-CZ3 3.5Å; W95-L97 VanDerWaalsContact C-N 3.25Å; W95-L97 HydrophobicContact CB-CG 4.08Å; W95-L97 HydrophobicContact CE3-CD1 4.27Å; W95-L97 PolarHBondContact O-N 3.22Å
96	G	92.2	Very high	91.1	Very high	61 Å²	61	84.5 Å²	84.5	63%	0.629	43%	0.429	S	S	*	.			trans	70.2	21.3	176	0	0	0	0	0	113.5	L91 K92 K98	L91-G96 PolarHBondContact O-N 2.9Å; K92-G96 VanDerWaalsContact O-CA 3.25Å; K92-G96 WeakPolarHBondContact O-CA 3.25Å; K92-G96 PolarHBondContact O-N 3.02Å; G96-K98 PolarHBondContact O-N 3.04Å
97	L	91.3	Very high	91	Very high	82 Å²	82	88 Å²	88	43%	0.429	44%	0.442	S	S	.	.	P	Polyproline II helix	trans	-71.5	132.6	-179.1	-57.7	-179.6	0	0	0	110	L91 W95	L91-L97 HydrophobicContact CB-CD1 4.27Å; L91-L97 HydrophobicContact CD2-CD1 3.91Å; L91-L97 VanDerWaalsContact O-CB 3.31Å; L91-L97 WeakPolarHBondContact O-CB 3.39Å; L91-L97 WeakPolarHBondContact O-CG 3.46Å; L91-L97 PolarHBondContact O-N 3.46Å; W95-L97 VanDerWaalsContact C-N 3.25Å; W95-L97 HydrophobicContact CB-CG 4.08Å; W95-L97 HydrophobicContact CE3-CD1 4.27Å; W95-L97 PolarHBondContact O-N 3.22Å
98	K	90.2	Very high	90.7	Very high	139 Å²	139	87.2 Å²	87.2	60%	0.604	45%	0.451	S	S	*	.	P	Polyproline II helix	trans	-65.2	140.3	170.6	-176.3	171.5	165.8	-174.2	0	109.2	G96 S134	G96-K98 PolarHBondContact O-N 3.04Å; K98-S134 VanDerWaalsContact CD-OG 3.29Å; K98-S134 WeakPolarHBondContact CD-OG 3.44Å
99	P	88.9	Confident	90.3	Very high	84 Å²	84	86.1 Å²	86.1	55%	0.545	46%	0.46	S	S	.	.	P	Polyproline II helix	trans	-53.8	126	174.4	-26.4	35.1	0	0	0	110.8
100	P	89.6	Confident	89.6	Confident	50 Å²	50	89 Å²	89	33%	0.325	48%	0.476	S	S	.	.	P	Polyproline II helix	trans	-71	143.6	-178.6	28.3	-34	0	0	0	111.5	I103 S134 L136	P100-I103 HydrophobicContact CB-CG1 4.47Å; P100-I103 HydrophobicContact CG-CD1 4.44Å; P100-I103 HydrophobicContact CG-CG1 4.09Å; P100-S134 WeakPolarHBondContact CA-O 3.31Å; P100-S134 WeakPolarHBondContact CB-O 3.29Å; P100-L136 HydrophobicContact CB-CB 3.68Å; P100-L136 HydrophobicContact CG-CB 3.96Å; P100-L136 HydrophobicContact CG-CD2 4.17Å
101	T	90.2	Very high	88.8	Confident	108 Å²	108	93 Å²	93	66%	0.663	49%	0.493	S	S	*	.	S	Bend	trans	-88.3	-21.3	174.5	54.4	0	0	0	0	112.3	S134	T101-S134 PolarHBondContact N-O 3.04Å
102	L	89.9	Confident	87.8	Confident	85 Å²	85	99 Å²	99	45%	0.445	52%	0.52	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141	131.3	178.6	179.7	63.8	0	0	0	108.9	I104 L136	L102-I104 HydrophobicContact CD2-CD1 4.12Å; L102-I104 HydrophobicContact CD2-CG1 4.1Å; L102-I104 HydrophobicContact CG-CG1 4.06Å; L102-L136 PolarHBondContact O-N 2.84Å
