A0AA82N422_SCHMA Loading...

Transposase

AlphaFold DB (A0A5K4F816), UniProt , Accession A0AA82N422, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 81 aa.

						>A0AA82N422_SCHMA|A0AA82N422
MLSLIYKEYQHEKTLRKAQLETKKRTMLVSIDEMTNGLLTKIDENVSKVFFSVCWCHCSPVFSPSLRLFDLSIEFRNTLFA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	85.6	Confident	93.8	Very high	174 Å²	174	124.4 Å²	124.4	86%	0.857	60%	0.595	S	S	*	*				0	-61	0	-160.7	173	77.8	0	0	111.9	S3 L4 I5	M1-S3 VanDerWaalsContact C-N 3.3Å; M1-S3 PolarHBondContact O-N 3.23Å; M1-L4 PolarHBondContact O-N 3.09Å; M1-L4 VanDerWaalsContact O-N 3.09Å; M1-I5 HydrophobicContact CG-CD1 4.11Å; M1-I5 PolarHBondContact O-N 3.23Å
2	L	91.8	Very high	94	Very high	143 Å²	143	120.9 Å²	120.9	75%	0.749	58%	0.578	S	S	*	*	H	α-helix	trans	-55.8	-38.2	-179.4	-67.1	173.5	0	0	0	114.4	L4 I5 Y6	L2-L4 VanDerWaalsContact C-N 3.35Å; L2-L4 PolarHBondContact O-N 2.94Å; L2-I5 PolarHBondContact O-N 3.46Å; L2-Y6 WeakPolarHBondContact O-CB 3.41Å; L2-Y6 PolarHBondContact O-N 3.45Å
3	S	92.4	Very high	94.2	Very high	79 Å²	79	120.8 Å²	120.8	55%	0.552	57%	0.573	S	S	*	*	H	α-helix	trans	-65.4	-33.7	178.1	56.4	0	0	0	0	113.8	M1 K7	M1-S3 VanDerWaalsContact C-N 3.3Å; M1-S3 PolarHBondContact O-N 3.23Å; S3-K7 WeakPolarHBondContact O-CG 3.46Å; S3-K7 PolarHBondContact O-N 3.32Å; S3-K7 VanDerWaalsContact O-N 3.12Å
4	L	94	Very high	94.3	Very high	119 Å²	119	118.7 Å²	118.7	62%	0.623	57%	0.573	S	S	*	*	H	α-helix	trans	-71.5	-47.8	176.9	-70.4	171.4	0	0	0	110.3	M1 L2 Y6 K7 E8	M1-L4 PolarHBondContact O-N 3.09Å; M1-L4 VanDerWaalsContact O-N 3.09Å; L2-L4 VanDerWaalsContact C-N 3.35Å; L2-L4 PolarHBondContact O-N 2.94Å; L4-Y6 VanDerWaalsContact C-N 3.26Å; L4-Y6 PolarHBondContact O-N 3.12Å; L4-K7 PolarHBondContact O-N 2.95Å; L4-K7 VanDerWaalsContact O-N 3.13Å; L4-E8 PolarHBondContact O-N 3.44Å
5	I	93.9	Very high	94.5	Very high	93 Å²	93	116.5 Å²	116.5	48%	0.477	56%	0.564	S	S	.	*	H	α-helix	trans	-56.9	-43.2	176.3	-62.2	168.9	0	0	0	110.4	M1 L2 E8 Y9	M1-I5 HydrophobicContact CG-CD1 4.11Å; M1-I5 PolarHBondContact O-N 3.23Å; L2-I5 PolarHBondContact O-N 3.46Å; I5-E8 PolarHBondContact O-N 3.13Å; I5-Y9 WeakPolarHBondContact O-CB 3.39Å; I5-Y9 PolarHBondContact O-N 2.95Å
6	Y	95.5	Very high	94.6	Very high	143 Å²	143	118.1 Å²	118.1	56%	0.561	56%	0.563	S	S	*	*	H	α-helix	trans	-65.1	-41.6	177.9	-176.1	-98.4	0	0	0	112.9	L2 L4 Y9 Q10	L2-Y6 WeakPolarHBondContact O-CB 3.41Å; L2-Y6 PolarHBondContact O-N 3.45Å; L4-Y6 VanDerWaalsContact C-N 3.26Å; L4-Y6 PolarHBondContact O-N 3.12Å; Y6-Y9 PolarHBondContact O-N 3.44Å; Y6-Q10 HydrophobicContact CD1-CG 4.15Å; Y6-Q10 HydrophobicContact CE1-CG 3.73Å; Y6-Q10 HydrophobicContact CE2-CG 4.44Å; Y6-Q10 VanDerWaalsContact CZ-NE2 3.27Å; Y6-Q10 WeakPolarHBondContact O-CG 3.34Å; Y6-Q10 PolarHBondContact O-N 2.97Å; Y6-Q10 PolarHBondContact OH-NE2 2.96Å
7	K	95.1	Very high	94.7	Very high	148 Å²	148	119.6 Å²	119.6	64%	0.643	57%	0.566	S	S	*	*	H	α-helix	trans	-63.5	-43.3	176.6	-77.9	179.8	179.3	-173.5	0	111.7	S3 L4 Q10 H11	S3-K7 WeakPolarHBondContact O-CG 3.46Å; S3-K7 PolarHBondContact O-N 3.32Å; S3-K7 VanDerWaalsContact O-N 3.12Å; L4-K7 PolarHBondContact O-N 2.95Å; L4-K7 VanDerWaalsContact O-N 3.13Å; K7-Q10 PolarHBondContact O-N 3.42Å; K7-H11 WeakPolarHBondContact O-CB 3.28Å; K7-H11 PolarHBondContact O-N 2.88Å
8	E	95.4	Very high	94.8	Very high	141 Å²	141	115.9 Å²	115.9	66%	0.659	56%	0.559	S	S	*	*	H	α-helix	trans	-62.1	-44.9	176.9	-170.4	169.9	-163.5	0	0	111.2	L4 I5 Q10 H11 E12	L4-E8 PolarHBondContact O-N 3.44Å; I5-E8 PolarHBondContact O-N 3.13Å; E8-Q10 PolarHBondContact O-N 3.26Å; E8-H11 PolarHBondContact O-N 3.41Å; E8-E12 WeakPolarHBondContact O-CB 3.46Å; E8-E12 PolarHBondContact O-N 2.86Å
9	Y	95.8	Very high	94.9	Very high	135 Å²	135	115.9 Å²	115.9	53%	0.529	56%	0.558	S	S	.	*	H	α-helix	trans	-59.9	-43.5	174.3	174.9	-104	0	0	0	113.1	I5 Y6 H11 E12 K13	I5-Y9 WeakPolarHBondContact O-CB 3.39Å; I5-Y9 PolarHBondContact O-N 2.95Å; Y6-Y9 PolarHBondContact O-N 3.44Å; Y9-H11 VanDerWaalsContact C-N 3.35Å; Y9-E12 PolarHBondContact O-N 2.91Å; Y9-K13 VanDerWaalsContact O-CB 3.28Å; Y9-K13 WeakPolarHBondContact O-CB 3.37Å; Y9-K13 PolarHBondContact O-N 3.33Å
10	Q	96.1	Very high	95	Very high	59 Å²	59	116 Å²	116	28%	0.276	56%	0.561	S	S	.	*	H	α-helix	trans	-66.3	-38.5	177.5	-71.4	-62.9	-17.1	0	0	112.2	Y6 K7 E8 T14	Y6-Q10 HydrophobicContact CD1-CG 4.15Å; Y6-Q10 HydrophobicContact CE1-CG 3.73Å; Y6-Q10 HydrophobicContact CE2-CG 4.44Å; Y6-Q10 VanDerWaalsContact CZ-NE2 3.27Å; Y6-Q10 WeakPolarHBondContact O-CG 3.34Å; Y6-Q10 PolarHBondContact O-N 2.97Å; Y6-Q10 PolarHBondContact OH-NE2 2.96Å; K7-Q10 PolarHBondContact O-N 3.42Å; E8-Q10 PolarHBondContact O-N 3.26Å; Q10-T14 WeakPolarHBondContact O-CB 3.46Å; Q10-T14 PolarHBondContact O-N 2.88Å; Q10-T14 PolarHBondContact O-OG1 3.2Å
