A0A5K4FD35_SCHMA Loading...

Alternative protein

AlphaFold DB (A0A5K4F9I6), UniProt , Accession A0A5K4FD35, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 141 aa.

						>A0A5K4FD35_SCHMA|A0A5K4FD35
MKCQENTKPKIYIFTNATRLMSQSSLQQRSRPQMSQSSLQQRSRSQMSQSSLQQRSRPQMSQSSLQQRSRSQMSQSSLQQRSRPQMSQSSLQQRSRSQMSQSSLQQRSRPQMSQSSLQQRSRSQMSQSSLQQRSRPQMSQS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.7	Very low	46.9	Very low	244 Å²	244	132.1 Å²	132.1	100%	1.202	67%	0.669	S	S	*	*				0	103.3	0	-74.6	150.4	150.5	0	0	108.5
2	K	34.3	Very low	48.5	Very low	213 Å²	213	132.6 Å²	132.6	93%	0.926	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-93.2	116	-178.9	-79.6	178.3	176.4	176.1	0	109.4
3	C	37.4	Very low	49.7	Very low	128 Å²	128	127.2 Å²	127.2	87%	0.865	63%	0.632	S	S	*	*	P	Polyproline II helix	trans	-64.9	132.8	176.8	-59.7	0	0	0	0	110.5	E5	C3-E5 PolarHBondContact O-N 3.29Å
4	Q	35.5	Very low	51	Low	178 Å²	178	127.6 Å²	127.6	83%	0.832	63%	0.629	S	S	*	*	P	Polyproline II helix	trans	-61.1	123.8	176.8	-73.1	-172.4	30.6	0	0	111.5	N6	Q4-N6 PolarHBondContact O-N 3.2Å
5	E	41.5	Very low	52	Low	173 Å²	173	121.3 Å²	121.3	81%	0.808	60%	0.6	S	S	*	*			trans	-69.1	95.8	166.1	-167.2	178.5	151.1	0	0	109	C3 T7	C3-E5 PolarHBondContact O-N 3.29Å; E5-T7 PolarHBondContact O-N 3.04Å; E5-T7 VanDerWaalsContact O-N 3.09Å
6	N	46.3	Very low	52.9	Low	112 Å²	112	121.6 Å²	121.6	60%	0.599	61%	0.605	S	S	*	*			trans	-84.8	80.6	-177.3	-148	-21.3	0	0	0	109.5	Q4 K8	Q4-N6 PolarHBondContact O-N 3.2Å; N6-K8 PolarHBondContact O-N 3.17Å
7	T	51.2	Low	53.5	Low	112 Å²	112	116.1 Å²	116.1	69%	0.687	58%	0.583	S	S	*	*			trans	-66.9	122.1	179.3	10.3	0	0	0	0	110.8	E5	E5-T7 PolarHBondContact O-N 3.04Å; E5-T7 VanDerWaalsContact O-N 3.09Å
8	K	56.2	Low	53.7	Low	53 Å²	53	116.2 Å²	116.2	23%	0.23	59%	0.591	C	S	.	*			trans	-72.7	148.2	-170.6	-49.7	162.1	-176.2	168.3	0	111.7	N6 K10 P32 M34	N6-K8 PolarHBondContact O-N 3.17Å; K8-K10 PolarHBondContact O-N 3.29Å; K8-P32 HydrophobicContact CG-CB 4.28Å; K8-P32 HydrophobicContact CG-CG 4.12Å; K8-M34 HydrophobicContact CD-CB 4.38Å; K8-M34 WeakPolarHBondContact CD-O 3.32Å; K8-M34 VanDerWaalsContact CE-C 3.42Å; K8-M34 VanDerWaalsContact CE-CB 3.4Å; K8-M34 VanDerWaalsContact CE-CG 3.48Å; K8-M34 WeakPolarHBondContact CE-O 3.29Å; K8-M34 WeakPolarHBondContact CG-O 3.49Å; K8-M34 PolarHBondContact NZ-SD 2.89Å
9	P	55	Low	54.4	Low	60 Å²	60	120.7 Å²	120.7	39%	0.39	60%	0.6	S	S	.	*			trans	-68.9	105.9	167.4	28.6	-32.1	0	0	0	109.5	I11	P9-I11 HydrophobicContact CB-CD1 4.22Å; P9-I11 HydrophobicContact CB-CG1 4.45Å; P9-I11 PolarHBondContact O-N 3.09Å
10	K	61.1	Low	55.2	Low	130 Å²	130	121.6 Å²	121.6	57%	0.565	61%	0.606	S	S	*	*			trans	-84.1	105.4	163.2	-71.2	-177.4	-178.9	174.9	0	107.5	K8 Y12	K8-K10 PolarHBondContact O-N 3.29Å; K10-Y12 HydrophobicContact CB-CD2 4.34Å; K10-Y12 HydrophobicContact CB-CE2 3.79Å; K10-Y12 HydrophobicContact CD-CE2 4.27Å
11	I	60.5	Low	55.9	Low	50 Å²	50	120.6 Å²	120.6	26%	0.256	60%	0.601	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.5	115.4	177.6	-71.9	163.8	0	0	0	108	P9 I13 L26 Q28 S38	P9-I11 HydrophobicContact CB-CD1 4.22Å; P9-I11 HydrophobicContact CB-CG1 4.45Å; P9-I11 PolarHBondContact O-N 3.09Å; I11-I13 HydrophobicContact CG2-CD1 3.92Å; I11-I13 HydrophobicContact CG2-CG1 3.54Å; I11-L26 HydrophobicContact CG2-CD1 4.08Å; I11-Q28 VanDerWaalsContact CD1-CD 3.48Å; I11-S38 PolarHBondContact O-N 2.87Å
12	Y	66.8	Low	57.8	Low	138 Å²	138	109.4 Å²	109.4	54%	0.541	55%	0.547	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	111.9	169.5	-64.3	-86.9	0	0	0	106.9	K10 S38	K10-Y12 HydrophobicContact CB-CD2 4.34Å; K10-Y12 HydrophobicContact CB-CE2 3.79Å; K10-Y12 HydrophobicContact CD-CE2 4.27Å; Y12-S38 WeakPolarHBondContact CA-O 2.91Å
13	I	63.5	Low	59.7	Low	62 Å²	62	105.5 Å²	105.5	32%	0.318	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	122.4	173.1	-52.3	-161.3	0	0	0	108.1	I11 T15 L26 L39 Q40	I11-I13 HydrophobicContact CG2-CD1 3.92Å; I11-I13 HydrophobicContact CG2-CG1 3.54Å; I13-T15 HydrophobicContact CG2-CG2 3.98Å; I13-L26 HydrophobicContact CD1-CD1 3.4Å; I13-L26 HydrophobicContact CD1-CG 4.12Å; I13-L26 HydrophobicContact CG1-CD1 3.87Å; I13-L39 HydrophobicContact CB-CD1 4.38Å; I13-Q40 PolarHBondContact O-N 3.43Å
14	F	68	Low	61.4	Low	134 Å²	134	100.8 Å²	100.8	59%	0.588	50%	0.501	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.9	116.8	170.5	-60.6	-83.6	0	0	0	108.3	Q40	F14-Q40 WeakPolarHBondContact CA-O 3.04Å; F14-Q40 HydrophobicContact CD1-CB 3.75Å; F14-Q40 HydrophobicContact CD1-CG 4.29Å; F14-Q40 HydrophobicContact CE1-CB 3.82Å; F14-Q40 HydrophobicContact CE1-CG 4.41Å
15	T	66.2	Low	63.3	Low	32 Å²	32	97.1 Å²	97.1	20%	0.196	49%	0.494	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	136.3	171.6	58.6	0	0	0	0	109.8	I13 Q40 Q41 R42	I13-T15 HydrophobicContact CG2-CG2 3.98Å; T15-Q40 PolarHBondContact N-O 3.07Å; T15-Q41 VanDerWaalsContact CG2-NE2 3.29Å; T15-Q41 WeakPolarHBondContact OG1-CG 3.37Å; T15-Q41 PolarHBondContact OG1-NE2 3.2Å; T15-Q41 PolarHBondContact OG1-OE1 2.89Å; T15-R42 PolarHBondContact O-N 3.27Å
16	N	66.4	Low	64.8	Low	126 Å²	126	89.6 Å²	89.6	67%	0.674	46%	0.46	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.2	117.8	166.6	-70.7	-67.4	0	0	0	107	R42	N16-R42 WeakPolarHBondContact CA-O 3.05Å; N16-R42 WeakPolarHBondContact OD1-CB 2.94Å; N16-R42 WeakPolarHBondContact OD1-CD 3.2Å
17	A	62.6	Low	66.3	Low	29 Å²	29	90.5 Å²	90.5	24%	0.24	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.2	137.5	-179.8	0	0	0	0	0	111.6	S22 R42 R44	A17-S22 WeakPolarHBondContact CB-OG 3.35Å; A17-R42 PolarHBondContact N-O 3.06Å; A17-R44 PolarHBondContact O-N 3.27Å
18	T	57.7	Low	67.1	Low	118 Å²	118	86.3 Å²	86.3	72%	0.724	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.7	96.8	172.5	-48.3	0	0	0	0	107.9	R44	T18-R44 WeakPolarHBondContact CA-O 3.41Å
19	R	67.1	Low	67.6	Low	201 Å²	201	92.5 Å²	92.5	76%	0.758	46%	0.455	S	S	*	.	S	Bend	trans	-156	166.9	178.6	-74.9	-162.8	-169.1	-133.9	2.2	109.9	M21 R44 S45	R19-M21 WeakPolarHBondContact CB-O 3.37Å; R19-M21 PolarHBondContact O-N 3.35Å; R19-R44 PolarHBondContact N-O 2.92Å; R19-S45 WeakPolarHBondContact O-CA 3.1Å; R19-S45 WeakPolarHBondContact O-CB 3Å
20	L	70.7	Confident	67.9	Low	139 Å²	139	89.9 Å²	89.9	73%	0.728	44%	0.438	S	S	*	.	S	Bend	trans	-53.1	-38.7	173.5	-71	171.7	0	0	0	112.1	Q46 M47	L20-Q46 HydrophobicContact CD2-CG 4.26Å; L20-Q46 WeakPolarHBondContact O-CB 3.39Å; L20-Q46 PolarHBondContact O-N 2.96Å; L20-M47 PolarHBondContact O-N 3.2Å
21	M	70.3	Confident	68	Low	100 Å²	100	91.6 Å²	91.6	49%	0.493	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	141.7	174.3	-63.3	177.3	70.1	0	0	110.9	R19 M47	R19-M21 WeakPolarHBondContact CB-O 3.37Å; R19-M21 PolarHBondContact O-N 3.35Å; M21-M47 WeakPolarHBondContact CA-O 3.31Å; M21-M47 HydrophobicContact CE-SD 3.96Å; M21-M47 HydrophobicContact CG-CB 4.37Å
22	S	74.8	Confident	68	Low	10 Å²	10	90 Å²	90	7%	0.07	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	123	171.9	-179.9	0	0	0	0	109.3	A17 M47 Q49	A17-S22 WeakPolarHBondContact CB-OG 3.35Å; S22-M47 PolarHBondContact N-O 3.26Å; S22-M47 VanDerWaalsContact N-O 3.14Å; S22-Q49 PolarHBondContact O-N 2.91Å
23	Q	74.8	Confident	67.7	Low	130 Å²	130	90.5 Å²	90.5	61%	0.607	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.5	140.4	177.5	-63.8	-168.7	0.9	0	0	110.8	Q49	Q23-Q49 WeakPolarHBondContact CA-O 3.43Å; Q23-Q49 HydrophobicContact CG-CB 4.28Å