103	I	90.5	Very high	86.9	Confident	105 Å²	105	101.8 Å²	101.8	54%	0.538	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	123.6	173.4	-59.5	174.1	0	0	0	107.2	P100 V138	P100-I103 HydrophobicContact CB-CG1 4.47Å; P100-I103 HydrophobicContact CG-CD1 4.44Å; P100-I103 HydrophobicContact CG-CG1 4.09Å; I103-V138 HydrophobicContact CG2-CG2 4.26Å
104	I	90.2	Very high	86.4	Confident	36 Å²	36	99.9 Å²	99.9	19%	0.185	53%	0.529	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	115.1	175.4	-53.6	173.4	0	0	0	107.6	L102 V106 L125 A128 L136 V138	L102-I104 HydrophobicContact CD2-CD1 4.12Å; L102-I104 HydrophobicContact CD2-CG1 4.1Å; L102-I104 HydrophobicContact CG-CG1 4.06Å; I104-V106 HydrophobicContact CG2-CG2 4.29Å; I104-L125 HydrophobicContact CB-CD1 4.4Å; I104-L125 HydrophobicContact CD1-CD1 3.94Å; I104-L125 HydrophobicContact CG2-CD1 3.7Å; I104-A128 HydrophobicContact CD1-CB 3.91Å; I104-L136 PolarHBondContact N-O 2.83Å; I104-V138 PolarHBondContact O-N 3.38Å
105	T	91.9	Very high	86.1	Confident	69 Å²	69	104.3 Å²	104.3	42%	0.423	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	123.9	175.7	-45.8	0	0	0	0	109.8	F107 V138	T105-F107 HydrophobicContact CG2-CD2 3.97Å; T105-F107 HydrophobicContact CG2-CE1 4.17Å; T105-F107 HydrophobicContact CG2-CE2 3.22Å; T105-F107 HydrophobicContact CG2-CZ 3.34Å; T105-V138 WeakPolarHBondContact CA-O 3.42Å; T105-V138 HydrophobicContact CG2-CB 4.43Å; T105-V138 HydrophobicContact CG2-CG1 4.47Å
106	V	88.9	Confident	86	Confident	32 Å²	32	109.2 Å²	109.2	19%	0.194	57%	0.565	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.5	123	178.6	-176.6	0	0	0	0	109	I104 F121 L125 V138 Q140	I104-V106 HydrophobicContact CG2-CG2 4.29Å; V106-F121 HydrophobicContact CG1-CE1 4.35Å; V106-F121 HydrophobicContact CG1-CZ 3.98Å; V106-F121 HydrophobicContact CG2-CZ 4.36Å; V106-L125 HydrophobicContact CG2-CD2 4.11Å; V106-V138 PolarHBondContact N-O 2.99Å; V106-Q140 PolarHBondContact O-N 2.75Å
107	F	89.3	Confident	85.8	Confident	139 Å²	139	110 Å²	110	61%	0.61	55%	0.554	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-118.1	139.2	173.4	-59.8	-86.4	0	0	0	109.4	T105 Q140	T105-F107 HydrophobicContact CG2-CD2 3.97Å; T105-F107 HydrophobicContact CG2-CE1 4.17Å; T105-F107 HydrophobicContact CG2-CE2 3.22Å; T105-F107 HydrophobicContact CG2-CZ 3.34Å; F107-Q140 HydrophobicContact CD1-CB 3.97Å; F107-Q140 HydrophobicContact CD1-CG 4.44Å; F107-Q140 HydrophobicContact CE1-CB 3.99Å; F107-Q140 HydrophobicContact CE1-CG 4.37Å
108	G	85.9	Confident	85.7	Confident	53 Å²	53	111.4 Å²	111.4	55%	0.546	56%	0.556	S	S	.	*			trans	146.1	-179.6	171.1	0	0	0	0	0	113.3
