SYUA_ERYPA Loading...

Alpha-synuclein

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (By similarity). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (By similarity). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (By similarity). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (By similarity). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (By similarity). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (By similarity).

AlphaFold DB (A0A0D9QW44), UniProt , Accession P61139, Species ERYPA (Erythrocebus patas, Red guenon), Gene SNCA, Length 140 aa.

						>SYUA_ERYPA|P61139|SNCA
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	86.6	Confident	89.1	Confident	189 Å²	189	116.9 Å²	116.9	93%	0.931	62%	0.622	S	S	*	*				0	-0.1	0	-80.4	178.5	-180	0	113	V3 F4 M5	M1-V3 PolarHBondContact O-N 3.15Å; M1-F4 WeakPolarHBondContact O-CB 3.4Å; M1-F4 PolarHBondContact O-N 3.36Å; M1-F4 VanDerWaalsContact O-N 3.11Å; M1-M5 PolarHBondContact O-N 3.42Å; M1-M5 VanDerWaalsContact O-N 3.11Å
2	D	88.9	Confident	89.1	Confident	136 Å²	136	120 Å²	120	73%	0.727	63%	0.626	S	S	*	*	H	α-helix	trans	-65.2	-35.8	-168.8	-53.3	-28.9	0	0	114.4	F4 M5 K6	D2-F4 VanDerWaalsContact C-N 3.31Å; D2-F4 PolarHBondContact O-N 3.01Å; D2-M5 PolarHBondContact O-N 2.84Å; D2-K6 WeakPolarHBondContact O-CB 3.47Å; D2-K6 PolarHBondContact O-N 3.27Å
3	V	90.1	Very high	89.1	Confident	128 Å²	128	121 Å²	121	78%	0.776	63%	0.626	S	S	*	*	H	α-helix	trans	-65.3	-36.9	176.7	-175.6	0	0	0	111.4	M1 G7	M1-V3 PolarHBondContact O-N 3.15Å; V3-G7 PolarHBondContact O-N 3.11Å
4	F	87	Confident	89.2	Confident	142 Å²	142	115.5 Å²	115.5	62%	0.623	61%	0.614	S	S	*	*	H	α-helix	trans	-67.3	-47.1	175.9	174.9	-95.9	0	0	111.2	M1 D2 K6 G7 L8	M1-F4 WeakPolarHBondContact O-CB 3.4Å; M1-F4 PolarHBondContact O-N 3.36Å; M1-F4 VanDerWaalsContact O-N 3.11Å; D2-F4 VanDerWaalsContact C-N 3.31Å; D2-F4 PolarHBondContact O-N 3.01Å; F4-K6 VanDerWaalsContact C-N 3.31Å; F4-K6 PolarHBondContact O-N 3.37Å; F4-G7 PolarHBondContact O-N 3.08Å; F4-G7 VanDerWaalsContact O-N 3.13Å; F4-L8 PolarHBondContact O-N 3.43Å
5	M	91.1	Very high	89.4	Confident	105 Å²	105	114.7 Å²	114.7	52%	0.517	61%	0.614	S	S	.	*	H	α-helix	trans	-59.5	-43.4	176.2	-70.8	-64.7	-175.8	0	111.5	M1 D2 G7 L8 S9	M1-M5 PolarHBondContact O-N 3.42Å; M1-M5 VanDerWaalsContact O-N 3.11Å; D2-M5 PolarHBondContact O-N 2.84Å; M5-G7 VanDerWaalsContact C-N 3.35Å; M5-G7 PolarHBondContact O-N 2.98Å; M5-L8 PolarHBondContact O-N 3.42Å; M5-S9 PolarHBondContact O-N 3.09Å; M5-S9 PolarHBondContact O-OG 3.33Å; M5-S9 VanDerWaalsContact O-OG 3.1Å
6	K	91.4	Very high	89.5	Confident	164 Å²	164	112.4 Å²	112.4	71%	0.713	61%	0.606	S	S	*	*	H	α-helix	trans	-62.7	-40.8	174.9	-171.8	174.1	-178	174	112.2	D2 F4 K10	D2-K6 WeakPolarHBondContact O-CB 3.47Å; D2-K6 PolarHBondContact O-N 3.27Å; F4-K6 VanDerWaalsContact C-N 3.31Å; F4-K6 PolarHBondContact O-N 3.37Å; K6-K10 WeakPolarHBondContact O-CB 3.36Å; K6-K10 PolarHBondContact O-N 2.71Å