11	H	95.9	Very high	95.1	Very high	134 Å²	134	114.5 Å²	114.5	62%	0.62	55%	0.553	S	S	*	*	H	α-helix	trans	-62.7	-48.4	174.7	-177.1	-87.2	0	0	0	110.7	K7 E8 Y9 K13 T14 L15	K7-H11 WeakPolarHBondContact O-CB 3.28Å; K7-H11 PolarHBondContact O-N 2.88Å; E8-H11 PolarHBondContact O-N 3.41Å; Y9-H11 VanDerWaalsContact C-N 3.35Å; H11-K13 PolarHBondContact O-N 3.26Å; H11-T14 PolarHBondContact O-N 2.63Å; H11-L15 WeakPolarHBondContact O-CB 3.38Å; H11-L15 PolarHBondContact O-N 2.76Å
12	E	96.3	Very high	95.7	Very high	83 Å²	83	110.3 Å²	110.3	39%	0.388	54%	0.537	S	S	.	.	H	α-helix	trans	-62.3	-43.4	178.1	-168.9	-178.4	-173.3	0	0	112.1	E8 Y9 T14 L15 R16	E8-E12 WeakPolarHBondContact O-CB 3.46Å; E8-E12 PolarHBondContact O-N 2.86Å; Y9-E12 PolarHBondContact O-N 2.91Å; E12-T14 VanDerWaalsContact C-N 3.29Å; E12-T14 PolarHBondContact O-N 3.28Å; E12-L15 PolarHBondContact O-N 2.98Å; E12-R16 HydrophobicContact CG-CG 4.5Å; E12-R16 WeakPolarHBondContact O-CB 3.35Å; E12-R16 WeakPolarHBondContact O-CG 3.49Å; E12-R16 PolarHBondContact O-N 3.04Å; E12-R16 IonicContact OE1-CZ 3.29Å; E12-R16 VanDerWaalsContact OE1-CZ 3.29Å; E12-R16 IonicContact OE1-NE 3.26Å; E12-R16 PolarHBondContact OE1-NE 2.77Å; E12-R16 IonicContact OE1-NH2 2.63Å; E12-R16 PolarHBondContact OE1-NH2 3.17Å; E12-R16 IonicContact OE2-NH2 3.83Å
13	K	96.9	Very high	95.9	Very high	119 Å²	119	109.9 Å²	109.9	52%	0.517	53%	0.529	S	S	.	.	H	α-helix	trans	-58.2	-43	174.6	-177.7	-178.5	178.2	-176.4	0	111.7	Y9 H11 K17	Y9-K13 VanDerWaalsContact O-CB 3.28Å; Y9-K13 WeakPolarHBondContact O-CB 3.37Å; Y9-K13 PolarHBondContact O-N 3.33Å; H11-K13 PolarHBondContact O-N 3.26Å; K13-K17 WeakPolarHBondContact O-CB 3.38Å; K13-K17 PolarHBondContact O-N 3.37Å
14	T	95.9	Very high	96.1	Very high	92 Å²	92	111.6 Å²	111.6	56%	0.564	53%	0.527	S	S	*	.	H	α-helix	trans	-67.4	-42.9	179	-57.2	0	0	0	0	111.1	Q10 H11 E12 K17 A18	Q10-T14 WeakPolarHBondContact O-CB 3.46Å; Q10-T14 PolarHBondContact O-N 2.88Å; Q10-T14 PolarHBondContact O-OG1 3.2Å; H11-T14 PolarHBondContact O-N 2.63Å; E12-T14 VanDerWaalsContact C-N 3.29Å; E12-T14 PolarHBondContact O-N 3.28Å; T14-K17 PolarHBondContact O-N 3.47Å; T14-A18 PolarHBondContact O-N 3.49Å
15	L	96.5	Very high	96.2	Very high	86 Å²	86	114.4 Å²	114.4	45%	0.45	53%	0.529	S	S	.	.	H	α-helix	trans	-60.7	-49.5	176.3	-178.2	66	0	0	0	111.6	H11 E12 K17 A18 Q19	H11-L15 WeakPolarHBondContact O-CB 3.38Å; H11-L15 PolarHBondContact O-N 2.76Å; E12-L15 PolarHBondContact O-N 2.98Å; L15-K17 VanDerWaalsContact C-N 3.3Å; L15-K17 PolarHBondContact O-N 3.38Å; L15-A18 PolarHBondContact O-N 3.03Å; L15-A18 VanDerWaalsContact O-N 3.17Å; L15-Q19 WeakPolarHBondContact O-CG 3.39Å; L15-Q19 PolarHBondContact O-N 2.89Å
16	R	96.3	Very high	96.3	Very high	142 Å²	142	114 Å²	114	54%	0.536	53%	0.531	S	S	.	.	H	α-helix	trans	-59.7	-41	177.5	-71.1	-179.7	-172	-174.1	2.5	111.5	E12 Q19 L20	E12-R16 HydrophobicContact CG-CG 4.5Å; E12-R16 WeakPolarHBondContact O-CB 3.35Å; E12-R16 WeakPolarHBondContact O-CG 3.49Å; E12-R16 PolarHBondContact O-N 3.04Å; E12-R16 IonicContact OE1-CZ 3.29Å; E12-R16 VanDerWaalsContact OE1-CZ 3.29Å; E12-R16 IonicContact OE1-NE 3.26Å; E12-R16 PolarHBondContact OE1-NE 2.77Å; E12-R16 IonicContact OE1-NH2 2.63Å; E12-R16 PolarHBondContact OE1-NH2 3.17Å; E12-R16 IonicContact OE2-NH2 3.83Å; R16-Q19 PolarHBondContact O-N 2.94Å; R16-L20 WeakPolarHBondContact O-CB 3.33Å; R16-L20 WeakPolarHBondContact O-CG 3.5Å; R16-L20 PolarHBondContact O-N 3.34Å
17	K	97	Very high	96.3	Very high	144 Å²	144	111.9 Å²	111.9	63%	0.626	53%	0.527	S	S	*	.	H	α-helix	trans	-62.3	-45.4	175.6	-171.6	178.5	179.6	-176.7	0	111.4	K13 T14 L15 Q19 L20 E21	K13-K17 WeakPolarHBondContact O-CB 3.38Å; K13-K17 PolarHBondContact O-N 3.37Å; T14-K17 PolarHBondContact O-N 3.47Å; L15-K17 VanDerWaalsContact C-N 3.3Å; L15-K17 PolarHBondContact O-N 3.38Å; K17-Q19 PolarHBondContact O-N 3.31Å; K17-L20 PolarHBondContact O-N 2.89Å; K17-E21 WeakPolarHBondContact O-CG 3.43Å; K17-E21 PolarHBondContact O-N 3.42Å
18	A	96.5	Very high	96.3	Very high	52 Å²	52	109.6 Å²	109.6	43%	0.43	52%	0.522	S	S	.	.	H	α-helix	trans	-63.4	-40.8	178	0	0	0	0	0	112.4	T14 L15 E21 T22	T14-A18 PolarHBondContact O-N 3.49Å; L15-A18 PolarHBondContact O-N 3.03Å; L15-A18 VanDerWaalsContact O-N 3.17Å; A18-E21 PolarHBondContact O-N 2.97Å; A18-T22 WeakPolarHBondContact O-CB 3.41Å; A18-T22 PolarHBondContact O-N 3.5Å; A18-T22 PolarHBondContact O-OG1 3.43Å
19	Q	97	Very high	96.3	Very high	116 Å²	116	106.7 Å²	106.7	54%	0.542	51%	0.513	S	S	.	.	H	α-helix	trans	-63.3	-42.9	175.5	-73.2	176.5	-28.7	0	0	112.1	L15 R16 K17 T22 K23	L15-Q19 WeakPolarHBondContact O-CG 3.39Å; L15-Q19 PolarHBondContact O-N 2.89Å; R16-Q19 PolarHBondContact O-N 2.94Å; K17-Q19 PolarHBondContact O-N 3.31Å; Q19-T22 PolarHBondContact O-N 3.1Å; Q19-K23 WeakPolarHBondContact O-CB 3.43Å; Q19-K23 PolarHBondContact O-N 2.99Å