109	T	81.2	Confident	85.7	Confident	125 Å²	125	109.5 Å²	109.5	77%	0.767	55%	0.551	S	S	*	*			trans	-105	178.3	177.9	64.1	0	0	0	0	110.9
110	D	78.9	Confident	85.8	Confident	127 Å²	127	110.2 Å²	110.2	68%	0.679	55%	0.549	S	S	*	.			trans	-58.8	137.6	177.4	-76.6	-54.9	0	0	0	114.1	E112	D110-E112 HydrophobicContact CB-CG 4.41Å; D110-E112 PolarHBondContact O-N 3.33Å
111	F	73.8	Confident	85.9	Confident	98 Å²	98	112.1 Å²	112.1	43%	0.43	55%	0.552	S	S	.	*			trans	-91.6	72.7	171.6	-61.3	-81.3	0	0	0	110.8	L117	F111-L117 HydrophobicContact CD1-CD2 4.43Å
112	E	71.9	Confident	85.9	Confident	171 Å²	171	113.9 Å²	113.9	80%	0.799	55%	0.551	S	S	*	*			trans	-67.9	-39.6	-177.6	-75.7	-177.1	160.6	0	0	113.1	D110 K114	D110-E112 HydrophobicContact CB-CG 4.41Å; D110-E112 PolarHBondContact O-N 3.33Å; E112-K114 PolarHBondContact O-N 2.94Å
113	K	73.1	Confident	86	Confident	203 Å²	203	116.3 Å²	116.3	88%	0.883	56%	0.558	S	S	*	*	S	Bend	trans	-85.3	-11.1	-166.7	-66	172.8	-176.8	157.7	0	115.1
114	K	82	Confident	86.1	Confident	138 Å²	138	113.4 Å²	113.4	60%	0.6	55%	0.554	S	S	*	*			trans	-126.5	73.1	-171.2	-63.2	-174.3	-179.7	-179.4	0	112.3	E112 K116 L117 K118	E112-K114 PolarHBondContact O-N 2.94Å; K114-K116 VanDerWaalsContact C-N 3.28Å; K114-K116 PolarHBondContact O-N 2.9Å; K114-L117 HydrophobicContact CB-CB 3.75Å; K114-L117 HydrophobicContact CB-CD2 4.38Å; K114-L117 HydrophobicContact CD-CD2 3.93Å; K114-L117 PolarHBondContact O-N 3.1Å; K114-K118 PolarHBondContact O-N 3Å
115	R	85.8	Confident	86.2	Confident	228 Å²	228	113.2 Å²	113.2	86%	0.86	55%	0.553	S	S	*	*	H	α-helix	trans	-51.2	-42.3	179.8	-175.5	175.6	175.9	149.4	-1.7	113.4	K118 M119	R115-K118 PolarHBondContact O-N 2.92Å; R115-M119 PolarHBondContact O-N 2.8Å
116	K	89.6	Confident	86.1	Confident	161 Å²	161	117.9 Å²	117.9	70%	0.7	56%	0.563	S	S	*	*	H	α-helix	trans	-64.5	-43.4	178.3	-169.8	174.4	-178.4	178.7	0	111.8	K114 M119 I120	K114-K116 VanDerWaalsContact C-N 3.28Å; K114-K116 PolarHBondContact O-N 2.9Å; K116-M119 PolarHBondContact O-N 3Å; K116-I120 HydrophobicContact CG-CD1 3.93Å; K116-I120 VanDerWaalsContact O-CG1 3.31Å; K116-I120 WeakPolarHBondContact O-CG1 3.29Å; K116-I120 PolarHBondContact O-N 3.4Å