7	G	89.8	Confident	89.4	Confident	40 Å²	40	109.1 Å²	109.1	41%	0.412	60%	0.598	S	S	.	*	H	α-helix	trans	-62.8	-45	175.8	0	0	0	0	112.6	V3 F4 M5 K10 A11	V3-G7 PolarHBondContact O-N 3.11Å; F4-G7 PolarHBondContact O-N 3.08Å; F4-G7 VanDerWaalsContact O-N 3.13Å; M5-G7 VanDerWaalsContact C-N 3.35Å; M5-G7 PolarHBondContact O-N 2.98Å; G7-K10 PolarHBondContact O-N 3.37Å; G7-A11 PolarHBondContact O-N 2.98Å
8	L	88.8	Confident	89.3	Confident	101 Å²	101	106.2 Å²	106.2	53%	0.529	59%	0.59	S	S	.	*	H	α-helix	trans	-63.1	-45.2	176.9	-178.1	63.7	0	0	111.7	F4 M5 K10 A11 K12	F4-L8 PolarHBondContact O-N 3.43Å; M5-L8 PolarHBondContact O-N 3.42Å; L8-K10 VanDerWaalsContact C-N 3.34Å; L8-K10 PolarHBondContact O-N 2.91Å; L8-A11 PolarHBondContact O-N 3.41Å; L8-K12 PolarHBondContact O-N 2.95Å
9	S	88.1	Confident	89.3	Confident	64 Å²	64	103.6 Å²	103.6	45%	0.448	58%	0.584	S	S	.	*	H	α-helix	trans	-60.5	-44	176.4	-64.5	0	0	0	111.7	M5 A11 K12 E13	M5-S9 PolarHBondContact O-N 3.09Å; M5-S9 PolarHBondContact O-OG 3.33Å; M5-S9 VanDerWaalsContact O-OG 3.1Å; S9-A11 VanDerWaalsContact C-N 3.34Å; S9-A11 PolarHBondContact O-N 3.24Å; S9-K12 WeakPolarHBondContact O-CB 3.33Å; S9-K12 PolarHBondContact O-N 3.45Å; S9-E13 WeakPolarHBondContact O-CG 3.4Å; S9-E13 PolarHBondContact O-N 3.44Å
10	K	89.4	Confident	89.1	Confident	159 Å²	159	104.8 Å²	104.8	69%	0.691	58%	0.584	S	S	*	*	H	α-helix	trans	-63.7	-38.9	176.7	-169.7	175.2	-177.1	179.3	112.5	K6 G7 L8 G14	K6-K10 WeakPolarHBondContact O-CB 3.36Å; K6-K10 PolarHBondContact O-N 2.71Å; G7-K10 PolarHBondContact O-N 3.37Å; L8-K10 VanDerWaalsContact C-N 3.34Å; L8-K10 PolarHBondContact O-N 2.91Å; K10-G14 PolarHBondContact O-N 3.25Å
11	A	89.1	Confident	89.2	Confident	58 Å²	58	107.8 Å²	107.8	48%	0.479	59%	0.591	S	S	.	*	H	α-helix	trans	-64.8	-43.5	175	0	0	0	0	111.5	G7 L8 S9 E13 G14 V15	G7-A11 PolarHBondContact O-N 2.98Å; L8-A11 PolarHBondContact O-N 3.41Å; S9-A11 VanDerWaalsContact C-N 3.34Å; S9-A11 PolarHBondContact O-N 3.24Å; A11-E13 PolarHBondContact O-N 2.85Å; A11-G14 PolarHBondContact O-N 3.21Å; A11-V15 WeakPolarHBondContact O-CG2 3.2Å; A11-V15 PolarHBondContact O-N 2.85Å
12	K	89.4	Confident	89.2	Confident	154 Å²	154	103 Å²	103	67%	0.67	57%	0.573	S	S	*	*	H	α-helix	trans	-58.9	-47.4	175.5	-178.7	-175.6	174.9	-174	111.5	L8 S9 G14 V15 V16	L8-K12 PolarHBondContact O-N 2.95Å; S9-K12 WeakPolarHBondContact O-CB 3.33Å; S9-K12 PolarHBondContact O-N 3.45Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 3.33Å; K12-V15 PolarHBondContact O-N 3.35Å; K12-V16 WeakPolarHBondContact O-CG2 3.42Å; K12-V16 PolarHBondContact O-N 2.98Å