20	L	97.2	Very high	96.3	Very high	117 Å²	117	102.8 Å²	102.8	61%	0.613	51%	0.506	S	S	*	.	H	α-helix	trans	-65.6	-43.6	177.6	-74.2	172	0	0	0	112.4	R16 K17 T22 K23 K24	R16-L20 WeakPolarHBondContact O-CB 3.33Å; R16-L20 WeakPolarHBondContact O-CG 3.5Å; R16-L20 PolarHBondContact O-N 3.34Å; K17-L20 PolarHBondContact O-N 2.89Å; L20-T22 VanDerWaalsContact C-N 3.31Å; L20-T22 PolarHBondContact O-N 3.47Å; L20-K23 PolarHBondContact O-N 3.41Å; L20-K24 WeakPolarHBondContact O-CB 3.38Å; L20-K24 PolarHBondContact O-N 2.97Å
21	E	96.8	Very high	96.2	Very high	86 Å²	86	104.6 Å²	104.6	40%	0.402	52%	0.517	S	S	.	.	H	α-helix	trans	-62.9	-39.9	175.7	-72.8	-59.7	145.3	0	0	111.7	K17 A18 K24 R25	K17-E21 WeakPolarHBondContact O-CG 3.43Å; K17-E21 PolarHBondContact O-N 3.42Å; A18-E21 PolarHBondContact O-N 2.97Å; E21-K24 PolarHBondContact O-N 3.4Å; E21-R25 WeakPolarHBondContact O-CG 3.4Å; E21-R25 PolarHBondContact O-N 3Å
22	T	96.5	Very high	96.2	Very high	85 Å²	85	102.7 Å²	102.7	52%	0.521	51%	0.511	S	S	.	.	H	α-helix	trans	-63.2	-49.1	175.1	-55.3	0	0	0	0	110.6	A18 Q19 L20 K24 R25 T26	A18-T22 WeakPolarHBondContact O-CB 3.41Å; A18-T22 PolarHBondContact O-N 3.5Å; A18-T22 PolarHBondContact O-OG1 3.43Å; Q19-T22 PolarHBondContact O-N 3.1Å; L20-T22 VanDerWaalsContact C-N 3.31Å; L20-T22 PolarHBondContact O-N 3.47Å; T22-K24 VanDerWaalsContact C-N 3.3Å; T22-K24 PolarHBondContact O-N 2.93Å; T22-R25 PolarHBondContact O-N 3.4Å; T22-R25 VanDerWaalsContact O-N 3.15Å; T22-T26 PolarHBondContact O-N 3.35Å; T22-T26 PolarHBondContact O-OG1 2.86Å; T22-T26 VanDerWaalsContact O-OG1 3.1Å
23	K	96.8	Very high	96.1	Very high	134 Å²	134	104.8 Å²	104.8	58%	0.583	52%	0.521	S	S	*	.	H	α-helix	trans	-58.5	-42	177.1	-173.8	176	179.9	177.7	0	111.8	Q19 L20 T26 M27	Q19-K23 WeakPolarHBondContact O-CB 3.43Å; Q19-K23 PolarHBondContact O-N 2.99Å; L20-K23 PolarHBondContact O-N 3.41Å; K23-T26 PolarHBondContact O-N 3.4Å; K23-M27 HydrophobicContact CG-CE 4.22Å; K23-M27 HydrophobicContact CG-SD 4.4Å; K23-M27 VanDerWaalsContact O-CG 3.31Å; K23-M27 WeakPolarHBondContact O-CG 3.31Å; K23-M27 PolarHBondContact O-N 3.33Å
24	K	96.4	Very high	96.1	Very high	115 Å²	115	105.1 Å²	105.1	50%	0.5	53%	0.526	S	S	.	.	H	α-helix	trans	-60.1	-46.3	175.9	-176.2	-177.4	175.9	-174.8	0	111.5	L20 E21 T22 M27 L28	L20-K24 WeakPolarHBondContact O-CB 3.38Å; L20-K24 PolarHBondContact O-N 2.97Å; E21-K24 PolarHBondContact O-N 3.4Å; T22-K24 VanDerWaalsContact C-N 3.3Å; T22-K24 PolarHBondContact O-N 2.93Å; K24-M27 PolarHBondContact O-N 3.15Å; K24-L28 HydrophobicContact CG-CD1 4.31Å; K24-L28 WeakPolarHBondContact O-CG 3.36Å; K24-L28 PolarHBondContact O-N 3.18Å
25	R	96	Very high	96	Very high	179 Å²	179	103.8 Å²	103.8	68%	0.675	52%	0.517	S	S	*	.	H	α-helix	trans	-62.1	-46.2	177	-72.1	176.4	-176.8	-156.8	-0.4	111.8	E21 T22 M27 L28 V29	E21-R25 WeakPolarHBondContact O-CG 3.4Å; E21-R25 PolarHBondContact O-N 3Å; T22-R25 PolarHBondContact O-N 3.4Å; T22-R25 VanDerWaalsContact O-N 3.15Å; R25-M27 VanDerWaalsContact C-N 3.34Å; R25-M27 PolarHBondContact O-N 3Å; R25-L28 PolarHBondContact O-N 3.02Å; R25-V29 WeakPolarHBondContact O-CG2 3.3Å; R25-V29 PolarHBondContact O-N 3.2Å
26	T	96.1	Very high	95.9	Very high	83 Å²	83	103.1 Å²	103.1	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-59.5	-45.1	177.6	-54	0	0	0	0	111.6	T22 K23 L28 V29 S30	T22-T26 PolarHBondContact O-N 3.35Å; T22-T26 PolarHBondContact O-OG1 2.86Å; T22-T26 VanDerWaalsContact O-OG1 3.1Å; K23-T26 PolarHBondContact O-N 3.4Å; T26-L28 VanDerWaalsContact C-N 3.34Å; T26-L28 PolarHBondContact O-N 3.03Å; T26-V29 PolarHBondContact O-N 3.41Å; T26-S30 PolarHBondContact O-N 3.44Å; T26-S30 PolarHBondContact O-OG 3Å
27	M	96.4	Very high	95.7	Very high	99 Å²	99	98 Å²	98	49%	0.488	51%	0.505	S	S	.	.	H	α-helix	trans	-61.9	-40.9	177	-70.9	-176.3	-55.7	0	0	112.2	K23 K24 R25 S30 I31	K23-M27 HydrophobicContact CG-CE 4.22Å; K23-M27 HydrophobicContact CG-SD 4.4Å; K23-M27 VanDerWaalsContact O-CG 3.31Å; K23-M27 WeakPolarHBondContact O-CG 3.31Å; K23-M27 PolarHBondContact O-N 3.33Å; K24-M27 PolarHBondContact O-N 3.15Å; R25-M27 VanDerWaalsContact C-N 3.34Å; R25-M27 PolarHBondContact O-N 3Å; M27-S30 PolarHBondContact O-N 3.21Å; M27-I31 VanDerWaalsContact O-CG1 3.29Å; M27-I31 WeakPolarHBondContact O-CG1 3.34Å; M27-I31 PolarHBondContact O-N 3.42Å
28	L	95.6	Very high	95.5	Very high	100 Å²	100	96 Å²	96	52%	0.524	50%	0.501	S	S	.	.	H	α-helix	trans	-64.6	-40.7	177.2	-73.4	171.6	0	0	0	112.3	K24 R25 T26 I31 D32	K24-L28 HydrophobicContact CG-CD1 4.31Å; K24-L28 WeakPolarHBondContact O-CG 3.36Å; K24-L28 PolarHBondContact O-N 3.18Å; R25-L28 PolarHBondContact O-N 3.02Å; T26-L28 VanDerWaalsContact C-N 3.34Å; T26-L28 PolarHBondContact O-N 3.03Å; L28-I31 PolarHBondContact O-N 3.36Å; L28-D32 WeakPolarHBondContact O-CB 3.49Å; L28-D32 PolarHBondContact O-N 3.41Å