24	S	72.6	Confident	67.7	Low	30 Å²	30	91.2 Å²	91.2	21%	0.21	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.5	129.6	171.1	-77	0	0	0	0	110.4	Q41 Q49 S50 S51	S24-Q41 VanDerWaalsContact CB-CD 3.47Å; S24-Q41 PolarHBondContact OG-NE2 3.09Å; S24-Q41 PolarHBondContact OG-OE1 3.09Å; S24-Q41 VanDerWaalsContact OG-OE1 3.04Å; S24-Q49 PolarHBondContact N-O 3.42Å; S24-Q49 VanDerWaalsContact N-O 3.14Å; S24-S50 WeakPolarHBondContact O-CA 3.29Å; S24-S51 PolarHBondContact O-N 3.45Å
25	S	76.9	Confident	67.7	Low	100 Å²	100	84.9 Å²	84.9	70%	0.699	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-126.3	131.5	178.2	-179.1	0	0	0	0	108.9	S51	S25-S51 WeakPolarHBondContact CA-O 3.38Å; S25-S51 WeakPolarHBondContact CB-OG 3.42Å; S25-S51 PolarHBondContact OG-OG 2.83Å
26	L	73.4	Confident	68	Low	16 Å²	16	86.4 Å²	86.4	8%	0.084	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133	124.5	178.6	-167.8	174	0	0	0	109.3	I11 I13 Q28 L39 S51 L52 Q53	I11-L26 HydrophobicContact CG2-CD1 4.08Å; I13-L26 HydrophobicContact CD1-CD1 3.4Å; I13-L26 HydrophobicContact CD1-CG 4.12Å; I13-L26 HydrophobicContact CG1-CD1 3.87Å; L26-Q28 HydrophobicContact CD2-CB 4.47Å; L26-Q28 HydrophobicContact CD2-CG 3.46Å; L26-Q28 VanDerWaalsContact CD2-CG 3.46Å; L26-L39 HydrophobicContact CB-CD1 4.19Å; L26-L39 HydrophobicContact CD1-CD1 3.63Å; L26-S51 PolarHBondContact N-O 2.91Å; L26-L52 HydrophobicContact CB-CD1 3.81Å; L26-L52 HydrophobicContact CD1-CD1 4.19Å; L26-L52 HydrophobicContact CD2-CD1 3.77Å; L26-L52 HydrophobicContact CG-CD1 4.14Å; L26-Q53 PolarHBondContact O-N 2.83Å
27	Q	75.8	Confident	68.2	Low	131 Å²	131	81 Å²	81	61%	0.612	39%	0.393	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-111.9	126.2	173.9	-168.6	174.4	47	0	0	110.3	Q53	Q27-Q53 CarbonylContact C-O 3.58Å; Q27-Q53 VanDerWaalsContact CA-O 3.31Å; Q27-Q53 WeakPolarHBondContact CA-O 3.39Å; Q27-Q53 HydrophobicContact CG-CB 4.33Å
28	Q	68.2	Low	68.9	Low	24 Å²	24	81.7 Å²	81.7	11%	0.112	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	142.8	173.1	-73.6	-54.6	-47	0	0	111.6	I11 L26 Q53 Q54 R55	I11-Q28 VanDerWaalsContact CD1-CD 3.48Å; L26-Q28 HydrophobicContact CD2-CB 4.47Å; L26-Q28 HydrophobicContact CD2-CG 3.46Å; L26-Q28 VanDerWaalsContact CD2-CG 3.46Å; Q28-Q53 PolarHBondContact N-O 2.93Å; Q28-Q54 HydrophobicContact CB-CG 4.34Å; Q28-R55 PolarHBondContact O-N 2.92Å
29	R	67.8	Low	69.7	Low	182 Å²	182	76.4 Å²	76.4	69%	0.687	36%	0.364	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-135.2	115.3	171.5	-164.4	179.1	-174.8	-152.7	5.4	109.2	R55	R29-R55 VanDerWaalsContact CA-O 3.32Å; R29-R55 WeakPolarHBondContact CA-O 3.43Å; R29-R55 HydrophobicContact CG-CB 4.33Å
30	S	61.4	Low	70.3	Confident	5 Å²	5	70.7 Å²	70.7	4%	0.035	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	133.7	-175.9	-42.2	0	0	0	0	111.2	S35 R55 R57	S30-S35 WeakPolarHBondContact CB-OG 3.21Å; S30-S35 PolarHBondContact OG-OG 3.21Å; S30-R55 PolarHBondContact N-O 3.01Å; S30-R57 PolarHBondContact O-N 2.98Å
31	R	62.9	Low	70.4	Confident	166 Å²	166	64.2 Å²	64.2	63%	0.626	31%	0.312	S	S	*	.			trans	-115.4	16.9	169.3	-62	-173	179.7	-161.6	5	117.6
32	P	61	Low	70.8	Confident	16 Å²	16	64 Å²	64	10%	0.104	31%	0.305	C	S	.	.	S	Bend	trans	-79.4	175.9	176.1	33.5	-35.8	0	0	0	112.8	K8 M34 P58	K8-P32 HydrophobicContact CG-CB 4.28Å; K8-P32 HydrophobicContact CG-CG 4.12Å; P32-M34 VanDerWaalsContact C-N 3.25Å; P32-M34 WeakPolarHBondContact CG-O 3.44Å; P32-M34 PolarHBondContact O-N 2.84Å; P32-P58 WeakPolarHBondContact O-CA 3.39Å; P32-P58 WeakPolarHBondContact O-CB 2.93Å
33	Q	60.4	Low	70.7	Confident	150 Å²	150	63.6 Å²	63.6	70%	0.701	30%	0.302	S	S	*	.	S	Bend	trans	-59.7	-28.1	177.3	-83	-173.1	-21.1	0	0	114.2	P58 Q59	Q33-P58 VanDerWaalsContact O-CB 3.29Å; Q33-P58 WeakPolarHBondContact O-CB 2.86Å; Q33-Q59 PolarHBondContact O-N 2.91Å
34	M	62.6	Low	70.8	Confident	77 Å²	77	63.1 Å²	63.1	38%	0.379	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.4	155.6	167.1	-4.1	168.1	-149.9	0	0	111.6	K8 P32 M60	K8-M34 HydrophobicContact CD-CB 4.38Å; K8-M34 WeakPolarHBondContact CD-O 3.32Å; K8-M34 VanDerWaalsContact CE-C 3.42Å; K8-M34 VanDerWaalsContact CE-CB 3.4Å; K8-M34 VanDerWaalsContact CE-CG 3.48Å; K8-M34 WeakPolarHBondContact CE-O 3.29Å; K8-M34 WeakPolarHBondContact CG-O 3.49Å; K8-M34 PolarHBondContact NZ-SD 2.89Å; P32-M34 VanDerWaalsContact C-N 3.25Å; P32-M34 WeakPolarHBondContact CG-O 3.44Å; P32-M34 PolarHBondContact O-N 2.84Å; M34-M60 CarbonylContact C-O 3.55Å; M34-M60 WeakPolarHBondContact CA-O 3.04Å; M34-M60 HydrophobicContact CB-CB 4.24Å; M34-M60 WeakPolarHBondContact CB-O 3.17Å; M34-M60 HydrophobicContact CG-CE 4.29Å; M34-M60 HydrophobicContact SD-CE 3.76Å
35	S	68	Low	70.8	Confident	1 Å²	1	62.4 Å²	62.4	1%	0.007	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	139.5	174.2	-176	0	0	0	0	110.9	S30 M60 Q62	S30-S35 WeakPolarHBondContact CB-OG 3.21Å; S30-S35 PolarHBondContact OG-OG 3.21Å; S35-M60 PolarHBondContact N-O 3.29Å; S35-Q62 PolarHBondContact O-N 3.03Å
36	Q	72.5	Confident	70.9	Confident	64 Å²	64	62.3 Å²	62.3	30%	0.299	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.6	129.5	-179.6	-78.7	177.7	-11.3	0	0	110.4	Q62	Q36-Q62 WeakPolarHBondContact CA-O 3.38Å; Q36-Q62 HydrophobicContact CG-CB 4.06Å
37	S	70.5	Confident	71.1	Confident	11 Å²	11	64 Å²	64	8%	0.077	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	136.3	174.6	-67.1	0	0	0	0	111.4	Q54 Q62 S63 S64	S37-Q54 PolarHBondContact OG-NE2 2.82Å; S37-Q62 PolarHBondContact N-O 3Å; S37-Q62 VanDerWaalsContact N-O 3.08Å; S37-S63 WeakPolarHBondContact O-CA 3.42Å; S37-S64 PolarHBondContact O-N 2.91Å
38	S	76.6	Confident	71.3	Confident	44 Å²	44	57.8 Å²	57.8	31%	0.308	26%	0.258	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	128.1	177.2	-172.7	0	0	0	0	110.2	I11 Y12 S64	I11-S38 PolarHBondContact O-N 2.87Å; Y12-S38 WeakPolarHBondContact CA-O 2.91Å; S38-S64 WeakPolarHBondContact CA-O 3.25Å
39	L	74.7	Confident	71.9	Confident	8 Å²	8	59.3 Å²	59.3	4%	0.042	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	122.7	179.4	179.1	139.4	0	0	0	109.7	I13 L26 Q41 S64 L65 Q66	I13-L39 HydrophobicContact CB-CD1 4.38Å; L26-L39 HydrophobicContact CB-CD1 4.19Å; L26-L39 HydrophobicContact CD1-CD1 3.63Å; L39-Q41 HydrophobicContact CD2-CB 4.36Å; L39-Q41 HydrophobicContact CD2-CG 3.28Å; L39-Q41 HydrophobicContact CG-CG 4.02Å; L39-S64 PolarHBondContact N-O 2.89Å; L39-L65 HydrophobicContact CD2-CD1 3.68Å; L39-L65 HydrophobicContact CD2-CG 3.84Å; L39-Q66 PolarHBondContact O-N 2.79Å
40	Q	79.8	Confident	72.4	Confident	81 Å²	81	50.9 Å²	50.9	38%	0.379	23%	0.234	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	119.1	174.5	-172	-177.1	63.5	0	0	109	I13 F14 T15 Q66	I13-Q40 PolarHBondContact O-N 3.43Å; F14-Q40 WeakPolarHBondContact CA-O 3.04Å; F14-Q40 HydrophobicContact CD1-CB 3.75Å; F14-Q40 HydrophobicContact CD1-CG 4.29Å; F14-Q40 HydrophobicContact CE1-CB 3.82Å; F14-Q40 HydrophobicContact CE1-CG 4.41Å; T15-Q40 PolarHBondContact N-O 3.07Å; Q40-Q66 CarbonylContact C-O 3.59Å; Q40-Q66 VanDerWaalsContact CA-O 3.32Å; Q40-Q66 WeakPolarHBondContact CA-O 3.32Å; Q40-Q66 HydrophobicContact CG-CB 4.42Å
41	Q	73.5	Confident	73.4	Confident	3 Å²	3	53 Å²	53	1%	0.014	25%	0.248	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	134.3	179.8	-69.6	-101.6	-23.3	0	0	109.8	T15 S24 L39 Q66 Q67 R68	T15-Q41 VanDerWaalsContact CG2-NE2 3.29Å; T15-Q41 WeakPolarHBondContact OG1-CG 3.37Å; T15-Q41 PolarHBondContact OG1-NE2 3.2Å; T15-Q41 PolarHBondContact OG1-OE1 2.89Å; S24-Q41 VanDerWaalsContact CB-CD 3.47Å; S24-Q41 PolarHBondContact OG-NE2 3.09Å; S24-Q41 PolarHBondContact OG-OE1 3.09Å; S24-Q41 VanDerWaalsContact OG-OE1 3.04Å; L39-Q41 HydrophobicContact CD2-CB 4.36Å; L39-Q41 HydrophobicContact CD2-CG 3.28Å; L39-Q41 HydrophobicContact CG-CG 4.02Å; Q41-Q66 PolarHBondContact N-O 2.82Å; Q41-Q67 VanDerWaalsContact CB-CD 3.43Å; Q41-Q67 VanDerWaalsContact CG-NE2 3.27Å; Q41-Q67 CarbonylContact O-C 3.58Å; Q41-R68 PolarHBondContact O-N 2.86Å