13	E	88.8	Confident	89.2	Confident	133 Å²	133	104.5 Å²	104.5	62%	0.621	57%	0.573	S	S	*	*	H	α-helix	trans	-58.4	-43.6	176.2	-73.7	170.6	-175.4	0	111.9	S9 A11 V15 V16 A17	S9-E13 WeakPolarHBondContact O-CG 3.4Å; S9-E13 PolarHBondContact O-N 3.44Å; A11-E13 PolarHBondContact O-N 2.85Å; E13-V15 PolarHBondContact O-N 3.02Å; E13-V16 PolarHBondContact O-N 3.45Å; E13-A17 WeakPolarHBondContact O-CB 3.42Å; E13-A17 PolarHBondContact O-N 2.95Å
14	G	90.1	Very high	89	Confident	44 Å²	44	103.9 Å²	103.9	45%	0.454	56%	0.562	S	S	.	*	H	α-helix	trans	-61.2	-41.9	176.7	0	0	0	0	113.3	K10 A11 K12 A18	K10-G14 PolarHBondContact O-N 3.25Å; A11-G14 PolarHBondContact O-N 3.21Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 3.33Å; G14-A18 WeakPolarHBondContact O-CB 3.36Å; G14-A18 PolarHBondContact O-N 3.21Å
15	V	93	Very high	88.9	Confident	103 Å²	103	98.9 Å²	98.9	62%	0.624	55%	0.551	S	S	*	*	H	α-helix	trans	-65.3	-44.7	176.5	172.9	0	0	0	111.2	A11 K12 E13 A18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.2Å; A11-V15 PolarHBondContact O-N 2.85Å; K12-V15 PolarHBondContact O-N 3.35Å; E13-V15 PolarHBondContact O-N 3.02Å; V15-A18 PolarHBondContact O-N 2.97Å; V15-A19 WeakPolarHBondContact O-CB 3.4Å; V15-A19 PolarHBondContact O-N 3.41Å
16	V	90.8	Very high	88.6	Confident	78 Å²	78	98.5 Å²	98.5	47%	0.473	55%	0.554	S	S	.	*	H	α-helix	trans	-62.2	-46.9	178.1	173.5	0	0	0	110.5	K12 E13 A18 A19 E20	K12-V16 WeakPolarHBondContact O-CG2 3.42Å; K12-V16 PolarHBondContact O-N 2.98Å; E13-V16 PolarHBondContact O-N 3.45Å; V16-A18 VanDerWaalsContact C-N 3.34Å; V16-A18 PolarHBondContact O-N 3.3Å; V16-A19 PolarHBondContact O-N 2.98Å; V16-E20 WeakPolarHBondContact O-CB 3.3Å; V16-E20 PolarHBondContact O-N 2.89Å
17	A	87.3	Confident	88.1	Confident	57 Å²	57	93.7 Å²	93.7	47%	0.471	55%	0.545	S	S	.	.	H	α-helix	trans	-62.1	-40.2	178.6	0	0	0	0	112.5	E13 E20 K21	E13-A17 WeakPolarHBondContact O-CB 3.42Å; E13-A17 PolarHBondContact O-N 2.95Å; A17-E20 PolarHBondContact O-N 2.88Å; A17-K21 VanDerWaalsContact O-CB 3.31Å; A17-K21 WeakPolarHBondContact O-CB 3.31Å; A17-K21 PolarHBondContact O-N 3.49Å
18	A	88.6	Confident	87.7	Confident	56 Å²	56	96.2 Å²	96.2	46%	0.463	55%	0.546	S	S	.	.	H	α-helix	trans	-66.2	-42.9	176.1	0	0	0	0	112.1	G14 V15 V16 T22	G14-A18 WeakPolarHBondContact O-CB 3.36Å; G14-A18 PolarHBondContact O-N 3.21Å; V15-A18 PolarHBondContact O-N 2.97Å; V16-A18 VanDerWaalsContact C-N 3.34Å; V16-A18 PolarHBondContact O-N 3.3Å; A18-T22 WeakPolarHBondContact O-CB 3.5Å; A18-T22 PolarHBondContact O-N 3.4Å; A18-T22 PolarHBondContact O-OG1 3.3Å
19	A	88.8	Confident	87.3	Confident	57 Å²	57	94 Å²	94	47%	0.471	54%	0.542	S	S	.	.	H	α-helix	trans	-63.7	-41.9	176.3	0	0	0	0	111.7	V15 V16 T22 K23	V15-A19 WeakPolarHBondContact O-CB 3.4Å; V15-A19 PolarHBondContact O-N 3.41Å; V16-A19 PolarHBondContact O-N 2.98Å; A19-T22 PolarHBondContact O-N 3.35Å; A19-K23 WeakPolarHBondContact O-CB 3.31Å; A19-K23 PolarHBondContact O-N 2.99Å