29	V	94.9	Very high	95.3	Very high	80 Å²	80	98.1 Å²	98.1	49%	0.485	51%	0.505	S	S	.	.	H	α-helix	trans	-61.9	-44.6	175.1	172.5	0	0	0	0	110.8	R25 T26 I31 D32 E33	R25-V29 WeakPolarHBondContact O-CG2 3.3Å; R25-V29 PolarHBondContact O-N 3.2Å; T26-V29 PolarHBondContact O-N 3.41Å; V29-I31 VanDerWaalsContact C-N 3.33Å; V29-I31 PolarHBondContact O-N 2.93Å; V29-D32 PolarHBondContact O-N 3.3Å; V29-E33 WeakPolarHBondContact O-CG 3.45Å; V29-E33 PolarHBondContact O-N 2.99Å
30	S	95.2	Very high	95	Very high	54 Å²	54	96.2 Å²	96.2	38%	0.378	50%	0.501	S	S	.	.	H	α-helix	trans	-63.4	-37.4	177	-57.9	0	0	0	0	113	T26 M27 M34	T26-S30 PolarHBondContact O-N 3.44Å; T26-S30 PolarHBondContact O-OG 3Å; M27-S30 PolarHBondContact O-N 3.21Å; S30-M34 WeakPolarHBondContact O-CB 3.42Å; S30-M34 VanDerWaalsContact O-CG 3.3Å; S30-M34 WeakPolarHBondContact O-CG 3.37Å; S30-M34 PolarHBondContact O-N 3.03Å
31	I	95	Very high	94.6	Very high	97 Å²	97	96.9 Å²	96.9	50%	0.497	50%	0.499	S	S	.	.	H	α-helix	trans	-65.7	-41.7	175.1	-69	165.1	0	0	0	110.5	M27 L28 V29 M34 T35	M27-I31 VanDerWaalsContact O-CG1 3.29Å; M27-I31 WeakPolarHBondContact O-CG1 3.34Å; M27-I31 PolarHBondContact O-N 3.42Å; L28-I31 PolarHBondContact O-N 3.36Å; V29-I31 VanDerWaalsContact C-N 3.33Å; V29-I31 PolarHBondContact O-N 2.93Å; I31-M34 PolarHBondContact O-N 2.96Å; I31-T35 VanDerWaalsContact O-CB 3.32Å; I31-T35 WeakPolarHBondContact O-CB 3.29Å; I31-T35 PolarHBondContact O-N 2.71Å; I31-T35 PolarHBondContact O-OG1 2.87Å
32	D	95.1	Very high	94.2	Very high	93 Å²	93	97.4 Å²	97.4	50%	0.497	50%	0.504	S	S	.	.	H	α-helix	trans	-63.1	-46.5	177.7	-171.1	64	0	0	0	111.4	L28 V29 M34 T35 N36	L28-D32 WeakPolarHBondContact O-CB 3.49Å; L28-D32 PolarHBondContact O-N 3.41Å; V29-D32 PolarHBondContact O-N 3.3Å; D32-M34 PolarHBondContact O-N 3.32Å; D32-T35 PolarHBondContact O-N 2.91Å; D32-N36 WeakPolarHBondContact O-CB 3.31Å; D32-N36 VanDerWaalsContact O-CG 3.25Å; D32-N36 PolarHBondContact O-N 3.12Å; D32-N36 PolarHBondContact O-ND2 2.85Å; D32-N36 VanDerWaalsContact O-ND2 3.12Å; D32-N36 PolarHBondContact OD1-ND2 2.9Å; D32-N36 PolarHBondContact OD2-ND2 3.23Å
33	E	94.6	Very high	93.8	Very high	127 Å²	127	98.7 Å²	98.7	59%	0.593	51%	0.507	S	S	*	.	H	α-helix	trans	-58.9	-44.9	174.9	-72.9	174.5	176.7	0	0	112.4	V29 G37	V29-E33 WeakPolarHBondContact O-CG 3.45Å; V29-E33 PolarHBondContact O-N 2.99Å; E33-G37 PolarHBondContact O-N 3.07Å
34	M	95.6	Very high	93.3	Very high	127 Å²	127	96.9 Å²	96.9	63%	0.626	50%	0.501	S	S	*	.	H	α-helix	trans	-63.5	-43.7	176.3	-76.9	177.1	48.2	0	0	112	S30 I31 D32 G37 L38	S30-M34 WeakPolarHBondContact O-CB 3.42Å; S30-M34 VanDerWaalsContact O-CG 3.3Å; S30-M34 WeakPolarHBondContact O-CG 3.37Å; S30-M34 PolarHBondContact O-N 3.03Å; I31-M34 PolarHBondContact O-N 2.96Å; D32-M34 PolarHBondContact O-N 3.32Å; M34-G37 PolarHBondContact O-N 3.3Å; M34-L38 WeakPolarHBondContact O-CB 3.49Å; M34-L38 VanDerWaalsContact O-CG 3.31Å; M34-L38 WeakPolarHBondContact O-CG 3.3Å; M34-L38 PolarHBondContact O-N 2.95Å
35	T	95.2	Very high	92.8	Very high	63 Å²	63	95.7 Å²	95.7	39%	0.387	50%	0.5	S	S	.	.	H	α-helix	trans	-65.4	-47.1	-178.7	-57	0	0	0	0	110.1	I31 D32 G37 L38 L39	I31-T35 VanDerWaalsContact O-CB 3.32Å; I31-T35 WeakPolarHBondContact O-CB 3.29Å; I31-T35 PolarHBondContact O-N 2.71Å; I31-T35 PolarHBondContact O-OG1 2.87Å; D32-T35 PolarHBondContact O-N 2.91Å; T35-G37 PolarHBondContact O-N 3.36Å; T35-L38 PolarHBondContact O-N 3.44Å; T35-L39 HydrophobicContact CG2-CD1 3.95Å; T35-L39 HydrophobicContact CG2-CG 4.34Å; T35-L39 WeakPolarHBondContact O-CB 3.32Å; T35-L39 VanDerWaalsContact O-CG 3.3Å; T35-L39 WeakPolarHBondContact O-CG 3.32Å; T35-L39 PolarHBondContact O-N 3.23Å
36	N	93.4	Very high	92.3	Very high	72 Å²	72	91.5 Å²	91.5	39%	0.385	49%	0.494	S	S	.	.	H	α-helix	trans	-62.5	-43.6	176.9	-69.7	-32.1	0	0	0	111.2	D32 L38 L39 T40	D32-N36 WeakPolarHBondContact O-CB 3.31Å; D32-N36 VanDerWaalsContact O-CG 3.25Å; D32-N36 PolarHBondContact O-N 3.12Å; D32-N36 PolarHBondContact O-ND2 2.85Å; D32-N36 VanDerWaalsContact O-ND2 3.12Å; D32-N36 PolarHBondContact OD1-ND2 2.9Å; D32-N36 PolarHBondContact OD2-ND2 3.23Å; N36-L38 VanDerWaalsContact C-N 3.32Å; N36-L38 PolarHBondContact O-N 2.99Å; N36-L39 PolarHBondContact O-N 3.43Å; N36-T40 PolarHBondContact O-N 3.48Å; N36-T40 PolarHBondContact O-OG1 2.85Å
37	G	92.6	Very high	91.5	Very high	34 Å²	34	89.8 Å²	89.8	35%	0.351	49%	0.486	S	S	.	.	H	α-helix	trans	-61.5	-36.3	175.4	0	0	0	0	0	113.8	E33 M34 T35 K41	E33-G37 PolarHBondContact O-N 3.07Å; M34-G37 PolarHBondContact O-N 3.3Å; T35-G37 PolarHBondContact O-N 3.36Å; G37-K41 WeakPolarHBondContact O-CG 3.36Å; G37-K41 PolarHBondContact O-N 2.93Å