42	R	78.8	Confident	74.2	Confident	95 Å²	95	45.2 Å²	45.2	36%	0.358	22%	0.219	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	116.2	175.1	-173.5	178.3	-178.6	-170.3	-1.3	109.6	T15 N16 A17 R68	T15-R42 PolarHBondContact O-N 3.27Å; N16-R42 WeakPolarHBondContact CA-O 3.05Å; N16-R42 WeakPolarHBondContact OD1-CB 2.94Å; N16-R42 WeakPolarHBondContact OD1-CD 3.2Å; A17-R42 PolarHBondContact N-O 3.06Å; R42-R68 VanDerWaalsContact CA-O 3.31Å; R42-R68 WeakPolarHBondContact CA-O 3.46Å; R42-R68 HydrophobicContact CG-CB 4.46Å
43	S	73.3	Confident	75.2	Confident	1 Å²	1	47.4 Å²	47.4	1%	0.007	23%	0.228	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-126	143.1	-176.1	55.3	0	0	0	0	111.7	S48 R68 S69 R70	S43-S48 WeakPolarHBondContact CB-OG 3.32Å; S43-S48 WeakPolarHBondContact OG-CB 2.98Å; S43-S48 PolarHBondContact OG-OG 3.25Å; S43-R68 PolarHBondContact N-O 2.89Å; S43-S69 PolarHBondContact OG-OG 3.26Å; S43-R70 PolarHBondContact O-N 3.02Å
44	R	76.6	Confident	75.9	Confident	120 Å²	120	40.3 Å²	40.3	45%	0.453	20%	0.195	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	103.4	166.6	-61.5	-171.7	-173.2	-173.7	7.4	107.7	A17 T18 R19 R70	A17-R44 PolarHBondContact O-N 3.27Å; T18-R44 WeakPolarHBondContact CA-O 3.41Å; R19-R44 PolarHBondContact N-O 2.92Å; R44-R70 WeakPolarHBondContact CA-O 3.43Å; R44-R70 HydrophobicContact CG-CB 4.32Å
45	S	72.9	Confident	76.4	Confident	16 Å²	16	42 Å²	42	11%	0.112	20%	0.197	C	C	.	.	S	Bend	trans	-158.4	172	-169.6	57.1	0	0	0	0	112	R19 M47 R70 S71	R19-S45 WeakPolarHBondContact O-CA 3.1Å; R19-S45 WeakPolarHBondContact O-CB 3Å; S45-M47 WeakPolarHBondContact CB-O 3.3Å; S45-M47 PolarHBondContact OG-O 2.94Å; S45-R70 PolarHBondContact N-O 2.83Å; S45-S71 WeakPolarHBondContact O-CA 3.37Å; S45-S71 WeakPolarHBondContact O-CB 3.38Å
46	Q	77.6	Confident	76.2	Confident	97 Å²	97	42 Å²	42	45%	0.453	20%	0.197	S	C	.	.	S	Bend	trans	-69.2	-41.2	166.2	-75.8	-76.3	-4.8	0	0	110	L20 S71 Q72 M73	L20-Q46 HydrophobicContact CD2-CG 4.26Å; L20-Q46 WeakPolarHBondContact O-CB 3.39Å; L20-Q46 PolarHBondContact O-N 2.96Å; Q46-S71 WeakPolarHBondContact O-CB 3.33Å; Q46-Q72 PolarHBondContact O-N 2.98Å; Q46-Q72 VanDerWaalsContact OE1-CG 3.24Å; Q46-M73 PolarHBondContact O-N 2.9Å; Q46-M73 VanDerWaalsContact O-N 3.13Å
47	M	77.4	Confident	76	Confident	53 Å²	53	45.2 Å²	45.2	26%	0.261	21%	0.207	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.9	135.8	179.1	-171.7	-178	-68	0	0	111.9	L20 M21 S22 S45 Q49 M73	L20-M47 PolarHBondContact O-N 3.2Å; M21-M47 WeakPolarHBondContact CA-O 3.31Å; M21-M47 HydrophobicContact CE-SD 3.96Å; M21-M47 HydrophobicContact CG-CB 4.37Å; S22-M47 PolarHBondContact N-O 3.26Å; S22-M47 VanDerWaalsContact N-O 3.14Å; S45-M47 WeakPolarHBondContact CB-O 3.3Å; S45-M47 PolarHBondContact OG-O 2.94Å; M47-Q49 HydrophobicContact CG-CG 4.18Å; M47-Q49 HydrophobicContact SD-CG 4.21Å; M47-M73 WeakPolarHBondContact CA-O 3.33Å; M47-M73 HydrophobicContact CE-SD 4.06Å; M47-M73 HydrophobicContact CG-CB 4.49Å
48	S	79.8	Confident	75.5	Confident	0 Å²	0	45.2 Å²	45.2	0%	0	21%	0.207	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	124.3	173.5	-176.6	0	0	0	0	110.1	S43 M73 S74 Q75	S43-S48 WeakPolarHBondContact CB-OG 3.32Å; S43-S48 WeakPolarHBondContact OG-CB 2.98Å; S43-S48 PolarHBondContact OG-OG 3.25Å; S48-M73 PolarHBondContact N-O 2.86Å; S48-S74 WeakPolarHBondContact O-CA 3.49Å; S48-Q75 PolarHBondContact O-N 2.89Å
49	Q	81.1	Confident	74.9	Confident	55 Å²	55	48.5 Å²	48.5	26%	0.257	22%	0.217	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	130.9	178.6	-63.9	-179.9	-36.6	0	0	110.7	S22 Q23 S24 M47 Q75	S22-Q49 PolarHBondContact O-N 2.91Å; Q23-Q49 WeakPolarHBondContact CA-O 3.43Å; Q23-Q49 HydrophobicContact CG-CB 4.28Å; S24-Q49 PolarHBondContact N-O 3.42Å; S24-Q49 VanDerWaalsContact N-O 3.14Å; M47-Q49 HydrophobicContact CG-CG 4.18Å; M47-Q49 HydrophobicContact SD-CG 4.21Å; Q49-Q75 WeakPolarHBondContact CA-O 3.36Å; Q49-Q75 HydrophobicContact CG-CB 4.24Å
50	S	79.3	Confident	74.4	Confident	5 Å²	5	51.3 Å²	51.3	4%	0.035	23%	0.231	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	132.1	174.8	-80.6	0	0	0	0	112	S24 Q67 Q75 S76 S77	S24-S50 WeakPolarHBondContact O-CA 3.29Å; S50-Q67 VanDerWaalsContact OG-CD 3.31Å; S50-Q67 PolarHBondContact OG-NE2 2.85Å; S50-Q67 PolarHBondContact OG-OE1 2.89Å; S50-Q67 VanDerWaalsContact OG-OE1 3.12Å; S50-Q75 PolarHBondContact N-O 2.87Å; S50-S76 CarbonylContact O-C 3.59Å; S50-S76 WeakPolarHBondContact O-CA 3.38Å; S50-S77 PolarHBondContact O-N 3.08Å
51	S	81.6	Confident	74	Confident	49 Å²	49	47.5 Å²	47.5	34%	0.343	21%	0.213	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	130.9	176.8	58.8	0	0	0	0	111.3	S24 S25 L26 S77	S24-S51 PolarHBondContact O-N 3.45Å; S25-S51 WeakPolarHBondContact CA-O 3.38Å; S25-S51 WeakPolarHBondContact CB-OG 3.42Å; S25-S51 PolarHBondContact OG-OG 2.83Å; L26-S51 PolarHBondContact N-O 2.91Å; S51-S77 CarbonylContact C-O 3.57Å; S51-S77 VanDerWaalsContact CA-O 3.28Å; S51-S77 WeakPolarHBondContact CA-O 3.16Å
52	L	81.3	Confident	74.2	Confident	4 Å²	4	51 Å²	51	2%	0.021	23%	0.229	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	118.9	174.1	-174	69.6	0	0	0	109.6	L26 Q54 L65 S77 L78 Q79	L26-L52 HydrophobicContact CB-CD1 3.81Å; L26-L52 HydrophobicContact CD1-CD1 4.19Å; L26-L52 HydrophobicContact CD2-CD1 3.77Å; L26-L52 HydrophobicContact CG-CD1 4.14Å; L52-Q54 HydrophobicContact CD1-CG 4.21Å; L52-Q54 HydrophobicContact CD2-CG 3.93Å; L52-Q54 HydrophobicContact CG-CG 3.8Å; L52-L65 HydrophobicContact CB-CD1 3.75Å; L52-L65 HydrophobicContact CD2-CD1 4.24Å; L52-S77 PolarHBondContact N-O 3.5Å; L52-L78 HydrophobicContact CB-CB 4.43Å; L52-L78 HydrophobicContact CB-CD1 4.46Å; L52-L78 HydrophobicContact CB-CG 4.27Å; L52-L78 HydrophobicContact CD2-CD1 3.67Å; L52-L78 HydrophobicContact CD2-CG 4.09Å; L52-L78 CarbonylContact O-C 3.57Å; L52-L78 WeakPolarHBondContact O-CA 3.31Å; L52-Q79 PolarHBondContact O-N 2.81Å
53	Q	81.5	Confident	74.1	Confident	62 Å²	62	46.7 Å²	46.7	29%	0.29	21%	0.214	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	123.5	170.6	-113	-172.2	23.2	0	0	110.3	L26 Q27 Q28 Q79	L26-Q53 PolarHBondContact O-N 2.83Å; Q27-Q53 CarbonylContact C-O 3.58Å; Q27-Q53 VanDerWaalsContact CA-O 3.31Å; Q27-Q53 WeakPolarHBondContact CA-O 3.39Å; Q27-Q53 HydrophobicContact CG-CB 4.33Å; Q28-Q53 PolarHBondContact N-O 2.93Å; Q53-Q79 CarbonylContact C-O 3.59Å; Q53-Q79 WeakPolarHBondContact CA-O 3.39Å; Q53-Q79 HydrophobicContact CG-CB 3.77Å
54	Q	73.6	Confident	74.5	Confident	1 Å²	1	48.7 Å²	48.7	1%	0.005	23%	0.228	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	124.6	-175.2	-73.6	-88.8	-5.7	0	0	109.2	Q28 S37 L52 Q79 Q80 R81	Q28-Q54 HydrophobicContact CB-CG 4.34Å; S37-Q54 PolarHBondContact OG-NE2 2.82Å; L52-Q54 HydrophobicContact CD1-CG 4.21Å; L52-Q54 HydrophobicContact CD2-CG 3.93Å; L52-Q54 HydrophobicContact CG-CG 3.8Å; Q54-Q79 PolarHBondContact N-O 2.85Å; Q54-Q80 HydrophobicContact CB-CG 4.4Å; Q54-Q80 VanDerWaalsContact CB-NE2 3.29Å; Q54-Q80 VanDerWaalsContact CG-NE2 3.26Å; Q54-Q80 CarbonylContact O-C 3.59Å; Q54-Q80 WeakPolarHBondContact O-CA 3.35Å; Q54-R81 PolarHBondContact O-N 2.78Å
55	R	73.3	Confident	74.7	Confident	111 Å²	111	43 Å²	43	42%	0.419	21%	0.207	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	105.1	178.5	-69.5	-172.5	177.8	-132.9	5.9	109.3	Q28 R29 S30 R81	Q28-R55 PolarHBondContact O-N 2.92Å; R29-R55 VanDerWaalsContact CA-O 3.32Å; R29-R55 WeakPolarHBondContact CA-O 3.43Å; R29-R55 HydrophobicContact CG-CB 4.33Å; S30-R55 PolarHBondContact N-O 3.01Å; R55-R81 CarbonylContact C-O 3.55Å; R55-R81 WeakPolarHBondContact CA-O 3.47Å; R55-R81 HydrophobicContact CG-CB 4.18Å