20	E	86.1	Confident	86.8	Confident	127 Å²	127	93.8 Å²	93.8	59%	0.593	54%	0.544	S	S	*	.	H	α-helix	trans	-67.4	-45	178.9	-169.3	162.8	-159.7	0	111.9	V16 A17 T22 K23 Q24	V16-E20 WeakPolarHBondContact O-CB 3.3Å; V16-E20 PolarHBondContact O-N 2.89Å; A17-E20 PolarHBondContact O-N 2.88Å; E20-T22 VanDerWaalsContact C-N 3.27Å; E20-T22 PolarHBondContact O-N 3.05Å; E20-K23 PolarHBondContact O-N 2.89Å; E20-Q24 WeakPolarHBondContact O-CB 3.43Å; E20-Q24 PolarHBondContact O-N 3.47Å
21	K	89.5	Confident	86.1	Confident	168 Å²	168	87.7 Å²	87.7	73%	0.73	53%	0.527	S	S	*	.	H	α-helix	trans	-59.2	-38.8	173.8	-174.6	168	-176.6	164.7	112.1	A17 G25	A17-K21 VanDerWaalsContact O-CB 3.31Å; A17-K21 WeakPolarHBondContact O-CB 3.31Å; A17-K21 PolarHBondContact O-N 3.49Å; K21-G25 PolarHBondContact O-N 3.3Å
22	T	87.9	Confident	85.3	Confident	90 Å²	90	92.9 Å²	92.9	55%	0.552	54%	0.538	S	S	*	.	H	α-helix	trans	-67.6	-46.7	176.3	-56.6	0	0	0	111.2	A18 A19 E20 Q24 G25 V26	A18-T22 WeakPolarHBondContact O-CB 3.5Å; A18-T22 PolarHBondContact O-N 3.4Å; A18-T22 PolarHBondContact O-OG1 3.3Å; A19-T22 PolarHBondContact O-N 3.35Å; E20-T22 VanDerWaalsContact C-N 3.27Å; E20-T22 PolarHBondContact O-N 3.05Å; T22-Q24 VanDerWaalsContact C-N 3.31Å; T22-Q24 PolarHBondContact O-N 3.41Å; T22-G25 PolarHBondContact O-N 2.9Å; T22-V26 HydrophobicContact CG2-CG2 4.45Å; T22-V26 VanDerWaalsContact O-CG2 3.31Å; T22-V26 WeakPolarHBondContact O-CG2 3.36Å; T22-V26 PolarHBondContact O-N 2.86Å
23	K	87.7	Confident	84.3	Confident	167 Å²	167	89.6 Å²	89.6	73%	0.726	53%	0.531	S	S	*	.	H	α-helix	trans	-59.1	-43.7	177.4	-174.4	-179.9	178.1	-175.4	111.5	A19 E20 A27	A19-K23 WeakPolarHBondContact O-CB 3.31Å; A19-K23 PolarHBondContact O-N 2.99Å; E20-K23 PolarHBondContact O-N 2.89Å; K23-A27 VanDerWaalsContact O-CB 3.3Å; K23-A27 WeakPolarHBondContact O-CB 3.25Å; K23-A27 PolarHBondContact O-N 3.38Å
24	Q	86.3	Confident	82.9	Confident	114 Å²	114	90 Å²	90	53%	0.533	53%	0.531	S	S	.	.	H	α-helix	trans	-65.2	-46.5	177.6	-171.1	178	-7.5	0	111.6	E20 T22 V26 A27 E28	E20-Q24 WeakPolarHBondContact O-CB 3.43Å; E20-Q24 PolarHBondContact O-N 3.47Å; T22-Q24 VanDerWaalsContact C-N 3.31Å; T22-Q24 PolarHBondContact O-N 3.41Å; Q24-V26 VanDerWaalsContact C-N 3.35Å; Q24-V26 PolarHBondContact O-N 3.5Å; Q24-A27 PolarHBondContact O-N 2.79Å; Q24-E28 HydrophobicContact CG-CG 4.4Å; Q24-E28 WeakPolarHBondContact CG-OE1 3.44Å; Q24-E28 PolarHBondContact NE2-OE1 3.26Å; Q24-E28 WeakPolarHBondContact O-CB 3.36Å; Q24-E28 WeakPolarHBondContact O-CG 3.35Å; Q24-E28 PolarHBondContact O-N 2.94Å
25	G	84.7	Confident	81.3	Confident	38 Å²	38	97 Å²	97	39%	0.392	55%	0.552	S	S	.	*	H	α-helix	trans	-61.1	-41.1	178.2	0	0	0	0	113.2	K21 T22 A29	K21-G25 PolarHBondContact O-N 3.3Å; T22-G25 PolarHBondContact O-N 2.9Å; G25-A29 WeakPolarHBondContact O-CB 3.43Å; G25-A29 PolarHBondContact O-N 3.33Å