117	L	89	Confident	86.2	Confident	77 Å²	77	123.8 Å²	123.8	40%	0.403	59%	0.586	S	S	.	*	H	α-helix	trans	-65	-45.8	177.5	-175.3	61.9	0	0	0	111.2	F111 K114 M119 I120 F121	F111-L117 HydrophobicContact CD1-CD2 4.43Å; K114-L117 HydrophobicContact CB-CB 3.75Å; K114-L117 HydrophobicContact CB-CD2 4.38Å; K114-L117 HydrophobicContact CD-CD2 3.93Å; K114-L117 PolarHBondContact O-N 3.1Å; L117-M119 VanDerWaalsContact C-N 3.26Å; L117-M119 PolarHBondContact O-N 3.17Å; L117-I120 PolarHBondContact O-N 2.73Å; L117-F121 VanDerWaalsContact O-CB 3.26Å; L117-F121 WeakPolarHBondContact O-CB 3.31Å; L117-F121 PolarHBondContact O-N 3.1Å
118	K	88.7	Confident	86.2	Confident	112 Å²	112	118.7 Å²	118.7	49%	0.487	57%	0.569	S	S	.	*	H	α-helix	trans	-55.7	-42.2	175.4	-174.4	171.3	-176.1	166.6	0	111.6	K114 R115 K122	K114-K118 PolarHBondContact O-N 3Å; R115-K118 PolarHBondContact O-N 2.92Å; K118-K122 VanDerWaalsContact O-CB 3.25Å; K118-K122 WeakPolarHBondContact O-CB 3.23Å; K118-K122 PolarHBondContact O-N 3.18Å
119	M	90.8	Very high	86.2	Confident	98 Å²	98	117.3 Å²	117.3	48%	0.483	55%	0.553	S	S	.	*	H	α-helix	trans	-68.4	-45.6	178.3	-175.1	170.1	66	0	0	112.6	R115 K116 L117 K123	R115-M119 PolarHBondContact O-N 2.8Å; K116-M119 PolarHBondContact O-N 3Å; L117-M119 VanDerWaalsContact C-N 3.26Å; L117-M119 PolarHBondContact O-N 3.17Å; M119-K123 HydrophobicContact CG-CD 4.36Å; M119-K123 WeakPolarHBondContact O-CB 3.41Å; M119-K123 WeakPolarHBondContact O-CG 3.47Å; M119-K123 PolarHBondContact O-N 2.76Å
120	I	91.8	Very high	86.4	Confident	99 Å²	99	118 Å²	118	51%	0.508	55%	0.547	S	S	.	.	H	α-helix	trans	-64.2	-46.8	179	-67.7	167.1	0	0	0	110.2	K116 L117 K122 K123 G124	K116-I120 HydrophobicContact CG-CD1 3.93Å; K116-I120 VanDerWaalsContact O-CG1 3.31Å; K116-I120 WeakPolarHBondContact O-CG1 3.29Å; K116-I120 PolarHBondContact O-N 3.4Å; L117-I120 PolarHBondContact O-N 2.73Å; I120-K122 PolarHBondContact O-N 3.47Å; I120-K123 PolarHBondContact O-N 2.98Å; I120-G124 PolarHBondContact O-N 3.04Å
121	F	90.3	Very high	86.5	Confident	91 Å²	91	116.5 Å²	116.5	40%	0.399	55%	0.547	S	S	.	.	H	α-helix	trans	-58.5	-49.9	177.7	-178.4	-102.6	0	0	0	111.5	V106 L117 K123 G124 L125	V106-F121 HydrophobicContact CG1-CE1 4.35Å; V106-F121 HydrophobicContact CG1-CZ 3.98Å; V106-F121 HydrophobicContact CG2-CZ 4.36Å; L117-F121 VanDerWaalsContact O-CB 3.26Å; L117-F121 WeakPolarHBondContact O-CB 3.31Å; L117-F121 PolarHBondContact O-N 3.1Å; F121-K123 PolarHBondContact O-N 3.19Å; F121-G124 PolarHBondContact O-N 3.22Å; F121-L125 HydrophobicContact CE1-CD2 4.23Å; F121-L125 HydrophobicContact CZ-CD2 4.45Å; F121-L125 WeakPolarHBondContact O-CB 3.25Å; F121-L125 PolarHBondContact O-N 2.89Å