56	S	65.6	Low	75.2	Confident	1 Å²	1	45 Å²	45	1%	0.007	21%	0.214	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.3	128.1	-172.6	-68.6	0	0	0	0	110.8	S61 R81 S82 R83	S56-S61 VanDerWaalsContact CB-OG 3.31Å; S56-S61 WeakPolarHBondContact CB-OG 3.36Å; S56-S61 PolarHBondContact OG-OG 2.82Å; S56-R81 PolarHBondContact N-O 2.97Å; S56-S82 WeakPolarHBondContact O-CA 3.32Å; S56-R83 PolarHBondContact O-N 3.03Å
57	R	66.6	Low	75.2	Confident	132 Å²	132	40.5 Å²	40.5	50%	0.498	19%	0.193	S	C	.	.			trans	-112.7	40.1	163.6	-58.7	-173.3	176.7	-172.1	0.2	115.8	S30 R83	S30-R57 PolarHBondContact O-N 2.98Å; R57-R83 HydrophobicContact CG-CB 4.34Å
58	P	60.1	Low	75.4	Confident	12 Å²	12	42.8 Å²	42.8	8%	0.078	20%	0.199	C	C	.	.	S	Bend	trans	-83	-167.7	176.3	31.9	-34	0	0	0	114	P32 Q33 M60 P84	P32-P58 WeakPolarHBondContact O-CA 3.39Å; P32-P58 WeakPolarHBondContact O-CB 2.93Å; Q33-P58 VanDerWaalsContact O-CB 3.29Å; Q33-P58 WeakPolarHBondContact O-CB 2.86Å; P58-M60 WeakPolarHBondContact CB-O 3.35Å; P58-M60 VanDerWaalsContact CG-C 3.49Å; P58-M60 WeakPolarHBondContact CG-O 3.45Å; P58-P84 HydrophobicContact CG-CB 3.99Å; P58-P84 HydrophobicContact CG-CG 4.37Å; P58-P84 WeakPolarHBondContact O-CA 3.31Å; P58-P84 WeakPolarHBondContact O-CB 3.49Å
59	Q	63.7	Low	75.1	Confident	112 Å²	112	42.8 Å²	42.8	52%	0.523	20%	0.199	S	C	.	.	S	Bend	trans	-80.5	-27.9	156.8	-81.8	-172	-31.8	0	0	112.5	Q33 P84 Q85 M86	Q33-Q59 PolarHBondContact O-N 2.91Å; Q59-P84 WeakPolarHBondContact O-CB 3.37Å; Q59-Q85 PolarHBondContact O-N 3.04Å; Q59-M86 PolarHBondContact O-N 2.87Å
60	M	65.3	Low	74.9	Confident	68 Å²	68	44.4 Å²	44.4	34%	0.335	20%	0.203	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	135.4	177.9	-64.7	-174.8	-81.7	0	0	112.7	M34 S35 P58 M86	M34-M60 CarbonylContact C-O 3.55Å; M34-M60 WeakPolarHBondContact CA-O 3.04Å; M34-M60 HydrophobicContact CB-CB 4.24Å; M34-M60 WeakPolarHBondContact CB-O 3.17Å; M34-M60 HydrophobicContact CG-CE 4.29Å; M34-M60 HydrophobicContact SD-CE 3.76Å; S35-M60 PolarHBondContact N-O 3.29Å; P58-M60 WeakPolarHBondContact CB-O 3.35Å; P58-M60 VanDerWaalsContact CG-C 3.49Å; P58-M60 WeakPolarHBondContact CG-O 3.45Å; M60-M86 WeakPolarHBondContact CA-O 3.44Å; M60-M86 HydrophobicContact CG-CB 4.36Å; M60-M86 HydrophobicContact CG-CE 3.94Å; M60-M86 HydrophobicContact SD-CE 3.75Å
61	S	72.1	Confident	74.5	Confident	1 Å²	1	45 Å²	45	1%	0.007	21%	0.207	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	128.8	173.4	-169.7	0	0	0	0	110.8	S56 M86 Q88	S56-S61 VanDerWaalsContact CB-OG 3.31Å; S56-S61 WeakPolarHBondContact CB-OG 3.36Å; S56-S61 PolarHBondContact OG-OG 2.82Å; S61-M86 PolarHBondContact N-O 2.82Å; S61-M86 VanDerWaalsContact N-O 3.09Å; S61-Q88 PolarHBondContact O-N 2.89Å
62	Q	76.7	Confident	74.3	Confident	75 Å²	75	47.9 Å²	47.9	35%	0.35	22%	0.215	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-124	127.9	177.5	-80.7	175	-12.5	0	0	110.4	S35 Q36 S37 Q88	S35-Q62 PolarHBondContact O-N 3.03Å; Q36-Q62 WeakPolarHBondContact CA-O 3.38Å; Q36-Q62 HydrophobicContact CG-CB 4.06Å; S37-Q62 PolarHBondContact N-O 3Å; S37-Q62 VanDerWaalsContact N-O 3.08Å; Q62-Q88 WeakPolarHBondContact CA-O 3.31Å; Q62-Q88 HydrophobicContact CG-CB 4.01Å
63	S	76.1	Confident	74.1	Confident	5 Å²	5	50.3 Å²	50.3	4%	0.035	23%	0.226	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-135.3	133.2	176	-72.3	0	0	0	0	111.8	S37 Q80 Q88 S89 S90	S37-S63 WeakPolarHBondContact O-CA 3.42Å; S63-Q80 PolarHBondContact OG-NE2 2.85Å; S63-Q80 PolarHBondContact OG-OE1 2.86Å; S63-Q88 PolarHBondContact N-O 2.95Å; S63-S89 CarbonylContact O-C 3.56Å; S63-S89 VanDerWaalsContact O-CA 3.29Å; S63-S89 WeakPolarHBondContact O-CA 3.42Å; S63-S90 PolarHBondContact O-N 2.99Å
64	S	81.7	Confident	74	Confident	44 Å²	44	47.3 Å²	47.3	31%	0.308	21%	0.213	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	130.9	175.2	-166.7	0	0	0	0	110.9	S37 S38 L39 S90	S37-S64 PolarHBondContact O-N 2.91Å; S38-S64 WeakPolarHBondContact CA-O 3.25Å; L39-S64 PolarHBondContact N-O 2.89Å; S64-S90 CarbonylContact C-O 3.58Å; S64-S90 VanDerWaalsContact CA-O 3.31Å; S64-S90 WeakPolarHBondContact CA-O 3.36Å; S64-S90 WeakPolarHBondContact CB-OG 3.42Å; S64-S90 PolarHBondContact OG-OG 2.84Å
65	L	81.9	Confident	74.4	Confident	0 Å²	0	50 Å²	50	0%	0	23%	0.225	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	113.6	176.7	-173.5	136.8	0	0	0	109.9	L39 L52 Q67 L78 S90 L91 Q92	L39-L65 HydrophobicContact CD2-CD1 3.68Å; L39-L65 HydrophobicContact CD2-CG 3.84Å; L52-L65 HydrophobicContact CB-CD1 3.75Å; L52-L65 HydrophobicContact CD2-CD1 4.24Å; L65-Q67 HydrophobicContact CD2-CG 3.34Å; L65-Q67 HydrophobicContact CG-CG 4.25Å; L65-L78 HydrophobicContact CB-CD1 3.93Å; L65-S90 PolarHBondContact N-O 2.79Å; L65-L91 HydrophobicContact CB-CD1 4.46Å; L65-L91 HydrophobicContact CB-CG 4.43Å; L65-L91 HydrophobicContact CD2-CD1 3.49Å; L65-L91 VanDerWaalsContact CD2-CD1 3.49Å; L65-L91 HydrophobicContact CD2-CG 3.73Å; L65-L91 HydrophobicContact CG-CD1 4.49Å; L65-L91 CarbonylContact O-C 3.58Å; L65-L91 VanDerWaalsContact O-CA 3.3Å; L65-L91 WeakPolarHBondContact O-CA 3.37Å; L65-Q92 PolarHBondContact O-N 2.86Å
66	Q	83.4	Confident	74.9	Confident	59 Å²	59	45 Å²	45	28%	0.276	21%	0.207	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	124.8	175.3	-169.4	179.6	42.5	0	0	109.9	L39 Q40 Q41 Q92	L39-Q66 PolarHBondContact O-N 2.79Å; Q40-Q66 CarbonylContact C-O 3.59Å; Q40-Q66 VanDerWaalsContact CA-O 3.32Å; Q40-Q66 WeakPolarHBondContact CA-O 3.32Å; Q40-Q66 HydrophobicContact CG-CB 4.42Å; Q41-Q66 PolarHBondContact N-O 2.82Å; Q66-Q92 CarbonylContact C-O 3.59Å; Q66-Q92 WeakPolarHBondContact CA-O 3.27Å; Q66-Q92 HydrophobicContact CG-CB 4.43Å
67	Q	76.9	Confident	75.8	Confident	1 Å²	1	46.8 Å²	46.8	1%	0.005	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	131.6	-178.7	-67	-79.3	-25.1	0	0	109.9	Q41 S50 L65 Q92 Q93 R94	Q41-Q67 VanDerWaalsContact CB-CD 3.43Å; Q41-Q67 VanDerWaalsContact CG-NE2 3.27Å; Q41-Q67 CarbonylContact O-C 3.58Å; S50-Q67 VanDerWaalsContact OG-CD 3.31Å; S50-Q67 PolarHBondContact OG-NE2 2.85Å; S50-Q67 PolarHBondContact OG-OE1 2.89Å; S50-Q67 VanDerWaalsContact OG-OE1 3.12Å; L65-Q67 HydrophobicContact CD2-CG 3.34Å; L65-Q67 HydrophobicContact CG-CG 4.25Å; Q67-Q92 PolarHBondContact N-O 2.87Å; Q67-Q93 VanDerWaalsContact CB-CD 3.48Å; Q67-R94 PolarHBondContact O-N 2.87Å
68	R	81.4	Confident	76.6	Confident	101 Å²	101	40.5 Å²	40.5	38%	0.381	20%	0.196	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128	100.7	176.4	-169.5	176.4	-176.4	-175.7	1.9	109.9	Q41 R42 S43 R94	Q41-R68 PolarHBondContact O-N 2.86Å; R42-R68 VanDerWaalsContact CA-O 3.31Å; R42-R68 WeakPolarHBondContact CA-O 3.46Å; R42-R68 HydrophobicContact CG-CB 4.46Å; S43-R68 PolarHBondContact N-O 2.89Å; R68-R94 CarbonylContact C-O 3.55Å; R68-R94 VanDerWaalsContact CA-O 3.31Å; R68-R94 WeakPolarHBondContact CA-O 3.32Å; R68-R94 HydrophobicContact CG-CB 4.41Å
69	S	73.9	Confident	77.7	Confident	0 Å²	0	42.5 Å²	42.5	0%	0	20%	0.204	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	134.3	-176.5	-48.4	0	0	0	0	110.7	S43 S74 R94 S95 R96	S43-S69 PolarHBondContact OG-OG 3.26Å; S69-S74 WeakPolarHBondContact CB-OG 3.38Å; S69-S74 PolarHBondContact OG-OG 3.02Å; S69-R94 PolarHBondContact N-O 2.79Å; S69-S95 WeakPolarHBondContact O-CA 3.32Å; S69-R96 PolarHBondContact O-N 3.12Å
70	R	77.5	Confident	78.3	Confident	90 Å²	90	37.2 Å²	37.2	34%	0.34	18%	0.18	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	93.8	162.6	-63.6	-174.7	176.8	-179.7	-2.1	107	S43 R44 S45 R96	S43-R70 PolarHBondContact O-N 3.02Å; R44-R70 WeakPolarHBondContact CA-O 3.43Å; R44-R70 HydrophobicContact CG-CB 4.32Å; S45-R70 PolarHBondContact N-O 2.83Å; R70-R96 HydrophobicContact CG-CB 4.3Å