26	V	85.2	Confident	79.5	Confident	97 Å²	97	95 Å²	95	59%	0.588	55%	0.552	S	S	*	*	H	α-helix	trans	-66.5	-43.4	175.7	174	0	0	0	111.1	T22 Q24 A29 A30	T22-V26 HydrophobicContact CG2-CG2 4.45Å; T22-V26 VanDerWaalsContact O-CG2 3.31Å; T22-V26 WeakPolarHBondContact O-CG2 3.36Å; T22-V26 PolarHBondContact O-N 2.86Å; Q24-V26 VanDerWaalsContact C-N 3.35Å; Q24-V26 PolarHBondContact O-N 3.5Å; V26-A29 PolarHBondContact O-N 3.44Å; V26-A30 WeakPolarHBondContact O-CB 3.25Å; V26-A30 PolarHBondContact O-N 3.18Å
27	A	82.1	Confident	77.8	Confident	63 Å²	63	95.5 Å²	95.5	52%	0.521	56%	0.555	S	S	.	*	H	α-helix	trans	-65.6	-40.8	178.5	0	0	0	0	112.4	K23 Q24 G31	K23-A27 VanDerWaalsContact O-CB 3.3Å; K23-A27 WeakPolarHBondContact O-CB 3.25Å; K23-A27 PolarHBondContact O-N 3.38Å; Q24-A27 PolarHBondContact O-N 2.79Å; A27-G31 PolarHBondContact O-N 3.25Å
28	E	81.4	Confident	76.4	Confident	93 Å²	93	99.7 Å²	99.7	44%	0.435	57%	0.568	S	S	.	*	H	α-helix	trans	-66.6	-41.9	176	-75.8	-179.5	-163.5	0	111.9	Q24 G31 K32	Q24-E28 HydrophobicContact CG-CG 4.4Å; Q24-E28 WeakPolarHBondContact CG-OE1 3.44Å; Q24-E28 PolarHBondContact NE2-OE1 3.26Å; Q24-E28 WeakPolarHBondContact O-CB 3.36Å; Q24-E28 WeakPolarHBondContact O-CG 3.35Å; Q24-E28 PolarHBondContact O-N 2.94Å; E28-G31 PolarHBondContact O-N 2.74Å; E28-K32 WeakPolarHBondContact O-CB 3.42Å; E28-K32 WeakPolarHBondContact O-CG 3.13Å; E28-K32 PolarHBondContact O-N 3.06Å
29	A	79.3	Confident	74.8	Confident	54 Å²	54	107.6 Å²	107.6	45%	0.446	59%	0.588	S	S	.	*	H	α-helix	trans	-62.9	-45.6	175	0	0	0	0	111.7	G25 V26 G31 K32 T33	G25-A29 WeakPolarHBondContact O-CB 3.43Å; G25-A29 PolarHBondContact O-N 3.33Å; V26-A29 PolarHBondContact O-N 3.44Å; A29-G31 VanDerWaalsContact C-N 3.3Å; A29-G31 PolarHBondContact O-N 3.46Å; A29-K32 PolarHBondContact O-N 3.23Å; A29-T33 PolarHBondContact O-N 3.39Å; A29-T33 VanDerWaalsContact O-N 3.09Å; A29-T33 PolarHBondContact O-OG1 3.04Å
30	A	77.4	Confident	73.4	Confident	60 Å²	60	109 Å²	109	50%	0.496	59%	0.591	S	S	.	*	H	α-helix	trans	-61.9	-39	174.3	0	0	0	0	111.8	V26 T33 K34	V26-A30 WeakPolarHBondContact O-CB 3.25Å; V26-A30 PolarHBondContact O-N 3.18Å; A30-T33 PolarHBondContact O-N 3.43Å; A30-K34 PolarHBondContact O-N 3.02Å
31	G	74.1	Confident	72.1	Confident	31 Å²	31	104.7 Å²	104.7	32%	0.32	58%	0.58	S	S	.	*	H	α-helix	trans	-64.6	-46.1	176.3	0	0	0	0	113.5	A27 E28 A29 T33 K34	A27-G31 PolarHBondContact O-N 3.25Å; E28-G31 PolarHBondContact O-N 2.74Å; A29-G31 VanDerWaalsContact C-N 3.3Å; A29-G31 PolarHBondContact O-N 3.46Å; G31-T33 PolarHBondContact O-N 3.5Å; G31-K34 WeakPolarHBondContact O-CB 3.3Å; G31-K34 WeakPolarHBondContact O-CG 3.42Å; G31-K34 PolarHBondContact O-N 3.26Å; G31-K34 VanDerWaalsContact O-N 3.11Å