122	K	90.1	Very high	86.2	Confident	145 Å²	145	112.8 Å²	112.8	63%	0.63	54%	0.536	S	S	*	.	H	α-helix	trans	-57.9	-46.5	176.8	-172.2	-179.2	73.7	165.4	0	112	K118 I120 L125 W126	K118-K122 VanDerWaalsContact O-CB 3.25Å; K118-K122 WeakPolarHBondContact O-CB 3.23Å; K118-K122 PolarHBondContact O-N 3.18Å; I120-K122 PolarHBondContact O-N 3.47Å; K122-L125 PolarHBondContact O-N 3.39Å; K122-W126 VanDerWaalsContact O-CB 3.31Å; K122-W126 WeakPolarHBondContact O-CB 3.35Å; K122-W126 PolarHBondContact O-N 2.9Å
123	K	92.6	Very high	85.7	Confident	135 Å²	135	109.6 Å²	109.6	59%	0.587	53%	0.533	S	S	*	.	H	α-helix	trans	-64.1	-43	179.3	-77.3	-174.6	174.5	-170	0	111.9	M119 I120 F121 K127	M119-K123 HydrophobicContact CG-CD 4.36Å; M119-K123 WeakPolarHBondContact O-CB 3.41Å; M119-K123 WeakPolarHBondContact O-CG 3.47Å; M119-K123 PolarHBondContact O-N 2.76Å; I120-K123 PolarHBondContact O-N 2.98Å; F121-K123 PolarHBondContact O-N 3.19Å; K123-K127 WeakPolarHBondContact O-CB 3.11Å; K123-K127 PolarHBondContact O-N 3.44Å
124	G	92.1	Very high	85.7	Confident	44 Å²	44	100.9 Å²	100.9	45%	0.454	50%	0.497	S	S	.	.	H	α-helix	trans	-62.3	-46.7	177.2	0	0	0	0	0	112	I120 F121 K127 A128	I120-G124 PolarHBondContact O-N 3.04Å; F121-G124 PolarHBondContact O-N 3.22Å; G124-K127 PolarHBondContact O-N 3.11Å; G124-A128 WeakPolarHBondContact O-CB 3.06Å; G124-A128 PolarHBondContact O-N 3.18Å
125	L	92.1	Very high	85.3	Confident	32 Å²	32	95.5 Å²	95.5	17%	0.168	48%	0.479	C	S	.	.	H	α-helix	trans	-66	-41.7	179.7	-174.6	60.9	0	0	0	112.3	I104 V106 F121 K122 A128 A129 Q137	I104-L125 HydrophobicContact CB-CD1 4.4Å; I104-L125 HydrophobicContact CD1-CD1 3.94Å; I104-L125 HydrophobicContact CG2-CD1 3.7Å; V106-L125 HydrophobicContact CG2-CD2 4.11Å; F121-L125 HydrophobicContact CE1-CD2 4.23Å; F121-L125 HydrophobicContact CZ-CD2 4.45Å; F121-L125 WeakPolarHBondContact O-CB 3.25Å; F121-L125 PolarHBondContact O-N 2.89Å; K122-L125 PolarHBondContact O-N 3.39Å; L125-A128 PolarHBondContact O-N 2.81Å; L125-A129 PolarHBondContact O-N 3.26Å; L125-Q137 PolarHBondContact O-NE2 2.87Å
126	W	90.9	Very high	85	Confident	168 Å²	168	87.6 Å²	87.6	64%	0.636	45%	0.453	S	S	*	.	H	α-helix	trans	-60.7	-48.9	174.3	-180	-93.9	0	0	0	111.5	K122 A128 A129 E130	K122-W126 VanDerWaalsContact O-CB 3.31Å; K122-W126 WeakPolarHBondContact O-CB 3.35Å; K122-W126 PolarHBondContact O-N 2.9Å; W126-A128 VanDerWaalsContact C-N 3.3Å; W126-A128 PolarHBondContact O-N 3.47Å; W126-A129 PolarHBondContact O-N 2.97Å; W126-A129 VanDerWaalsContact O-N 3.12Å; W126-E130 PolarHBondContact NE1-OE2 3.38Å; W126-E130 WeakPolarHBondContact O-CB 3.47Å; W126-E130 PolarHBondContact O-N 2.92Å