38	L	93.8	Very high	90.8	Very high	103 Å²	103	91.2 Å²	91.2	54%	0.539	49%	0.489	S	S	.	.	H	α-helix	trans	-72.7	-43.9	174.9	-72.8	172.6	0	0	0	112	M34 T35 N36 T40 K41 I42	M34-L38 WeakPolarHBondContact O-CB 3.49Å; M34-L38 VanDerWaalsContact O-CG 3.31Å; M34-L38 WeakPolarHBondContact O-CG 3.3Å; M34-L38 PolarHBondContact O-N 2.95Å; T35-L38 PolarHBondContact O-N 3.44Å; N36-L38 VanDerWaalsContact C-N 3.32Å; N36-L38 PolarHBondContact O-N 2.99Å; L38-T40 PolarHBondContact O-N 3.31Å; L38-K41 PolarHBondContact O-N 3.22Å; L38-I42 WeakPolarHBondContact O-CG1 3.34Å; L38-I42 PolarHBondContact O-N 3.43Å
39	L	92.2	Very high	90	Very high	97 Å²	97	90.6 Å²	90.6	51%	0.508	49%	0.489	S	S	.	.	H	α-helix	trans	-61.5	-43.6	178.1	-73.3	174.1	0	0	0	111.4	T35 N36 K41 I42 D43	T35-L39 HydrophobicContact CG2-CD1 3.95Å; T35-L39 HydrophobicContact CG2-CG 4.34Å; T35-L39 WeakPolarHBondContact O-CB 3.32Å; T35-L39 VanDerWaalsContact O-CG 3.3Å; T35-L39 WeakPolarHBondContact O-CG 3.32Å; T35-L39 PolarHBondContact O-N 3.23Å; N36-L39 PolarHBondContact O-N 3.43Å; L39-K41 VanDerWaalsContact C-N 3.33Å; L39-K41 PolarHBondContact O-N 2.94Å; L39-I42 PolarHBondContact O-N 3.09Å; L39-D43 WeakPolarHBondContact O-CB 3.48Å; L39-D43 PolarHBondContact O-N 2.89Å
40	T	89.4	Confident	89	Confident	75 Å²	75	93.2 Å²	93.2	46%	0.46	49%	0.494	S	S	.	.	H	α-helix	trans	-60.8	-42	175	-56.7	0	0	0	0	111.7	N36 L38 I42 D43 E44	N36-T40 PolarHBondContact O-N 3.48Å; N36-T40 PolarHBondContact O-OG1 2.85Å; L38-T40 PolarHBondContact O-N 3.31Å; T40-I42 VanDerWaalsContact C-N 3.33Å; T40-I42 PolarHBondContact O-N 3.34Å; T40-D43 PolarHBondContact O-N 3.5Å; T40-E44 WeakPolarHBondContact O-CB 3.32Å; T40-E44 WeakPolarHBondContact O-CG 3.42Å; T40-E44 PolarHBondContact O-N 3.45Å
41	K	89.6	Confident	87.6	Confident	132 Å²	132	97 Å²	97	57%	0.574	50%	0.504	S	S	*	.	H	α-helix	trans	-64.3	-38.1	175.7	-75.1	176	-178	-179.9	0	112.6	G37 L38 L39 N45	G37-K41 WeakPolarHBondContact O-CG 3.36Å; G37-K41 PolarHBondContact O-N 2.93Å; L38-K41 PolarHBondContact O-N 3.22Å; L39-K41 VanDerWaalsContact C-N 3.33Å; L39-K41 PolarHBondContact O-N 2.94Å; K41-N45 WeakPolarHBondContact O-CB 3.43Å; K41-N45 PolarHBondContact O-N 3.31Å; K41-N45 VanDerWaalsContact O-N 3.09Å; K41-N45 PolarHBondContact O-ND2 3.14Å
42	I	88.8	Confident	86.5	Confident	97 Å²	97	94.6 Å²	94.6	50%	0.497	50%	0.496	S	S	.	.	H	α-helix	trans	-65.7	-47.1	175.5	-68.4	166.5	0	0	0	109.5	L38 L39 T40 E44 N45 V46	L38-I42 WeakPolarHBondContact O-CG1 3.34Å; L38-I42 PolarHBondContact O-N 3.43Å; L39-I42 PolarHBondContact O-N 3.09Å; T40-I42 VanDerWaalsContact C-N 3.33Å; T40-I42 PolarHBondContact O-N 3.34Å; I42-E44 PolarHBondContact O-N 3.19Å; I42-N45 PolarHBondContact O-N 2.84Å; I42-N45 VanDerWaalsContact O-N 3.14Å; I42-V46 HydrophobicContact CG2-CG2 4.1Å; I42-V46 WeakPolarHBondContact O-CB 3.25Å; I42-V46 VanDerWaalsContact O-CG2 3.32Å; I42-V46 WeakPolarHBondContact O-CG2 3.46Å; I42-V46 PolarHBondContact O-N 3.47Å
43	D	87.4	Confident	85.2	Confident	112 Å²	112	92.9 Å²	92.9	60%	0.599	49%	0.489	S	S	*	.	H	α-helix	trans	-58.8	-47	178.6	-173.6	71.3	0	0	0	111.8	L39 T40 N45 V46 S47	L39-D43 WeakPolarHBondContact O-CB 3.48Å; L39-D43 PolarHBondContact O-N 2.89Å; T40-D43 PolarHBondContact O-N 3.5Å; D43-N45 VanDerWaalsContact C-N 3.3Å; D43-N45 PolarHBondContact O-N 3.49Å; D43-V46 PolarHBondContact O-N 2.81Å; D43-S47 WeakPolarHBondContact O-CB 3.46Å; D43-S47 PolarHBondContact O-N 2.82Å
44	E	86.4	Confident	83.5	Confident	95 Å²	95	89.3 Å²	89.3	44%	0.444	48%	0.477	S	S	.	.	H	α-helix	trans	-58.6	-41.1	174.3	-75.9	178.4	-165.6	0	0	112.5	T40 I42 K48	T40-E44 WeakPolarHBondContact O-CB 3.32Å; T40-E44 WeakPolarHBondContact O-CG 3.42Å; T40-E44 PolarHBondContact O-N 3.45Å; I42-E44 PolarHBondContact O-N 3.19Å; E44-K48 WeakPolarHBondContact O-CB 3.49Å; E44-K48 VanDerWaalsContact O-CG 3.25Å; E44-K48 WeakPolarHBondContact O-CG 3.37Å; E44-K48 PolarHBondContact O-N 3.22Å
45	N	86.5	Confident	81.5	Confident	91 Å²	91	92.1 Å²	92.1	49%	0.487	48%	0.481	S	S	.	.	H	α-helix	trans	-72.3	-42.6	-179.8	-74.8	-20.6	0	0	0	112	K41 I42 D43 S47 K48 V49	K41-N45 WeakPolarHBondContact O-CB 3.43Å; K41-N45 PolarHBondContact O-N 3.31Å; K41-N45 VanDerWaalsContact O-N 3.09Å; K41-N45 PolarHBondContact O-ND2 3.14Å; I42-N45 PolarHBondContact O-N 2.84Å; I42-N45 VanDerWaalsContact O-N 3.14Å; D43-N45 VanDerWaalsContact C-N 3.3Å; D43-N45 PolarHBondContact O-N 3.49Å; N45-S47 VanDerWaalsContact C-N 3.31Å; N45-K48 PolarHBondContact O-N 2.81Å; N45-V49 WeakPolarHBondContact O-CG2 3.33Å; N45-V49 PolarHBondContact O-N 2.93Å
46	V	83.6	Confident	79.5	Confident	90 Å²	90	91.6 Å²	91.6	55%	0.545	48%	0.479	S	S	.	.	H	α-helix	trans	-62.5	-42.9	174.9	171.8	0	0	0	0	109.8	I42 D43 V49 F50	I42-V46 HydrophobicContact CG2-CG2 4.1Å; I42-V46 WeakPolarHBondContact O-CB 3.25Å; I42-V46 VanDerWaalsContact O-CG2 3.32Å; I42-V46 WeakPolarHBondContact O-CG2 3.46Å; I42-V46 PolarHBondContact O-N 3.47Å; D43-V46 PolarHBondContact O-N 2.81Å; V46-V49 PolarHBondContact O-N 2.93Å; V46-F50 VanDerWaalsContact O-CB 3.3Å; V46-F50 WeakPolarHBondContact O-CB 3.42Å; V46-F50 PolarHBondContact O-N 3.33Å