32	K	72.2	Confident	70.7	Confident	167 Å²	167	101.6 Å²	101.6	73%	0.726	58%	0.579	S	S	*	*	H	α-helix	trans	-65.8	-24.3	176.1	-73.6	178.4	179.9	175.3	112.7	E28 A29 K34	E28-K32 WeakPolarHBondContact O-CB 3.42Å; E28-K32 WeakPolarHBondContact O-CG 3.13Å; E28-K32 PolarHBondContact O-N 3.06Å; A29-K32 PolarHBondContact O-N 3.23Å; K32-K34 VanDerWaalsContact C-N 3.34Å
33	T	68.4	Low	69.3	Low	85 Å²	85	106.7 Å²	106.7	52%	0.521	59%	0.594	S	S	.	*	T	Hydrogen-bonded Turn	trans	-85.3	-4.2	175.9	-42.9	0	0	0	112.9	A29 A30 G31 E35 G36	A29-T33 PolarHBondContact O-N 3.39Å; A29-T33 VanDerWaalsContact O-N 3.09Å; A29-T33 PolarHBondContact O-OG1 3.04Å; A30-T33 PolarHBondContact O-N 3.43Å; G31-T33 PolarHBondContact O-N 3.5Å; T33-E35 PolarHBondContact O-N 3.44Å; T33-E35 VanDerWaalsContact O-N 3.15Å; T33-G36 PolarHBondContact O-N 2.97Å
34	K	61	Low	68.1	Low	141 Å²	141	102.2 Å²	102.2	61%	0.613	58%	0.581	S	S	*	*	H	α-helix	trans	-60	-23.6	177.4	-75.8	178.7	176.5	176.6	113.5	A30 G31 K32 G36	A30-K34 PolarHBondContact O-N 3.02Å; G31-K34 WeakPolarHBondContact O-CB 3.3Å; G31-K34 WeakPolarHBondContact O-CG 3.42Å; G31-K34 PolarHBondContact O-N 3.26Å; G31-K34 VanDerWaalsContact O-N 3.11Å; K32-K34 VanDerWaalsContact C-N 3.34Å; K34-G36 VanDerWaalsContact C-N 3.25Å; K34-G36 PolarHBondContact O-N 3.26Å
35	E	56.1	Low	67.1	Low	192 Å²	192	104.2 Å²	104.2	90%	0.897	59%	0.588	S	S	*	*	H	α-helix	trans	-69.3	-23.5	176.2	-133.8	170.4	-171.4	0	112.5	T33	T33-E35 PolarHBondContact O-N 3.44Å; T33-E35 VanDerWaalsContact O-N 3.15Å
36	G	55.9	Low	66.1	Low	61 Å²	61	110.4 Å²	110.4	63%	0.629	61%	0.606	S	S	*	*	H	α-helix	trans	-90	-17.9	-179.7	0	0	0	0	116.3	T33 K34	T33-G36 PolarHBondContact O-N 2.97Å; K34-G36 VanDerWaalsContact C-N 3.25Å; K34-G36 PolarHBondContact O-N 3.26Å
37	V	53.9	Low	65.2	Low	87 Å²	87	108.3 Å²	108.3	53%	0.527	60%	0.604	S	S	.	*	H	α-helix	trans	-119.4	-13.9	-164.8	-173	0	0	0	114.5	Y39 V40 G41	V37-Y39 PolarHBondContact O-N 3.01Å; V37-V40 PolarHBondContact O-N 3.47Å; V37-V40 VanDerWaalsContact O-N 3.08Å; V37-G41 PolarHBondContact O-N 3.46Å
38	L	57.5	Low	64.8	Low	145 Å²	145	109 Å²	109	76%	0.759	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.2	-21.8	177.6	-109.6	150.8	0	0	113.4
39	Y	55.5	Low	64.3	Low	222 Å²	222	109.4 Å²	109.4	87%	0.871	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.7	-22.5	179.1	-169.3	-107.9	0	0	115	V37	V37-Y39 PolarHBondContact O-N 3.01Å
40	V	58.4	Low	64	Low	88 Å²	88	113.9 Å²	113.9	53%	0.533	62%	0.622	S	S	.	*	T	Hydrogen-bonded Turn	trans	-108.3	-23.9	-174.8	-174.2	0	0	0	112.9	V37 S42 K43 T44	V37-V40 PolarHBondContact O-N 3.47Å; V37-V40 VanDerWaalsContact O-N 3.08Å; V40-S42 VanDerWaalsContact C-N 3.35Å; V40-S42 PolarHBondContact O-N 2.94Å; V40-K43 PolarHBondContact O-N 3.24Å; V40-T44 PolarHBondContact O-OG1 3.25Å