127	K	90.8	Very high	84.3	Confident	155 Å²	155	83.4 Å²	83.4	67%	0.674	44%	0.436	S	S	*	.	H	α-helix	trans	-60.4	-40.6	179.1	-171.2	176.5	-177.7	-178.9	0	111.8	K123 G124 S131	K123-K127 WeakPolarHBondContact O-CB 3.11Å; K123-K127 PolarHBondContact O-N 3.44Å; G124-K127 PolarHBondContact O-N 3.11Å; K127-S131 VanDerWaalsContact O-CB 3.25Å; K127-S131 WeakPolarHBondContact O-CB 3.25Å; K127-S131 PolarHBondContact O-N 3.26Å; K127-S131 PolarHBondContact O-OG 3.4Å; K127-S131 VanDerWaalsContact O-OG 3.1Å
128	A	88.3	Confident	84	Confident	32 Å²	32	82.8 Å²	82.8	26%	0.264	44%	0.435	S	S	.	.	H	α-helix	trans	-61.6	-44.5	175.5	0	0	0	0	0	111.6	I104 G124 L125 W126 S131 G132	I104-A128 HydrophobicContact CD1-CB 3.91Å; G124-A128 WeakPolarHBondContact O-CB 3.06Å; G124-A128 PolarHBondContact O-N 3.18Å; L125-A128 PolarHBondContact O-N 2.81Å; W126-A128 VanDerWaalsContact C-N 3.3Å; W126-A128 PolarHBondContact O-N 3.47Å; A128-S131 PolarHBondContact O-OG 3.39Å; A128-G132 PolarHBondContact O-N 2.98Å
129	A	86.7	Confident	83.4	Confident	24 Å²	24	82.7 Å²	82.7	20%	0.198	44%	0.439	C	S	.	.	H	α-helix	trans	-71.4	-34.8	-179.6	0	0	0	0	0	114.2	L125 W126 A135 Q137	L125-A129 PolarHBondContact O-N 3.26Å; W126-A129 PolarHBondContact O-N 2.97Å; W126-A129 VanDerWaalsContact O-N 3.12Å; A129-A135 HydrophobicContact CB-CB 4.2Å; A129-Q137 HydrophobicContact CB-CG 4.36Å
130	E	85.9	Confident	82.6	Confident	139 Å²	139	83.8 Å²	83.8	65%	0.65	44%	0.443	S	S	*	.	H	α-helix	trans	-73.4	-34.1	176.8	-172.5	169.3	-157.9	0	0	112	W126	W126-E130 PolarHBondContact NE1-OE2 3.38Å; W126-E130 WeakPolarHBondContact O-CB 3.47Å; W126-E130 PolarHBondContact O-N 2.92Å
131	S	79.8	Confident	80.9	Confident	97 Å²	97	87.1 Å²	87.1	68%	0.678	47%	0.473	S	S	*	.	H	α-helix	trans	-72.5	-30	-179.8	68.1	0	0	0	0	114.1	K127 A128	K127-S131 VanDerWaalsContact O-CB 3.25Å; K127-S131 WeakPolarHBondContact O-CB 3.25Å; K127-S131 PolarHBondContact O-N 3.26Å; K127-S131 PolarHBondContact O-OG 3.4Å; K127-S131 VanDerWaalsContact O-OG 3.1Å; A128-S131 PolarHBondContact O-OG 3.39Å
132	G	67.3	Low	80.4	Confident	19 Å²	19	87 Å²	87	20%	0.196	48%	0.477	C	S	.	.	S	Bend	trans	-88.8	115.1	176.2	0	0	0	0	0	109.2	A128 S134 A135	A128-G132 PolarHBondContact O-N 2.98Å; G132-S134 PolarHBondContact O-N 3.5Å; G132-A135 PolarHBondContact O-N 3.34Å
133	S	61.9	Low	79.9	Confident	104 Å²	104	83.9 Å²	83.9	73%	0.727	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.7	4.5	179	55.8	0	0	0	0	115.2