71	S	71.3	Confident	78.7	Confident	17 Å²	17	38.7 Å²	38.7	12%	0.119	18%	0.181	C	C	.	.	S	Bend	trans	-149.1	-172.3	-169.4	58.7	0	0	0	0	113.6	S45 Q46 M73 R96 S97	S45-S71 WeakPolarHBondContact O-CA 3.37Å; S45-S71 WeakPolarHBondContact O-CB 3.38Å; Q46-S71 WeakPolarHBondContact O-CB 3.33Å; S71-M73 PolarHBondContact OG-O 2.85Å; S71-R96 PolarHBondContact N-O 2.85Å; S71-S97 WeakPolarHBondContact O-CA 3.35Å; S71-S97 WeakPolarHBondContact O-CB 3.42Å
72	Q	75.6	Confident	78.4	Confident	110 Å²	110	38.7 Å²	38.7	51%	0.514	18%	0.182	S	C	.	.	S	Bend	trans	-85.5	-41.1	161.3	-75.9	-171.4	-17.2	0	0	110.4	Q46 S97 Q98 M99	Q46-Q72 PolarHBondContact O-N 2.98Å; Q46-Q72 VanDerWaalsContact OE1-CG 3.24Å; Q72-S97 WeakPolarHBondContact O-CB 3.33Å; Q72-Q98 PolarHBondContact O-N 2.89Å; Q72-M99 PolarHBondContact O-N 3.28Å
73	M	77.3	Confident	77.8	Confident	54 Å²	54	41.6 Å²	41.6	27%	0.266	19%	0.189	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	136.9	-178.5	-170.5	179.9	-69	0	0	111.9	Q46 M47 S48 S71 Q75 M99	Q46-M73 PolarHBondContact O-N 2.9Å; Q46-M73 VanDerWaalsContact O-N 3.13Å; M47-M73 WeakPolarHBondContact CA-O 3.33Å; M47-M73 HydrophobicContact CE-SD 4.06Å; M47-M73 HydrophobicContact CG-CB 4.49Å; S48-M73 PolarHBondContact N-O 2.86Å; S71-M73 PolarHBondContact OG-O 2.85Å; M73-Q75 HydrophobicContact CG-CG 4.2Å; M73-Q75 HydrophobicContact SD-CG 4.22Å; M73-M99 HydrophobicContact CE-SD 4.11Å
74	S	79.9	Confident	76.8	Confident	0 Å²	0	41.5 Å²	41.5	0%	0	19%	0.189	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	124.2	170.2	-170.5	0	0	0	0	109.6	S48 S69 M99 S100 Q101	S48-S74 WeakPolarHBondContact O-CA 3.49Å; S69-S74 WeakPolarHBondContact CB-OG 3.38Å; S69-S74 PolarHBondContact OG-OG 3.02Å; S74-M99 PolarHBondContact N-O 2.94Å; S74-S100 CarbonylContact O-C 3.54Å; S74-S100 WeakPolarHBondContact O-CA 3.46Å; S74-Q101 PolarHBondContact O-N 2.87Å
75	Q	83.2	Confident	75.8	Confident	57 Å²	57	45 Å²	45	27%	0.266	20%	0.2	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-121	132.9	176.8	-65.6	-177.6	-31.5	0	0	110.1	S48 Q49 S50 M73 Q101	S48-Q75 PolarHBondContact O-N 2.89Å; Q49-Q75 WeakPolarHBondContact CA-O 3.36Å; Q49-Q75 HydrophobicContact CG-CB 4.24Å; S50-Q75 PolarHBondContact N-O 2.87Å; M73-Q75 HydrophobicContact CG-CG 4.2Å; M73-Q75 HydrophobicContact SD-CG 4.22Å; Q75-Q101 WeakPolarHBondContact CA-O 2.71Å; Q75-Q101 HydrophobicContact CG-CB 4.27Å
76	S	82.1	Confident	74.9	Confident	7 Å²	7	48.5 Å²	48.5	5%	0.049	22%	0.217	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	133	175.4	-71.7	0	0	0	0	112.2	S50 Q93 Q101 S102 S103	S50-S76 CarbonylContact O-C 3.59Å; S50-S76 WeakPolarHBondContact O-CA 3.38Å; S76-Q93 PolarHBondContact OG-NE2 2.96Å; S76-Q93 PolarHBondContact OG-OE1 3.16Å; S76-Q101 PolarHBondContact N-O 2.86Å; S76-S102 CarbonylContact O-C 3.58Å; S76-S102 VanDerWaalsContact O-CA 3.27Å; S76-S102 WeakPolarHBondContact O-CA 3.06Å; S76-S103 PolarHBondContact O-N 2.85Å
77	S	84.5	Confident	74.4	Confident	38 Å²	38	45.8 Å²	45.8	27%	0.266	21%	0.205	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	129.6	178	-173.5	0	0	0	0	109.8	S50 S51 L52 S103	S50-S77 PolarHBondContact O-N 3.08Å; S51-S77 CarbonylContact C-O 3.57Å; S51-S77 VanDerWaalsContact CA-O 3.28Å; S51-S77 WeakPolarHBondContact CA-O 3.16Å; L52-S77 PolarHBondContact N-O 3.5Å; S77-S103 CarbonylContact C-O 3.59Å; S77-S103 WeakPolarHBondContact CA-O 3.45Å
78	L	84.3	Confident	74.4	Confident	0 Å²	0	49.5 Å²	49.5	0%	0	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	118.2	175.3	178.1	154.1	0	0	0	108.7	L52 L65 Q80 L91 S103 L104 Q105	L52-L78 HydrophobicContact CB-CB 4.43Å; L52-L78 HydrophobicContact CB-CD1 4.46Å; L52-L78 HydrophobicContact CB-CG 4.27Å; L52-L78 HydrophobicContact CD2-CD1 3.67Å; L52-L78 HydrophobicContact CD2-CG 4.09Å; L52-L78 CarbonylContact O-C 3.57Å; L52-L78 WeakPolarHBondContact O-CA 3.31Å; L65-L78 HydrophobicContact CB-CD1 3.93Å; L78-Q80 HydrophobicContact CD2-CG 3.32Å; L78-Q80 HydrophobicContact CG-CG 4.33Å; L78-L91 HydrophobicContact CB-CD1 4.14Å; L78-S103 PolarHBondContact N-O 2.88Å; L78-L104 HydrophobicContact CB-CD2 3.6Å; L78-L104 HydrophobicContact CD1-CD2 4.39Å; L78-L104 HydrophobicContact CD2-CD2 4Å; L78-L104 HydrophobicContact CG-CD2 4.21Å; L78-L104 CarbonylContact O-C 3.58Å; L78-L104 WeakPolarHBondContact O-CA 3.36Å; L78-Q105 PolarHBondContact O-N 2.89Å
79	Q	83.3	Confident	74.2	Confident	54 Å²	54	45 Å²	45	25%	0.252	21%	0.206	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	121.2	177.6	-63.9	-176.1	11.5	0	0	109.4	L52 Q53 Q54 Q105	L52-Q79 PolarHBondContact O-N 2.81Å; Q53-Q79 CarbonylContact C-O 3.59Å; Q53-Q79 WeakPolarHBondContact CA-O 3.39Å; Q53-Q79 HydrophobicContact CG-CB 3.77Å; Q54-Q79 PolarHBondContact N-O 2.85Å; Q79-Q105 CarbonylContact C-O 3.6Å; Q79-Q105 WeakPolarHBondContact CA-O 3.32Å; Q79-Q105 HydrophobicContact CG-CB 4.26Å
80	Q	75.4	Confident	74.7	Confident	1 Å²	1	47 Å²	47	1%	0.005	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	126.8	179.6	-66.1	-80	-19.6	0	0	108.6	Q54 S63 L78 Q105 R107	Q54-Q80 HydrophobicContact CB-CG 4.4Å; Q54-Q80 VanDerWaalsContact CB-NE2 3.29Å; Q54-Q80 VanDerWaalsContact CG-NE2 3.26Å; Q54-Q80 CarbonylContact O-C 3.59Å; Q54-Q80 WeakPolarHBondContact O-CA 3.35Å; S63-Q80 PolarHBondContact OG-NE2 2.85Å; S63-Q80 PolarHBondContact OG-OE1 2.86Å; L78-Q80 HydrophobicContact CD2-CG 3.32Å; L78-Q80 HydrophobicContact CG-CG 4.33Å; Q80-Q105 PolarHBondContact N-O 2.77Å; Q80-R107 PolarHBondContact O-N 2.82Å
81	R	73.9	Confident	74.9	Confident	98 Å²	98	42.8 Å²	42.8	37%	0.37	21%	0.205	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	105.2	173.4	-70.8	-178.3	178.1	-114.1	4.8	107.4	Q54 R55 S56 R107	Q54-R81 PolarHBondContact O-N 2.78Å; R55-R81 CarbonylContact C-O 3.55Å; R55-R81 WeakPolarHBondContact CA-O 3.47Å; R55-R81 HydrophobicContact CG-CB 4.18Å; S56-R81 PolarHBondContact N-O 2.97Å; R81-R107 WeakPolarHBondContact CA-O 3.41Å; R81-R107 HydrophobicContact CG-CB 4.23Å
82	S	65.3	Low	75.6	Confident	2 Å²	2	44.1 Å²	44.1	1%	0.014	21%	0.209	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	124.6	-170.4	-69.6	0	0	0	0	108.2	S56 S87 R107 S108 R109	S56-S82 WeakPolarHBondContact O-CA 3.32Å; S82-S87 PolarHBondContact OG-OG 3Å; S82-R107 PolarHBondContact N-O 3.05Å; S82-S108 VanDerWaalsContact O-CA 3.32Å; S82-S108 WeakPolarHBondContact O-CA 3.2Å; S82-R109 PolarHBondContact O-N 3.46Å
83	R	64.5	Low	75.7	Confident	135 Å²	135	38.9 Å²	38.9	51%	0.509	18%	0.184	S	C	.	.			trans	-102.4	27.1	158.9	-60	-174.8	176.2	-174.8	-1.9	116.8	S56 R57 R109	S56-R83 PolarHBondContact O-N 3.03Å; R57-R83 HydrophobicContact CG-CB 4.34Å; R83-R109 HydrophobicContact CG-CB 4.34Å
84	P	55.6	Low	75.8	Confident	3 Å²	3	41.2 Å²	41.2	2%	0.019	19%	0.19	C	C	.	.	S	Bend	trans	-94.5	159.3	174.4	39	-36	0	0	0	115	P58 Q59 M86 P110	P58-P84 HydrophobicContact CG-CB 3.99Å; P58-P84 HydrophobicContact CG-CG 4.37Å; P58-P84 WeakPolarHBondContact O-CA 3.31Å; P58-P84 WeakPolarHBondContact O-CB 3.49Å; Q59-P84 WeakPolarHBondContact O-CB 3.37Å; P84-M86 VanDerWaalsContact CG-O 3.25Å; P84-M86 WeakPolarHBondContact CG-O 3.31Å; P84-M86 PolarHBondContact O-N 2.93Å; P84-M86 VanDerWaalsContact O-N 3.09Å; P84-P110 WeakPolarHBondContact O-CB 3.4Å; P84-P110 WeakPolarHBondContact O-CD 3.45Å; P84-P110 WeakPolarHBondContact O-CG 3.49Å
85	Q	60.3	Low	75.4	Confident	117 Å²	117	41.3 Å²	41.3	55%	0.547	19%	0.191	S	C	.	.	S	Bend	trans	-48.3	-36.8	173.4	-84.7	-166.1	-27.5	0	0	113.3	Q59 M112	Q59-Q85 PolarHBondContact O-N 3.04Å; Q85-M112 PolarHBondContact O-N 3.06Å