41	G	59.8	Low	64	Low	36 Å²	36	112.6 Å²	112.6	37%	0.371	62%	0.615	S	S	.	*	H	α-helix	trans	-65.9	-23.5	-171.2	0	0	0	0	116.6	V37 K45	V37-G41 PolarHBondContact O-N 3.46Å; G41-K45 WeakPolarHBondContact O-CB 3.4Å; G41-K45 PolarHBondContact O-N 2.92Å
42	S	59.1	Low	64.1	Low	102 Å²	102	115.2 Å²	115.2	71%	0.713	62%	0.624	S	S	*	*	H	α-helix	trans	-70.4	-31.6	-178.8	-59.8	0	0	0	113.3	V40	V40-S42 VanDerWaalsContact C-N 3.35Å; V40-S42 PolarHBondContact O-N 2.94Å
43	K	59.5	Low	64.3	Low	197 Å²	197	110 Å²	110	86%	0.857	61%	0.612	S	S	*	*	H	α-helix	trans	-82.3	-27.5	176.8	-81.9	-160.3	175.7	-172.3	113.7	V40	V40-K43 PolarHBondContact O-N 3.24Å
44	T	62.6	Low	64.8	Low	74 Å²	74	109.1 Å²	109.1	45%	0.454	61%	0.607	S	S	.	*	H	α-helix	trans	-86.5	-16.2	-178.7	-38	0	0	0	112.3	V40 E46 G47 V48	V40-T44 PolarHBondContact O-OG1 3.25Å; T44-E46 PolarHBondContact O-N 2.98Å; T44-G47 PolarHBondContact O-N 2.77Å; T44-V48 HydrophobicContact CG2-CG2 3.92Å; T44-V48 WeakPolarHBondContact O-CB 3.37Å; T44-V48 VanDerWaalsContact O-CG2 3.25Å; T44-V48 WeakPolarHBondContact O-CG2 3.46Å; T44-V48 PolarHBondContact O-N 2.85Å
45	K	64.4	Low	65.8	Low	155 Å²	155	106.5 Å²	106.5	67%	0.674	60%	0.603	S	S	*	*	H	α-helix	trans	-58.4	-44.6	-177.1	-138.5	177.5	-176	-179.3	113	G41 V48 V49	G41-K45 WeakPolarHBondContact O-CB 3.4Å; G41-K45 PolarHBondContact O-N 2.92Å; K45-V48 PolarHBondContact O-N 3.48Å; K45-V49 VanDerWaalsContact O-CG2 3.25Å; K45-V49 WeakPolarHBondContact O-CG2 3.33Å; K45-V49 PolarHBondContact O-N 3.31Å
46	E	64	Low	66.8	Low	168 Å²	168	100 Å²	100	79%	0.785	58%	0.582	S	S	*	*	H	α-helix	trans	-68.7	-41.6	178.6	-73.2	-178.1	161.4	0	112.3	T44 V48 V49 H50	T44-E46 PolarHBondContact O-N 2.98Å; E46-V48 VanDerWaalsContact C-N 3.34Å; E46-V48 PolarHBondContact O-N 3.32Å; E46-V49 PolarHBondContact O-N 3.19Å; E46-H50 PolarHBondContact O-N 3.42Å
47	G	67.2	Low	68	Low	53 Å²	53	104 Å²	104	55%	0.546	58%	0.584	S	S	.	*	H	α-helix	trans	-65.8	-35.2	176	0	0	0	0	113.3	T44 G51	T44-G47 PolarHBondContact O-N 2.77Å; G47-G51 PolarHBondContact O-N 3.37Å
48	V	72.3	Confident	69.4	Low	77 Å²	77	106.4 Å²	106.4	47%	0.467	59%	0.588	S	S	.	*	H	α-helix	trans	-70.4	-39.3	175.3	170.5	0	0	0	111.2	T44 K45 E46 H50 G51 V52	T44-V48 HydrophobicContact CG2-CG2 3.92Å; T44-V48 WeakPolarHBondContact O-CB 3.37Å; T44-V48 VanDerWaalsContact O-CG2 3.25Å; T44-V48 WeakPolarHBondContact O-CG2 3.46Å; T44-V48 PolarHBondContact O-N 2.85Å; K45-V48 PolarHBondContact O-N 3.48Å; E46-V48 VanDerWaalsContact C-N 3.34Å; E46-V48 PolarHBondContact O-N 3.32Å; V48-H50 VanDerWaalsContact C-N 3.3Å; V48-H50 PolarHBondContact O-N 3.38Å; V48-G51 CarbonylContact O-C 3.59Å; V48-G51 PolarHBondContact O-N 3.42Å; V48-V52 HydrophobicContact CG1-CG2 3.77Å; V48-V52 VanDerWaalsContact O-CB 3.3Å; V48-V52 WeakPolarHBondContact O-CB 3.18Å; V48-V52 WeakPolarHBondContact O-CG2 3.2Å; V48-V52 PolarHBondContact O-N 3.3Å