134	S	72.7	Confident	79.2	Confident	20 Å²	20	81.1 Å²	81.1	14%	0.14	46%	0.462	C	S	.	.	T	Hydrogen-bonded Turn	trans	-162.5	43.9	172.1	-56.5	0	0	0	0	111.3	K98 P100 T101 G132 L136	K98-S134 VanDerWaalsContact CD-OG 3.29Å; K98-S134 WeakPolarHBondContact CD-OG 3.44Å; P100-S134 WeakPolarHBondContact CA-O 3.31Å; P100-S134 WeakPolarHBondContact CB-O 3.29Å; T101-S134 PolarHBondContact N-O 3.04Å; G132-S134 PolarHBondContact O-N 3.5Å; S134-L136 PolarHBondContact O-N 2.88Å
135	A	74.6	Confident	78.5	Confident	25 Å²	25	83.2 Å²	83.2	21%	0.207	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	129.4	176.8	0	0	0	0	0	110.9	A129 G132	A129-A135 HydrophobicContact CB-CB 4.2Å; G132-A135 PolarHBondContact O-N 3.34Å
136	L	79	Confident	77.6	Confident	63 Å²	63	86.4 Å²	86.4	33%	0.33	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	123	173.8	-175.2	65.7	0	0	0	109.7	P100 L102 I104 S134 V138	P100-L136 HydrophobicContact CB-CB 3.68Å; P100-L136 HydrophobicContact CG-CB 3.96Å; P100-L136 HydrophobicContact CG-CD2 4.17Å; L102-L136 PolarHBondContact O-N 2.84Å; I104-L136 PolarHBondContact N-O 2.83Å; S134-L136 PolarHBondContact O-N 2.88Å; L136-V138 HydrophobicContact CD2-CG2 4.45Å; L136-V138 HydrophobicContact CG-CG2 4.39Å
137	Q	75.9	Confident	76.7	Confident	73 Å²	73	81 Å²	81	34%	0.341	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	121.3	173.6	-65.7	179.9	-6	0	0	109.3	L125 A129	L125-Q137 PolarHBondContact O-NE2 2.87Å; A129-Q137 HydrophobicContact CB-CG 4.36Å
138	V	81.3	Confident	75.7	Confident	63 Å²	63	75.7 Å²	75.7	38%	0.382	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	115.3	172.6	-177.5	0	0	0	0	107.4	I103 I104 T105 V106 L136	I103-V138 HydrophobicContact CG2-CG2 4.26Å; I104-V138 PolarHBondContact O-N 3.38Å; T105-V138 WeakPolarHBondContact CA-O 3.42Å; T105-V138 HydrophobicContact CG2-CB 4.43Å; T105-V138 HydrophobicContact CG2-CG1 4.47Å; V106-V138 PolarHBondContact N-O 2.99Å; L136-V138 HydrophobicContact CD2-CG2 4.45Å; L136-V138 HydrophobicContact CG-CG2 4.39Å
139	I	76.8	Confident	74.8	Confident	111 Å²	111	79.1 Å²	79.1	57%	0.569	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.5	119.5	178	-58.4	173.9	0	0	0	107.2
140	Q	73.5	Confident	73.8	Confident	120 Å²	120	83.7 Å²	83.7	56%	0.561	49%	0.494	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.4	111.3	171	-171.3	173	-37.4	0	0	107.9	V106 F107	V106-Q140 PolarHBondContact O-N 2.75Å; F107-Q140 HydrophobicContact CD1-CB 3.97Å; F107-Q140 HydrophobicContact CD1-CG 4.44Å; F107-Q140 HydrophobicContact CE1-CB 3.99Å; F107-Q140 HydrophobicContact CE1-CG 4.37Å
141	C	56.3	Low	72.7	Confident	170 Å²	170	78.6 Å²	78.6	100%	1.149	48%	0.48	S	S	*	.			trans	-83.6	0	173.6	-58.9	0	0	0	0	111.4

Retrieved 141 of 141 residues in 195.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).