86	M	64.2	Low	74.9	Confident	75 Å²	75	44 Å²	44	37%	0.369	20%	0.199	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	138.2	-179.6	-64.5	-175.6	-82.2	0	0	113.5	Q59 M60 S61 P84 M112	Q59-M86 PolarHBondContact O-N 2.87Å; M60-M86 WeakPolarHBondContact CA-O 3.44Å; M60-M86 HydrophobicContact CG-CB 4.36Å; M60-M86 HydrophobicContact CG-CE 3.94Å; M60-M86 HydrophobicContact SD-CE 3.75Å; S61-M86 PolarHBondContact N-O 2.82Å; S61-M86 VanDerWaalsContact N-O 3.09Å; P84-M86 VanDerWaalsContact CG-O 3.25Å; P84-M86 WeakPolarHBondContact CG-O 3.31Å; P84-M86 PolarHBondContact O-N 2.93Å; P84-M86 VanDerWaalsContact O-N 3.09Å; M86-M112 WeakPolarHBondContact CA-O 3.45Å; M86-M112 HydrophobicContact CG-CB 4.49Å
87	S	72.1	Confident	74	Confident	2 Å²	2	43.9 Å²	43.9	1%	0.014	20%	0.198	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	126.7	169.9	-167.3	0	0	0	0	110.3	S82 Q106 M112 Q114	S82-S87 PolarHBondContact OG-OG 3Å; S87-Q106 PolarHBondContact OG-OE1 2.9Å; S87-M112 PolarHBondContact N-O 3.07Å; S87-Q114 PolarHBondContact O-N 3.28Å
88	Q	76.9	Confident	73.1	Confident	78 Å²	78	47.2 Å²	47.2	36%	0.364	21%	0.209	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-120	129.2	175.2	-78.4	-179.4	-19.3	0	0	110.2	S61 Q62 S63 Q114	S61-Q88 PolarHBondContact O-N 2.89Å; Q62-Q88 WeakPolarHBondContact CA-O 3.31Å; Q62-Q88 HydrophobicContact CG-CB 4.01Å; S63-Q88 PolarHBondContact N-O 2.95Å; Q88-Q114 WeakPolarHBondContact CA-O 3.5Å; Q88-Q114 HydrophobicContact CG-CB 4.23Å
89	S	77.6	Confident	72.7	Confident	6 Å²	6	49.6 Å²	49.6	4%	0.042	22%	0.221	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.5	133.9	175	-66.4	0	0	0	0	112.5	S63 Q106 Q114 S115 S116	S63-S89 CarbonylContact O-C 3.56Å; S63-S89 VanDerWaalsContact O-CA 3.29Å; S63-S89 WeakPolarHBondContact O-CA 3.42Å; S89-Q106 PolarHBondContact OG-NE2 3.25Å; S89-Q114 PolarHBondContact N-O 3.15Å; S89-S115 WeakPolarHBondContact O-CA 3.49Å; S89-S116 PolarHBondContact O-N 3.26Å; S89-S116 PolarHBondContact O-OG 2.99Å
90	S	83.3	Confident	72.5	Confident	42 Å²	42	47 Å²	47	29%	0.294	21%	0.209	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.4	131.9	173.1	61	0	0	0	0	110.4	S63 S64 L65 S116	S63-S90 PolarHBondContact O-N 2.99Å; S64-S90 CarbonylContact C-O 3.58Å; S64-S90 VanDerWaalsContact CA-O 3.31Å; S64-S90 WeakPolarHBondContact CA-O 3.36Å; S64-S90 WeakPolarHBondContact CB-OG 3.42Å; S64-S90 PolarHBondContact OG-OG 2.84Å; L65-S90 PolarHBondContact N-O 2.79Å; S90-S116 WeakPolarHBondContact CA-OG 3.47Å; S90-S116 WeakPolarHBondContact CB-OG 3.48Å
91	L	83.3	Confident	72.8	Confident	3 Å²	3	49.8 Å²	49.8	2%	0.016	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	121.3	170.7	175.3	153.3	0	0	0	109.2	L65 L78 Q93 L104 S116 L117 Q118	L65-L91 HydrophobicContact CB-CD1 4.46Å; L65-L91 HydrophobicContact CB-CG 4.43Å; L65-L91 HydrophobicContact CD2-CD1 3.49Å; L65-L91 VanDerWaalsContact CD2-CD1 3.49Å; L65-L91 HydrophobicContact CD2-CG 3.73Å; L65-L91 HydrophobicContact CG-CD1 4.49Å; L65-L91 CarbonylContact O-C 3.58Å; L65-L91 VanDerWaalsContact O-CA 3.3Å; L65-L91 WeakPolarHBondContact O-CA 3.37Å; L78-L91 HydrophobicContact CB-CD1 4.14Å; L91-Q93 HydrophobicContact CD2-CG 3.5Å; L91-Q93 VanDerWaalsContact CD2-CG 3.5Å; L91-L104 HydrophobicContact CB-CD1 4.32Å; L91-L104 HydrophobicContact CB-CD2 3.59Å; L91-L104 HydrophobicContact CD1-CD2 3.4Å; L91-L104 VanDerWaalsContact CD1-CD2 3.4Å; L91-L104 HydrophobicContact CD2-CD2 4.46Å; L91-L104 HydrophobicContact CG-CD2 3.99Å; L91-S116 PolarHBondContact N-O 2.83Å; L91-L117 HydrophobicContact CB-CD2 3.77Å; L91-L117 HydrophobicContact CD2-CD2 3.33Å; L91-L117 HydrophobicContact CG-CD2 4.04Å; L91-Q118 PolarHBondContact O-N 2.72Å
92	Q	84.1	Confident	73.3	Confident	44 Å²	44	45.4 Å²	45.4	21%	0.206	21%	0.206	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	117.3	178.5	-171.6	-179	51.5	0	0	109.3	L65 Q66 Q67 Q118	L65-Q92 PolarHBondContact O-N 2.86Å; Q66-Q92 CarbonylContact C-O 3.59Å; Q66-Q92 WeakPolarHBondContact CA-O 3.27Å; Q66-Q92 HydrophobicContact CG-CB 4.43Å; Q67-Q92 PolarHBondContact N-O 2.87Å; Q92-Q118 CarbonylContact C-O 3.54Å; Q92-Q118 WeakPolarHBondContact CA-O 3.48Å; Q92-Q118 HydrophobicContact CG-CB 4.43Å
93	Q	77.9	Confident	74.2	Confident	1 Å²	1	47 Å²	47	1%	0.005	22%	0.217	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.4	129.7	174.3	-60.5	-69.2	-44.4	0	0	110.1	Q67 S76 L91 S102 Q118 Q119 R120	Q67-Q93 VanDerWaalsContact CB-CD 3.48Å; S76-Q93 PolarHBondContact OG-NE2 2.96Å; S76-Q93 PolarHBondContact OG-OE1 3.16Å; L91-Q93 HydrophobicContact CD2-CG 3.5Å; L91-Q93 VanDerWaalsContact CD2-CG 3.5Å; Q93-S102 VanDerWaalsContact CG-OG 3.32Å; Q93-S102 WeakPolarHBondContact CG-OG 3.42Å; Q93-Q118 PolarHBondContact N-O 3.35Å; Q93-Q119 HydrophobicContact CB-CG 4.32Å; Q93-Q119 HydrophobicContact CG-CG 4.48Å; Q93-R120 PolarHBondContact O-N 2.8Å
94	R	81.1	Confident	75.1	Confident	102 Å²	102	40.5 Å²	40.5	39%	0.385	19%	0.193	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	105.5	168.2	-69.8	-176.1	177.4	-166.8	-0.3	108.5	Q67 R68 S69 R120	Q67-R94 PolarHBondContact O-N 2.87Å; R68-R94 CarbonylContact C-O 3.55Å; R68-R94 VanDerWaalsContact CA-O 3.31Å; R68-R94 WeakPolarHBondContact CA-O 3.32Å; R68-R94 HydrophobicContact CG-CB 4.41Å; S69-R94 PolarHBondContact N-O 2.79Å; R94-R120 CarbonylContact C-O 3.56Å; R94-R120 WeakPolarHBondContact CA-O 3.39Å; R94-R120 HydrophobicContact CG-CB 4.34Å
95	S	70.9	Confident	76.4	Confident	3 Å²	3	42.2 Å²	42.2	2%	0.021	20%	0.201	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	136.7	177.9	59.9	0	0	0	0	111.4	S69 S97 R120 S121 R122	S69-S95 WeakPolarHBondContact O-CA 3.32Å; S95-S97 WeakPolarHBondContact CB-OG 3.28Å; S95-R120 PolarHBondContact N-O 3.03Å; S95-S121 WeakPolarHBondContact O-CA 3.43Å; S95-S121 WeakPolarHBondContact OG-CA 3.39Å; S95-S121 WeakPolarHBondContact OG-CB 3.38Å; S95-R122 PolarHBondContact O-N 3.05Å
96	R	73.1	Confident	77.1	Confident	113 Å²	113	36.8 Å²	36.8	43%	0.426	18%	0.175	S	C	.	.			trans	-113.8	75.7	162.8	-64.7	-174	176.8	-176.2	-4.4	106.4	S69 R70 S71 R122	S69-R96 PolarHBondContact O-N 3.12Å; R70-R96 HydrophobicContact CG-CB 4.3Å; S71-R96 PolarHBondContact N-O 2.85Å; R96-R122 HydrophobicContact CG-CB 4.43Å
97	S	62.7	Low	77.4	Confident	4 Å²	4	37.6 Å²	37.6	3%	0.028	17%	0.174	C	C	.	.	S	Bend	trans	-160.4	161.7	-167.9	66.9	0	0	0	0	111.5	S71 Q72 S95 M99 S123	S71-S97 WeakPolarHBondContact O-CA 3.35Å; S71-S97 WeakPolarHBondContact O-CB 3.42Å; Q72-S97 WeakPolarHBondContact O-CB 3.33Å; S95-S97 WeakPolarHBondContact CB-OG 3.28Å; S97-M99 VanDerWaalsContact C-N 3.35Å; S97-M99 PolarHBondContact O-N 2.97Å; S97-M99 PolarHBondContact OG-O 2.93Å; S97-S123 VanDerWaalsContact C-OG 3.23Å; S97-S123 PolarHBondContact N-OG 3.04Å; S97-S123 WeakPolarHBondContact O-CB 2.94Å; S97-S123 VanDerWaalsContact O-O 3.08Å; S97-S123 PolarHBondContact O-OG 2.91Å
98	Q	66.2	Low	77	Confident	108 Å²	108	38 Å²	38	51%	0.505	18%	0.177	S	C	.	.	S	Bend	trans	-63.9	-35.3	177.6	-76.5	-173.5	-27.6	0	0	113.4	Q72 M125	Q72-Q98 PolarHBondContact O-N 2.89Å; Q98-M125 PolarHBondContact O-N 2.82Å
99	M	74.1	Confident	76.3	Confident	50 Å²	50	40.1 Å²	40.1	25%	0.246	18%	0.182	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	136	-174.3	-167.9	178.6	-69.9	0	0	112.9	Q72 M73 S74 S97 Q101 M125	Q72-M99 PolarHBondContact O-N 3.28Å; M73-M99 HydrophobicContact CE-SD 4.11Å; S74-M99 PolarHBondContact N-O 2.94Å; S97-M99 VanDerWaalsContact C-N 3.35Å; S97-M99 PolarHBondContact O-N 2.97Å; S97-M99 PolarHBondContact OG-O 2.93Å; M99-Q101 HydrophobicContact CG-CG 4.43Å; M99-Q101 HydrophobicContact SD-CG 4.44Å; M99-M125 WeakPolarHBondContact CA-O 3.43Å; M99-M125 HydrophobicContact CE-CE 3.81Å