47	S	79.6	Confident	77.5	Confident	48 Å²	48	95.9 Å²	95.9	34%	0.336	50%	0.497	S	S	.	.	H	α-helix	trans	-59.9	-48.1	174.8	-174.6	0	0	0	0	111.4	D43 N45 V49 F50 F51	D43-S47 WeakPolarHBondContact O-CB 3.46Å; D43-S47 PolarHBondContact O-N 2.82Å; N45-S47 VanDerWaalsContact C-N 3.31Å; S47-V49 PolarHBondContact O-N 3.26Å; S47-F50 PolarHBondContact O-N 3.42Å; S47-F51 WeakPolarHBondContact O-CB 3.18Å; S47-F51 WeakPolarHBondContact O-CD2 3.48Å; S47-F51 PolarHBondContact O-N 2.82Å; S47-F51 WeakPolarHBondContact OG-CE2 3.19Å
48	K	81.6	Confident	75.5	Confident	128 Å²	128	99.1 Å²	99.1	56%	0.557	51%	0.513	S	S	*	.	H	α-helix	trans	-58	-45.9	174.8	-76.1	168.1	-172.3	164.7	0	112.7	E44 N45 F51 S52	E44-K48 WeakPolarHBondContact O-CB 3.49Å; E44-K48 VanDerWaalsContact O-CG 3.25Å; E44-K48 WeakPolarHBondContact O-CG 3.37Å; E44-K48 PolarHBondContact O-N 3.22Å; N45-K48 PolarHBondContact O-N 2.81Å; K48-F51 PolarHBondContact O-N 3.32Å; K48-S52 WeakPolarHBondContact O-CB 3.3Å; K48-S52 PolarHBondContact O-N 3.36Å
49	V	79.6	Confident	73.2	Confident	87 Å²	87	97.1 Å²	97.1	53%	0.527	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-46.2	177.8	173.6	0	0	0	0	110	N45 V46 S47 F51 S52 V53	N45-V49 WeakPolarHBondContact O-CG2 3.33Å; N45-V49 PolarHBondContact O-N 2.93Å; V46-V49 PolarHBondContact O-N 2.93Å; S47-V49 PolarHBondContact O-N 3.26Å; V49-F51 PolarHBondContact O-N 3.44Å; V49-S52 PolarHBondContact O-N 3.14Å; V49-S52 VanDerWaalsContact O-N 3.14Å; V49-S52 PolarHBondContact O-OG 3.48Å; V49-V53 HydrophobicContact CG1-CG2 4.35Å; V49-V53 WeakPolarHBondContact O-CG2 3.24Å; V49-V53 PolarHBondContact O-N 3.48Å
50	F	73	Confident	71.2	Confident	135 Å²	135	98.5 Å²	98.5	59%	0.592	52%	0.522	S	S	*	.	H	α-helix	trans	-59.9	-47	177.8	-175.5	-93.8	0	0	0	111.8	V46 S47 S52 V53 C54	V46-F50 VanDerWaalsContact O-CB 3.3Å; V46-F50 WeakPolarHBondContact O-CB 3.42Å; V46-F50 PolarHBondContact O-N 3.33Å; S47-F50 PolarHBondContact O-N 3.42Å; F50-S52 VanDerWaalsContact C-N 3.31Å; F50-S52 PolarHBondContact O-N 3.4Å; F50-V53 PolarHBondContact O-N 3.27Å; F50-C54 HydrophobicContact CE1-CB 4.31Å; F50-C54 WeakPolarHBondContact O-CB 3.4Å; F50-C54 PolarHBondContact O-N 3.02Å
51	F	67	Low	69.3	Low	133 Å²	133	100.5 Å²	100.5	58%	0.583	53%	0.534	S	S	*	.	H	α-helix	trans	-60.3	-40.2	174.5	-85.1	-68.3	0	0	0	112	S47 K48 V49 C54 W55	S47-F51 WeakPolarHBondContact O-CB 3.18Å; S47-F51 WeakPolarHBondContact O-CD2 3.48Å; S47-F51 PolarHBondContact O-N 2.82Å; S47-F51 WeakPolarHBondContact OG-CE2 3.19Å; K48-F51 PolarHBondContact O-N 3.32Å; V49-F51 PolarHBondContact O-N 3.44Å; F51-C54 PolarHBondContact O-N 3.16Å; F51-W55 VanDerWaalsContact O-CB 3.24Å; F51-W55 WeakPolarHBondContact O-CB 3.35Å; F51-W55 PolarHBondContact O-N 3.43Å
52	S	71.3	Confident	66.9	Low	48 Å²	48	103.4 Å²	103.4	34%	0.336	55%	0.547	S	S	.	.	H	α-helix	trans	-62.9	-45.7	176.8	77.3	0	0	0	0	112	K48 V49 F50 C56	K48-S52 WeakPolarHBondContact O-CB 3.3Å; K48-S52 PolarHBondContact O-N 3.36Å; V49-S52 PolarHBondContact O-N 3.14Å; V49-S52 VanDerWaalsContact O-N 3.14Å; V49-S52 PolarHBondContact O-OG 3.48Å; F50-S52 VanDerWaalsContact C-N 3.31Å; F50-S52 PolarHBondContact O-N 3.4Å; S52-C56 WeakPolarHBondContact O-CB 3.45Å; S52-C56 PolarHBondContact O-N 2.87Å; S52-C56 PolarHBondContact O-SG 3.04Å
53	V	68.8	Low	64.8	Low	57 Å²	57	102.4 Å²	102.4	35%	0.345	55%	0.548	S	S	.	.	H	α-helix	trans	-68	-41.3	178.8	175.8	0	0	0	0	110.9	V49 F50 C56 H57	V49-V53 HydrophobicContact CG1-CG2 4.35Å; V49-V53 WeakPolarHBondContact O-CG2 3.24Å; V49-V53 PolarHBondContact O-N 3.48Å; F50-V53 PolarHBondContact O-N 3.27Å; V53-C56 WeakPolarHBondContact O-CB 3.35Å; V53-C56 PolarHBondContact O-N 2.68Å; V53-H57 PolarHBondContact O-N 2.93Å
54	C	57.4	Low	63	Low	51 Å²	51	102.7 Å²	102.7	35%	0.345	56%	0.556	S	S	.	*	H	α-helix	trans	-69.5	-37.4	-179.9	-154	0	0	0	0	111.6	F50 F51 H57 C58	F50-C54 HydrophobicContact CE1-CB 4.31Å; F50-C54 WeakPolarHBondContact O-CB 3.4Å; F50-C54 PolarHBondContact O-N 3.02Å; F51-C54 PolarHBondContact O-N 3.16Å; C54-H57 PolarHBondContact O-N 2.8Å; C54-C58 WeakPolarHBondContact O-CB 3.2Å; C54-C58 PolarHBondContact O-N 3.29Å
55	W	55.3	Low	61.4	Low	187 Å²	187	101.7 Å²	101.7	71%	0.708	56%	0.56	S	S	*	*	H	α-helix	trans	-65.1	-40.6	173.4	-159.4	-65.2	0	0	0	111.7	F51 H57 C58 S59	F51-W55 VanDerWaalsContact O-CB 3.24Å; F51-W55 WeakPolarHBondContact O-CB 3.35Å; F51-W55 PolarHBondContact O-N 3.43Å; W55-H57 VanDerWaalsContact C-N 3.27Å; W55-H57 PolarHBondContact O-N 3.4Å; W55-C58 PolarHBondContact O-N 3.28Å; W55-S59 PolarHBondContact O-N 2.7Å