100	S	79.8	Confident	74.9	Confident	1 Å²	1	41.8 Å²	41.8	1%	0.007	19%	0.192	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.2	125.6	168.6	176.1	0	0	0	0	110.6	S74 M125 S126 Q127	S74-S100 CarbonylContact O-C 3.54Å; S74-S100 WeakPolarHBondContact O-CA 3.46Å; S100-M125 PolarHBondContact N-O 2.99Å; S100-S126 WeakPolarHBondContact O-CA 2.85Å; S100-Q127 PolarHBondContact O-N 3.14Å
101	Q	82.8	Confident	73.6	Confident	59 Å²	59	48.4 Å²	48.4	28%	0.276	22%	0.218	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	131.9	173.3	-69.9	-179.6	-26.9	0	0	110.4	S74 Q75 S76 M99 Q127	S74-Q101 PolarHBondContact O-N 2.87Å; Q75-Q101 WeakPolarHBondContact CA-O 2.71Å; Q75-Q101 HydrophobicContact CG-CB 4.27Å; S76-Q101 PolarHBondContact N-O 2.86Å; M99-Q101 HydrophobicContact CG-CG 4.43Å; M99-Q101 HydrophobicContact SD-CG 4.44Å; Q101-Q127 CarbonylContact C-O 3.56Å; Q101-Q127 WeakPolarHBondContact CA-O 3.36Å; Q101-Q127 HydrophobicContact CG-CB 4.38Å
102	S	82.5	Confident	72.4	Confident	5 Å²	5	53.5 Å²	53.5	4%	0.035	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	140.4	173.3	-49.1	0	0	0	0	112.6	S76 Q93 Q119 Q127 S128 S129	S76-S102 CarbonylContact O-C 3.58Å; S76-S102 VanDerWaalsContact O-CA 3.27Å; S76-S102 WeakPolarHBondContact O-CA 3.06Å; Q93-S102 VanDerWaalsContact CG-OG 3.32Å; Q93-S102 WeakPolarHBondContact CG-OG 3.42Å; S102-Q119 PolarHBondContact OG-NE2 3.37Å; S102-Q127 PolarHBondContact N-O 3.33Å; S102-S128 CarbonylContact O-C 3.6Å; S102-S128 WeakPolarHBondContact O-CA 3.11Å; S102-S129 PolarHBondContact O-N 2.96Å; S102-S129 PolarHBondContact O-OG 3.06Å
103	S	84.2	Confident	71.6	Confident	35 Å²	35	52.6 Å²	52.6	25%	0.245	24%	0.242	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131	123.4	173	-166.9	0	0	0	0	110.3	S76 S77 L78 S129	S76-S103 PolarHBondContact O-N 2.85Å; S77-S103 CarbonylContact C-O 3.59Å; S77-S103 WeakPolarHBondContact CA-O 3.45Å; L78-S103 PolarHBondContact N-O 2.88Å; S103-S129 WeakPolarHBondContact CA-O 3.42Å; S103-S129 WeakPolarHBondContact CA-OG 3.45Å; S103-S129 WeakPolarHBondContact CB-OG 3.47Å; S103-S129 PolarHBondContact OG-OG 3.22Å
104	L	84.1	Confident	71.5	Confident	0 Å²	0	58 Å²	58	0%	0	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	128.1	161.8	-45	-172.7	0	0	0	109.6	L78 L91 L117 S129 L130 Q131	L78-L104 HydrophobicContact CB-CD2 3.6Å; L78-L104 HydrophobicContact CD1-CD2 4.39Å; L78-L104 HydrophobicContact CD2-CD2 4Å; L78-L104 HydrophobicContact CG-CD2 4.21Å; L78-L104 CarbonylContact O-C 3.58Å; L78-L104 WeakPolarHBondContact O-CA 3.36Å; L91-L104 HydrophobicContact CB-CD1 4.32Å; L91-L104 HydrophobicContact CB-CD2 3.59Å; L91-L104 HydrophobicContact CD1-CD2 3.4Å; L91-L104 VanDerWaalsContact CD1-CD2 3.4Å; L91-L104 HydrophobicContact CD2-CD2 4.46Å; L91-L104 HydrophobicContact CG-CD2 3.99Å; L104-L117 HydrophobicContact CD1-CD2 3.56Å; L104-L117 HydrophobicContact CD1-CG 3.73Å; L104-L117 HydrophobicContact CD2-CD2 3.7Å; L104-L117 HydrophobicContact CG-CD1 4.14Å; L104-L117 HydrophobicContact CG-CD2 3.45Å; L104-L117 VanDerWaalsContact CG-CD2 3.45Å; L104-L117 HydrophobicContact CG-CG 3.79Å; L104-S129 PolarHBondContact N-O 3.47Å; L104-L130 HydrophobicContact CB-CD2 3.58Å; L104-L130 HydrophobicContact CD1-CD2 3.48Å; L104-L130 VanDerWaalsContact CD1-CD2 3.48Å; L104-L130 HydrophobicContact CG-CD2 3.56Å; L104-Q131 PolarHBondContact O-N 2.93Å
105	Q	82.6	Confident	71.2	Confident	39 Å²	39	54.5 Å²	54.5	18%	0.182	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	112.8	168	-170.6	176.2	67.5	0	0	109.6	L78 Q79 Q80 Q131	L78-Q105 PolarHBondContact O-N 2.89Å; Q79-Q105 CarbonylContact C-O 3.6Å; Q79-Q105 WeakPolarHBondContact CA-O 3.32Å; Q79-Q105 HydrophobicContact CG-CB 4.26Å; Q80-Q105 PolarHBondContact N-O 2.77Å; Q105-Q131 CarbonylContact C-O 3.58Å; Q105-Q131 WeakPolarHBondContact CA-O 3.43Å; Q105-Q131 HydrophobicContact CG-CB 4.44Å
106	Q	74.8	Confident	71.7	Confident	2 Å²	2	57.5 Å²	57.5	1%	0.009	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.2	127.1	170.8	-61.3	-67.2	-33.6	0	0	109.8	S87 S89 S115 Q131 Q132 R133	S87-Q106 PolarHBondContact OG-OE1 2.9Å; S89-Q106 PolarHBondContact OG-NE2 3.25Å; Q106-S115 WeakPolarHBondContact CG-OG 2.85Å; Q106-Q131 PolarHBondContact N-O 3.3Å; Q106-Q132 HydrophobicContact CB-CG 4.35Å; Q106-R133 PolarHBondContact O-N 3.35Å
107	R	71.8	Confident	72	Confident	93 Å²	93	54 Å²	54	35%	0.351	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	109	166.7	-69.2	-178.5	178.4	-111.2	2.8	108.1	Q80 R81 S82 R133	Q80-R107 PolarHBondContact O-N 2.82Å; R81-R107 WeakPolarHBondContact CA-O 3.41Å; R81-R107 HydrophobicContact CG-CB 4.23Å; S82-R107 PolarHBondContact N-O 3.05Å; R107-R133 HydrophobicContact CG-CB 4.46Å
108	S	63.4	Low	72.9	Confident	11 Å²	11	58 Å²	58	8%	0.077	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	143.2	-179.5	-62.7	0	0	0	0	110.5	S82 R133	S82-S108 VanDerWaalsContact O-CA 3.32Å; S82-S108 WeakPolarHBondContact O-CA 3.2Å; S108-R133 PolarHBondContact N-O 2.93Å
109	R	61.7	Low	73.3	Confident	122 Å²	122	55 Å²	55	46%	0.46	27%	0.273	S	S	.	.			trans	-113	-2.1	176.4	-139.9	177.9	-177.1	-171.1	4.7	114.9	S82 R83	S82-R109 PolarHBondContact O-N 3.46Å; R83-R109 HydrophobicContact CG-CB 4.34Å
110	P	49.5	Very low	73.4	Confident	41 Å²	41	59.6 Å²	59.6	27%	0.266	29%	0.287	S	S	.	.	S	Bend	trans	-120.5	-178.3	167.7	-13.6	38.2	0	0	0	115.6	P84 M112	P84-P110 WeakPolarHBondContact O-CB 3.4Å; P84-P110 WeakPolarHBondContact O-CD 3.45Å; P84-P110 WeakPolarHBondContact O-CG 3.49Å; P110-M112 PolarHBondContact O-N 3.47Å
111	Q	54.4	Low	72.8	Confident	180 Å²	180	61.8 Å²	61.8	84%	0.841	30%	0.303	S	S	*	.	S	Bend	trans	-48.6	-40	-157.4	-80.6	-164.5	-27.1	0	0	119.4
112	M	57.7	Low	71.9	Confident	111 Å²	111	68.5 Å²	68.5	55%	0.547	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	141.7	-171.1	-68.1	-144	-72.1	0	0	115.5	Q85 M86 S87 P110	Q85-M112 PolarHBondContact O-N 3.06Å; M86-M112 WeakPolarHBondContact CA-O 3.45Å; M86-M112 HydrophobicContact CG-CB 4.49Å; S87-M112 PolarHBondContact N-O 3.07Å; P110-M112 PolarHBondContact O-N 3.47Å
113	S	68.8	Low	70.5	Confident	24 Å²	24	70.6 Å²	70.6	17%	0.168	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	127.1	176.3	167.1	0	0	0	0	109.9	Q132	S113-Q132 PolarHBondContact OG-OE1 3.13Å
114	Q	74.3	Confident	69.4	Low	116 Å²	116	76.5 Å²	76.5	54%	0.542	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	125.7	173.4	-73.8	-176.3	-15	0	0	110.2	S87 Q88 S89	S87-Q114 PolarHBondContact O-N 3.28Å; Q88-Q114 WeakPolarHBondContact CA-O 3.5Å; Q88-Q114 HydrophobicContact CG-CB 4.23Å; S89-Q114 PolarHBondContact N-O 3.15Å
115	S	75.6	Confident	68.5	Low	27 Å²	27	81.2 Å²	81.2	19%	0.189	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.1	129.8	178.7	-63.8	0	0	0	0	110.3	S89 Q106	S89-S115 WeakPolarHBondContact O-CA 3.49Å; Q106-S115 WeakPolarHBondContact CG-OG 2.85Å
116	S	80.6	Confident	68.1	Low	66 Å²	66	81.9 Å²	81.9	46%	0.462	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	129.3	173.7	54.7	0	0	0	0	110.2	S89 S90 L91	S89-S116 PolarHBondContact O-N 3.26Å; S89-S116 PolarHBondContact O-OG 2.99Å; S90-S116 WeakPolarHBondContact CA-OG 3.47Å; S90-S116 WeakPolarHBondContact CB-OG 3.48Å; L91-S116 PolarHBondContact N-O 2.83Å