56	C	52.7	Low	59.6	Low	52 Å²	52	100.6 Å²	100.6	35%	0.351	55%	0.554	S	S	.	*	H	α-helix	trans	-58.7	-36.4	172	-81.7	0	0	0	0	112.7	S52 V53 L66	S52-C56 WeakPolarHBondContact O-CB 3.45Å; S52-C56 PolarHBondContact O-N 2.87Å; S52-C56 PolarHBondContact O-SG 3.04Å; V53-C56 WeakPolarHBondContact O-CB 3.35Å; V53-C56 PolarHBondContact O-N 2.68Å; C56-L66 HydrophobicContact CB-CD2 3.46Å; C56-L66 VanDerWaalsContact CB-CD2 3.46Å; C56-L66 VanDerWaalsContact SG-CD2 3.57Å
57	H	51.5	Low	58	Low	162 Å²	162	106.1 Å²	106.1	75%	0.75	57%	0.565	S	S	*	*	H	α-helix	trans	-83.2	-29.6	178.2	-109.1	-87.4	0	0	0	114.4	V53 C54 W55	V53-H57 PolarHBondContact O-N 2.93Å; C54-H57 PolarHBondContact O-N 2.8Å; W55-H57 VanDerWaalsContact C-N 3.27Å; W55-H57 PolarHBondContact O-N 3.4Å
58	C	49.6	Very low	56.7	Low	101 Å²	101	110 Å²	110	68%	0.682	58%	0.581	S	S	*	*	H	α-helix	trans	-90.7	-7.5	-176.4	-90.8	0	0	0	0	115	C54 W55 P60	C54-C58 WeakPolarHBondContact O-CB 3.2Å; C54-C58 PolarHBondContact O-N 3.29Å; W55-C58 PolarHBondContact O-N 3.28Å; C58-P60 WeakPolarHBondContact O-CD 3.36Å
59	S	46.1	Very low	55.4	Low	61 Å²	61	108.8 Å²	108.8	43%	0.427	58%	0.576	S	S	.	*			trans	-98.8	96.9	170.1	-69.4	0	0	0	0	110.3	W55 V61	W55-S59 PolarHBondContact O-N 2.7Å; S59-V61 PolarHBondContact O-N 3.08Å
60	P	50.7	Low	54.2	Low	126 Å²	126	109.7 Å²	109.7	82%	0.818	58%	0.578	S	S	*	*			trans	-74.2	19.6	178.8	30.4	-35.1	0	0	0	113.8	C58	C58-P60 WeakPolarHBondContact O-CD 3.36Å
61	V	48.2	Very low	53.3	Low	117 Å²	117	108.2 Å²	108.2	71%	0.709	58%	0.576	S	S	*	*	S	Bend	trans	-116.5	95	-175.5	-173	0	0	0	0	110.1	S59	S59-V61 PolarHBondContact O-N 3.08Å
62	F	40.6	Very low	53.1	Low	194 Å²	194	104 Å²	104	85%	0.851	56%	0.562	S	S	*	*			trans	41.7	106.6	153.7	-89.3	-98.4	0	0	0	118.7
63	S	44.2	Very low	52.5	Low	75 Å²	75	105 Å²	105	52%	0.524	56%	0.563	S	S	.	*			trans	-162.8	129.4	142.6	-80.3	0	0	0	0	112.9	S65	S63-S65 WeakPolarHBondContact CB-OG 3.43Å; S63-S65 PolarHBondContact O-N 2.99Å
64	P	48.5	Very low	51.9	Low	118 Å²	118	108.4 Å²	108.4	77%	0.766	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.6	-11.4	-180	-15.6	25.6	0	0	0	115.6	L66 R67	P64-L66 PolarHBondContact O-N 3.48Å; P64-R67 PolarHBondContact O-N 3.05Å
65	S	53.2	Low	51.8	Low	74 Å²	74	112.9 Å²	112.9	52%	0.517	59%	0.589	S	S	.	*	T	Hydrogen-bonded Turn	trans	-62	-19.7	179	38.1	0	0	0	0	113.9	S63 L68	S63-S65 WeakPolarHBondContact CB-OG 3.43Å; S63-S65 PolarHBondContact O-N 2.99Å; S65-L68 PolarHBondContact O-N 3.28Å
66	L	49	Very low	51.9	Low	68 Å²	68	111.5 Å²	111.5	36%	0.356	58%	0.584	S	S	.	*	H	α-helix	trans	-69.4	-32.6	178.2	-74.2	165.1	0	0	0	113.7	C56 P64 L68 F69 D70	C56-L66 HydrophobicContact CB-CD2 3.46Å; C56-L66 VanDerWaalsContact CB-CD2 3.46Å; C56-L66 VanDerWaalsContact SG-CD2 3.57Å; P64-L66 PolarHBondContact O-N 3.48Å; L66-L68 PolarHBondContact O-N 2.99Å; L66-F69 WeakPolarHBondContact O-CB 3.43Å; L66-F69 PolarHBondContact O-N 3.15Å; L66-D70 PolarHBondContact O-N 3.17Å; L66-D70 VanDerWaalsContact O-N 3.1Å
67	R	49.2	Very low	52	Low	207 Å²	207	114.1 Å²	114.1	78%	0.781	60%	0.595	S	S	*	*	H	α-helix	trans	-60.9	-32.7	175.9	-82.9	-165.3	173	-179.6	-1.2	112.4	P64 F69 L71	P64-R67 PolarHBondContact O-N 3.05Å; R67-F69 VanDerWaalsContact C-N 3.34Å; R67-L71 WeakPolarHBondContact O-CB 3.48Å; R67-L71 WeakPolarHBondContact O-CD1 3.5Å; R67-L71 PolarHBondContact O-N 2.87Å
68	L	53.7	Low	52.3	Low	129 Å²	129	111.3 Å²	111.3	68%	0.675	59%	0.589	S	S	*	*	H	α-helix	trans	-70.3	-32	175.1	-82	156.7	0	0	0	112	S65 L66 S72	S65-L68 PolarHBondContact O-N 3.28Å; L66-L68 PolarHBondContact O-N 2.99Å; L68-S72 WeakPolarHBondContact O-CB 3.23Å; L68-S72 PolarHBondContact O-N 2.94Å
69	F	54.8	Low	52.6	Low	102 Å²	102	112.2 Å²	112.2	45%	0.447	59%	0.586	S	S	.	*	H	α-helix	trans	-71.7	-45.2	179.1	-121.3	-88.6	0	0	0	111.6	L66 R67 L71 S72 I73	L66-F69 WeakPolarHBondContact O-CB 3.43Å; L66-F69 PolarHBondContact O-N 3.15Å; R67-F69 VanDerWaalsContact C-N 3.34Å; F69-L71 PolarHBondContact O-N 3.07Å; F69-S72 WeakPolarHBondContact O-CB 3.43Å; F69-S72 PolarHBondContact O-N 3.4Å; F69-S72 VanDerWaalsContact O-N 3.08Å; F69-S72 PolarHBondContact O-OG 3.1Å; F69-I73 PolarHBondContact O-N 2.86Å
70	D	53.8	Low	53.1	Low	106 Å²	106	117.5 Å²	117.5	57%	0.567	60%	0.602	S	S	*	*	H	α-helix	trans	-59.1	-46.6	173.7	-75.6	-29.7	0	0	0	111.3	L66 S72 I73 E74	L66-D70 PolarHBondContact O-N 3.17Å; L66-D70 VanDerWaalsContact O-N 3.1Å; D70-S72 VanDerWaalsContact C-N 3.25Å; D70-S72 PolarHBondContact O-N 3.45Å; D70-I73 PolarHBondContact O-N 2.87Å; D70-I73 VanDerWaalsContact O-N 3.15Å; D70-E74 WeakPolarHBondContact O-CB 3.48Å; D70-E74 PolarHBondContact O-N 3.46Å
71	L	54.3	Low	53.1	Low	105 Å²	105	118 Å²	118	55%	0.55	62%	0.617	S	S	.	*	H	α-helix	trans	-56.8	-38.3	173.7	-96.9	151.1	0	0	0	112.2	R67 F69 F75	R67-L71 WeakPolarHBondContact O-CB 3.48Å; R67-L71 WeakPolarHBondContact O-CD1 3.5Å; R67-L71 PolarHBondContact O-N 2.87Å; F69-L71 PolarHBondContact O-N 3.07Å; L71-F75 VanDerWaalsContact O-CB 3.23Å; L71-F75 WeakPolarHBondContact O-CB 3.32Å; L71-F75 PolarHBondContact O-N 3.41Å
72	S	61.5	Low	53.4	Low	43 Å²	43	118.1 Å²	118.1	30%	0.301	61%	0.612	S	S	.	*	H	α-helix	trans	-70.9	-32.7	179.4	80.9	0	0	0	0	113.3	L68 F69 D70 R76	L68-S72 WeakPolarHBondContact O-CB 3.23Å; L68-S72 PolarHBondContact O-N 2.94Å; F69-S72 WeakPolarHBondContact O-CB 3.43Å; F69-S72 PolarHBondContact O-N 3.4Å; F69-S72 VanDerWaalsContact O-N 3.08Å; F69-S72 PolarHBondContact O-OG 3.1Å; D70-S72 VanDerWaalsContact C-N 3.25Å; D70-S72 PolarHBondContact O-N 3.45Å; S72-R76 WeakPolarHBondContact O-CB 3.47Å; S72-R76 PolarHBondContact O-N 2.7Å; S72-R76 VanDerWaalsContact O-N 3.07Å
73	I	60.3	Low	54	Low	70 Å²	70	114.1 Å²	114.1	36%	0.359	60%	0.6	S	S	.	*	H	α-helix	trans	-73.6	-44.2	175.6	-66.5	170.4	0	0	0	109.4	F69 D70 F75 R76 N77	F69-I73 PolarHBondContact O-N 2.86Å; D70-I73 PolarHBondContact O-N 2.87Å; D70-I73 VanDerWaalsContact O-N 3.15Å; I73-F75 VanDerWaalsContact C-N 3.33Å; I73-F75 PolarHBondContact O-N 3.22Å; I73-R76 PolarHBondContact O-N 3.41Å; I73-N77 WeakPolarHBondContact O-CB 3.19Å; I73-N77 PolarHBondContact O-N 3Å
74	E	56.1	Low	54.6	Low	128 Å²	128	116.2 Å²	116.2	60%	0.598	60%	0.604	S	S	*	*	H	α-helix	trans	-61.4	-42.5	176.1	-160.3	171.3	-157.8	0	0	111.1	D70 R76 N77 T78	D70-E74 WeakPolarHBondContact O-CB 3.48Å; D70-E74 PolarHBondContact O-N 3.46Å; E74-R76 VanDerWaalsContact C-N 3.35Å; E74-R76 PolarHBondContact O-N 3.06Å; E74-N77 PolarHBondContact O-N 3.19Å; E74-T78 WeakPolarHBondContact O-CB 3.37Å; E74-T78 PolarHBondContact O-N 3.1Å; E74-T78 PolarHBondContact O-OG1 3.34Å
75	F	55.1	Low	54.9	Low	145 Å²	145	116.1 Å²	116.1	64%	0.636	59%	0.594	S	S	*	*	H	α-helix	trans	-62.9	-40.5	174.5	-152	-91.4	0	0	0	111.9	L71 I73 T78 L79	L71-F75 VanDerWaalsContact O-CB 3.23Å; L71-F75 WeakPolarHBondContact O-CB 3.32Å; L71-F75 PolarHBondContact O-N 3.41Å; I73-F75 VanDerWaalsContact C-N 3.33Å; I73-F75 PolarHBondContact O-N 3.22Å; F75-T78 PolarHBondContact O-N 3.21Å; F75-L79 HydrophobicContact CD1-CD1 4.02Å; F75-L79 HydrophobicContact CE1-CD1 3.65Å; F75-L79 WeakPolarHBondContact O-CB 3.44Å; F75-L79 PolarHBondContact O-N 2.91Å
76	R	57.8	Low	55.1	Low	158 Å²	158	118.8 Å²	118.8	60%	0.596	60%	0.599	S	S	*	*	H	α-helix	trans	-68.3	-42.5	178.2	-143.5	-177.7	-60.9	-132	4.2	111.7	S72 I73 E74 T78 L79 F80	S72-R76 WeakPolarHBondContact O-CB 3.47Å; S72-R76 PolarHBondContact O-N 2.7Å; S72-R76 VanDerWaalsContact O-N 3.07Å; I73-R76 PolarHBondContact O-N 3.41Å; E74-R76 VanDerWaalsContact C-N 3.35Å; E74-R76 PolarHBondContact O-N 3.06Å; R76-T78 VanDerWaalsContact C-N 3.29Å; R76-T78 PolarHBondContact O-N 3.25Å; R76-L79 PolarHBondContact O-N 3.22Å; R76-F80 HydrophobicContact CG-CD2 4.07Å; R76-F80 HydrophobicContact CG-CE2 4.11Å; R76-F80 WeakPolarHBondContact O-CD2 3.44Å; R76-F80 PolarHBondContact O-N 3.35Å; R76-F80 VanDerWaalsContact O-N 3.16Å
77	N	53.6	Low	55.5	Low	108 Å²	108	122.1 Å²	122.1	58%	0.578	62%	0.615	S	S	*	*	H	α-helix	trans	-67.2	-31.5	177.3	-70.5	-14.4	0	0	0	112.1	I73 E74 A81	I73-N77 WeakPolarHBondContact O-CB 3.19Å; I73-N77 PolarHBondContact O-N 3Å; E74-N77 PolarHBondContact O-N 3.19Å; N77-A81 WeakPolarHBondContact O-CB 3.11Å; N77-A81 PolarHBondContact O-N 2.95Å; N77-A81 VanDerWaalsContact O-N 3.1Å
78	T	57.5	Low	55.9	Low	103 Å²	103	116.1 Å²	116.1	63%	0.632	60%	0.603	S	S	*	*	H	α-helix	trans	-75.8	-29.8	175.4	-47	0	0	0	0	112.1	E74 F75 R76	E74-T78 WeakPolarHBondContact O-CB 3.37Å; E74-T78 PolarHBondContact O-N 3.1Å; E74-T78 PolarHBondContact O-OG1 3.34Å; F75-T78 PolarHBondContact O-N 3.21Å; R76-T78 VanDerWaalsContact C-N 3.29Å; R76-T78 PolarHBondContact O-N 3.25Å
79	L	55.7	Low	56.1	Low	119 Å²	119	115.1 Å²	115.1	62%	0.623	60%	0.598	S	S	*	*	H	α-helix	trans	-78.8	-24.1	178.7	-136	111.3	0	0	0	113.5	F75 R76	F75-L79 HydrophobicContact CD1-CD1 4.02Å; F75-L79 HydrophobicContact CE1-CD1 3.65Å; F75-L79 WeakPolarHBondContact O-CB 3.44Å; F75-L79 PolarHBondContact O-N 2.91Å; R76-L79 PolarHBondContact O-N 3.22Å
80	F	57.5	Low	56.2	Low	172 Å²	172	116.2 Å²	116.2	75%	0.754	61%	0.61	S	S	*	*	H	α-helix	trans	-109.3	-1.5	-178.1	-76.3	-79.8	0	0	0	114.3	R76	R76-F80 HydrophobicContact CG-CD2 4.07Å; R76-F80 HydrophobicContact CG-CE2 4.11Å; R76-F80 WeakPolarHBondContact O-CD2 3.44Å; R76-F80 PolarHBondContact O-N 3.35Å; R76-F80 VanDerWaalsContact O-N 3.16Å
81	A	51.1	Low	56.4	Low	137 Å²	137	117.1 Å²	117.1	100%	1.132	61%	0.614	S	S	*	*			trans	-87.2	0	165.1	0	0	0	0	0	110.2	N77	N77-A81 WeakPolarHBondContact O-CB 3.11Å; N77-A81 PolarHBondContact O-N 2.95Å; N77-A81 VanDerWaalsContact O-N 3.1Å

Retrieved 81 of 81 residues in 78.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).