117	L	80.8	Confident	68.3	Low	39 Å²	39	87.7 Å²	87.7	20%	0.204	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	118.8	170.3	-82.6	-172.3	0	0	0	109.1	L91 L104 L130	L91-L117 HydrophobicContact CB-CD2 3.77Å; L91-L117 HydrophobicContact CD2-CD2 3.33Å; L91-L117 HydrophobicContact CG-CD2 4.04Å; L104-L117 HydrophobicContact CD1-CD2 3.56Å; L104-L117 HydrophobicContact CD1-CG 3.73Å; L104-L117 HydrophobicContact CD2-CD2 3.7Å; L104-L117 HydrophobicContact CG-CD1 4.14Å; L104-L117 HydrophobicContact CG-CD2 3.45Å; L104-L117 VanDerWaalsContact CG-CD2 3.45Å; L104-L117 HydrophobicContact CG-CG 3.79Å; L117-L130 HydrophobicContact CD1-CD1 4.3Å; L117-L130 HydrophobicContact CD1-CD2 3.47Å; L117-L130 VanDerWaalsContact CD1-CD2 3.47Å; L117-L130 HydrophobicContact CD1-CG 3.55Å; L117-L130 HydrophobicContact CG-CD1 4.32Å; L117-L130 HydrophobicContact CG-CD2 3.51Å; L117-L130 HydrophobicContact CG-CG 3.94Å
118	Q	80.8	Confident	68.7	Low	89 Å²	89	87 Å²	87	42%	0.416	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	115.9	169.8	-169.7	178.1	54.1	0	0	109.5	L91 Q92 Q93	L91-Q118 PolarHBondContact O-N 2.72Å; Q92-Q118 CarbonylContact C-O 3.54Å; Q92-Q118 WeakPolarHBondContact CA-O 3.48Å; Q92-Q118 HydrophobicContact CG-CB 4.43Å; Q93-Q118 PolarHBondContact N-O 3.35Å
119	Q	74.7	Confident	69.6	Low	44 Å²	44	88.7 Å²	88.7	21%	0.206	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	130.2	174.2	-64.8	-176.1	-12.9	0	0	109.6	Q93 S102 Q127	Q93-Q119 HydrophobicContact CB-CG 4.32Å; Q93-Q119 HydrophobicContact CG-CG 4.48Å; S102-Q119 PolarHBondContact OG-NE2 3.37Å; Q119-Q127 PolarHBondContact NE2-O 2.87Å
120	R	75.5	Confident	70.5	Confident	147 Å²	147	86.8 Å²	86.8	56%	0.555	44%	0.443	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.2	107.2	169.7	-75.6	-175.6	170.6	-167.8	-2.4	108.4	Q93 R94 S95	Q93-R120 PolarHBondContact O-N 2.8Å; R94-R120 CarbonylContact C-O 3.56Å; R94-R120 WeakPolarHBondContact CA-O 3.39Å; R94-R120 HydrophobicContact CG-CB 4.34Å; S95-R120 PolarHBondContact N-O 3.03Å
121	S	67	Low	71.9	Confident	47 Å²	47	89.5 Å²	89.5	33%	0.329	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	142	172.8	50.8	0	0	0	0	109.7	S95 S126	S95-S121 WeakPolarHBondContact O-CA 3.43Å; S95-S121 WeakPolarHBondContact OG-CA 3.39Å; S95-S121 WeakPolarHBondContact OG-CB 3.38Å; S121-S126 WeakPolarHBondContact CB-OG 3.42Å; S121-S126 PolarHBondContact OG-OG 3.03Å
122	R	65.2	Low	72.7	Confident	200 Å²	200	85.4 Å²	85.4	76%	0.755	43%	0.433	S	S	*	.	S	Bend	trans	-104.9	19.4	169.4	-77.8	-167.9	174.4	-172	-4.1	112.6	S95 R96	S95-R122 PolarHBondContact O-N 3.05Å; R96-R122 HydrophobicContact CG-CB 4.43Å
123	S	53.9	Low	73.3	Confident	49 Å²	49	87.7 Å²	87.7	34%	0.343	44%	0.436	S	S	.	.	S	Bend	trans	-163	142	172.2	10.9	0	0	0	0	112.9	S97 M125	S97-S123 VanDerWaalsContact C-OG 3.23Å; S97-S123 PolarHBondContact N-OG 3.04Å; S97-S123 WeakPolarHBondContact O-CB 2.94Å; S97-S123 VanDerWaalsContact O-O 3.08Å; S97-S123 PolarHBondContact O-OG 2.91Å; S123-M125 PolarHBondContact O-N 2.66Å
124	Q	60.2	Low	73.1	Confident	159 Å²	159	90 Å²	90	74%	0.743	45%	0.452	S	S	*	.	S	Bend	trans	32.1	-58.8	174.1	-62.5	-159.4	-22.8	0	0	124
125	M	66	Low	72.5	Confident	100 Å²	100	94.3 Å²	94.3	49%	0.493	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.9	138.6	-166.6	-73.1	-172.2	-78.6	0	0	115.4	Q98 M99 S100 S123	Q98-M125 PolarHBondContact O-N 2.82Å; M99-M125 WeakPolarHBondContact CA-O 3.43Å; M99-M125 HydrophobicContact CE-CE 3.81Å; S100-M125 PolarHBondContact N-O 2.99Å; S123-M125 PolarHBondContact O-N 2.66Å
126	S	73.7	Confident	71.4	Confident	52 Å²	52	98.4 Å²	98.4	36%	0.364	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.6	123.7	178.9	-66.3	0	0	0	0	110.6	S100 S121	S100-S126 WeakPolarHBondContact O-CA 2.85Å; S121-S126 WeakPolarHBondContact CB-OG 3.42Å; S121-S126 PolarHBondContact OG-OG 3.03Å
127	Q	79.2	Confident	70	Confident	124 Å²	124	102.6 Å²	102.6	58%	0.579	50%	0.502	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.5	128.2	175.6	-72.8	-175.2	-20.2	0	0	110.2	S100 Q101 S102 Q119	S100-Q127 PolarHBondContact O-N 3.14Å; Q101-Q127 CarbonylContact C-O 3.56Å; Q101-Q127 WeakPolarHBondContact CA-O 3.36Å; Q101-Q127 HydrophobicContact CG-CB 4.38Å; S102-Q127 PolarHBondContact N-O 3.33Å; Q119-Q127 PolarHBondContact NE2-O 2.87Å
128	S	79.2	Confident	68.1	Low	78 Å²	78	108.7 Å²	108.7	55%	0.545	53%	0.531	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	128.9	178.3	56	0	0	0	0	110.3	S102	S102-S128 CarbonylContact O-C 3.6Å; S102-S128 WeakPolarHBondContact O-CA 3.11Å
129	S	82.6	Confident	66.3	Low	48 Å²	48	109.8 Å²	109.8	34%	0.336	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	129.2	170.8	57.8	0	0	0	0	110.6	S102 S103 L104	S102-S129 PolarHBondContact O-N 2.96Å; S102-S129 PolarHBondContact O-OG 3.06Å; S103-S129 WeakPolarHBondContact CA-O 3.42Å; S103-S129 WeakPolarHBondContact CA-OG 3.45Å; S103-S129 WeakPolarHBondContact CB-OG 3.47Å; S103-S129 PolarHBondContact OG-OG 3.22Å; L104-S129 PolarHBondContact N-O 3.47Å
130	L	79.9	Confident	64.2	Low	82 Å²	82	116.2 Å²	116.2	43%	0.429	58%	0.578	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116.4	115.9	172	-75.2	179.1	0	0	0	108.3	L104 L117	L104-L130 HydrophobicContact CB-CD2 3.58Å; L104-L130 HydrophobicContact CD1-CD2 3.48Å; L104-L130 VanDerWaalsContact CD1-CD2 3.48Å; L104-L130 HydrophobicContact CG-CD2 3.56Å; L117-L130 HydrophobicContact CD1-CD1 4.3Å; L117-L130 HydrophobicContact CD1-CD2 3.47Å; L117-L130 VanDerWaalsContact CD1-CD2 3.47Å; L117-L130 HydrophobicContact CD1-CG 3.55Å; L117-L130 HydrophobicContact CG-CD1 4.32Å; L117-L130 HydrophobicContact CG-CD2 3.51Å; L117-L130 HydrophobicContact CG-CG 3.94Å
131	Q	79.5	Confident	62.1	Low	98 Å²	98	118.1 Å²	118.1	46%	0.458	61%	0.614	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-115.4	116.2	171.5	-69.1	-175.6	14.7	0	0	109.5	L104 Q105 Q106	L104-Q131 PolarHBondContact O-N 2.93Å; Q105-Q131 CarbonylContact C-O 3.58Å; Q105-Q131 WeakPolarHBondContact CA-O 3.43Å; Q105-Q131 HydrophobicContact CG-CB 4.44Å; Q106-Q131 PolarHBondContact N-O 3.3Å
132	Q	72.1	Confident	61.8	Low	94 Å²	94	121.7 Å²	121.7	44%	0.439	63%	0.629	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.1	129.4	172.4	-56.3	-166.8	35.6	0	0	109	Q106 S113	Q106-Q132 HydrophobicContact CB-CG 4.35Å; S113-Q132 PolarHBondContact OG-OE1 3.13Å
133	R	69.7	Low	61.6	Low	159 Å²	159	117.6 Å²	117.6	60%	0.6	62%	0.622	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-123.4	115.5	170.2	-73.2	-176.7	178.5	-106.7	4.4	109.1	Q106 R107 S108	Q106-R133 PolarHBondContact O-N 3.35Å; R107-R133 HydrophobicContact CG-CB 4.46Å; S108-R133 PolarHBondContact N-O 2.93Å
134	S	64.7	Low	62.1	Low	72 Å²	72	121.4 Å²	121.4	50%	0.503	64%	0.638	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.9	130.4	172.2	-58.9	0	0	0	0	108.7
135	R	60.9	Low	62.2	Low	206 Å²	206	119.2 Å²	119.2	78%	0.777	63%	0.631	S	S	*	*			trans	-116.2	107.3	167.3	-87.5	-169.6	174.2	-143.1	1.9	107.6
136	P	53.6	Low	61.9	Low	114 Å²	114	120.4 Å²	120.4	74%	0.74	64%	0.64	S	S	*	*			trans	-61.4	137.7	170.5	25.3	-30.7	0	0	0	109.1	M138	P136-M138 PolarHBondContact O-N 2.97Å
137	Q	51.6	Low	61.1	Low	154 Å²	154	124.9 Å²	124.9	72%	0.72	66%	0.659	S	S	*	*			trans	-80.9	95.3	164.2	-67.4	-136.5	-83.9	0	0	107	S139	Q137-S139 PolarHBondContact O-N 2.69Å
138	M	40.9	Very low	59.9	Low	167 Å²	167	125 Å²	125	82%	0.823	66%	0.664	S	S	*	*			trans	-73.1	101.9	152.7	-68.9	-128.1	-65	0	0	105.5	P136	P136-M138 PolarHBondContact O-N 2.97Å
139	S	41.3	Very low	58.4	Low	111 Å²	111	128.6 Å²	128.6	78%	0.776	67%	0.673	S	S	*	*			trans	-83.4	112.9	160.9	-153.9	0	0	0	0	105.6	Q137 S141	Q137-S139 PolarHBondContact O-N 2.69Å; S139-S141 PolarHBondContact O-N 3.14Å
140	Q	31.6	Very low	56.3	Low	179 Å²	179	135.3 Å²	135.3	84%	0.836	70%	0.701	S	S	*	*			trans	-73.5	102.1	166.6	-75.5	-171	-26	0	0	108.1
141	S	30.5	Very low	54.2	Low	188 Å²	188	140.2 Å²	140.2	100%	1.315	73%	0.726	S	S	*	*			trans	165.6	0	150.3	-79.1	0	0	0	0	108.2	S139	S139-S141 PolarHBondContact O-N 3.14Å

Retrieved 141 of 141 residues in 68.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).