49	V	72	Confident	70.6	Confident	103 Å²	103	102.5 Å²	102.5	62%	0.624	57%	0.57	S	S	*	*	H	α-helix	trans	-60.5	-42.5	177.9	169.6	0	0	0	111.1	K45 E46 V52 A53	K45-V49 VanDerWaalsContact O-CG2 3.25Å; K45-V49 WeakPolarHBondContact O-CG2 3.33Å; K45-V49 PolarHBondContact O-N 3.31Å; E46-V49 PolarHBondContact O-N 3.19Å; V49-V52 PolarHBondContact O-N 3.45Å; V49-A53 PolarHBondContact O-N 3.21Å
50	H	72.4	Confident	71.9	Confident	147 Å²	147	99.4 Å²	99.4	68%	0.681	56%	0.561	S	S	*	*	H	α-helix	trans	-67.8	-42.8	176	-151.4	79.4	0	0	111.9	E46 V48 V52 A53 T54	E46-H50 PolarHBondContact O-N 3.42Å; V48-H50 VanDerWaalsContact C-N 3.3Å; V48-H50 PolarHBondContact O-N 3.38Å; H50-V52 VanDerWaalsContact C-N 3.34Å; H50-V52 PolarHBondContact O-N 3.38Å; H50-A53 PolarHBondContact O-N 2.89Å; H50-T54 PolarHBondContact O-N 3.37Å; H50-T54 PolarHBondContact O-OG1 2.87Å
51	G	76.9	Confident	72.9	Confident	34 Å²	34	101.8 Å²	101.8	35%	0.351	57%	0.566	S	S	.	*	H	α-helix	trans	-63	-36.8	175.1	0	0	0	0	113.5	G47 V48 T54 V55	G47-G51 PolarHBondContact O-N 3.37Å; V48-G51 CarbonylContact O-C 3.59Å; V48-G51 PolarHBondContact O-N 3.42Å; G51-T54 PolarHBondContact O-N 2.89Å; G51-V55 WeakPolarHBondContact O-CB 3.49Å; G51-V55 WeakPolarHBondContact O-CG2 3.32Å; G51-V55 PolarHBondContact O-N 3.48Å
52	V	77.8	Confident	73.7	Confident	85 Å²	85	106.2 Å²	106.2	52%	0.515	58%	0.577	S	S	.	*	H	α-helix	trans	-68.2	-35.7	178.1	168.7	0	0	0	111.1	V48 V49 H50 V55 A56	V48-V52 HydrophobicContact CG1-CG2 3.77Å; V48-V52 VanDerWaalsContact O-CB 3.3Å; V48-V52 WeakPolarHBondContact O-CB 3.18Å; V48-V52 WeakPolarHBondContact O-CG2 3.2Å; V48-V52 PolarHBondContact O-N 3.3Å; V49-V52 PolarHBondContact O-N 3.45Å; H50-V52 VanDerWaalsContact C-N 3.34Å; H50-V52 PolarHBondContact O-N 3.38Å; V52-V55 PolarHBondContact O-N 3.13Å; V52-A56 WeakPolarHBondContact O-CB 3.35Å; V52-A56 PolarHBondContact O-N 3.1Å
53	A	76.4	Confident	74.6	Confident	57 Å²	57	105.8 Å²	105.8	47%	0.471	57%	0.57	S	S	.	*	H	α-helix	trans	-62.3	-47.8	173.5	0	0	0	0	111.5	V49 H50 V55 A56 E57	V49-A53 PolarHBondContact O-N 3.21Å; H50-A53 PolarHBondContact O-N 2.89Å; A53-V55 PolarHBondContact O-N 3.41Å; A53-A56 WeakPolarHBondContact O-CB 3.2Å; A53-A56 PolarHBondContact O-N 2.9Å; A53-E57 PolarHBondContact O-N 2.96Å
54	T	77.9	Confident	75.7	Confident	67 Å²	67	100.9 Å²	100.9	41%	0.411	56%	0.557	S	S	.	*	H	α-helix	trans	-64.6	-39.1	176	-51.3	0	0	0	112.4	H50 G51 A56 K58	H50-T54 PolarHBondContact O-N 3.37Å; H50-T54 PolarHBondContact O-OG1 2.87Å; G51-T54 PolarHBondContact O-N 2.89Å; T54-A56 VanDerWaalsContact C-N 3.34Å; T54-K58 PolarHBondContact O-N 2.62Å
55	V	83	Confident	76.6	Confident	87 Å²	87	103 Å²	103	53%	0.527	57%	0.566	S	S	.	*	H	α-helix	trans	-68.4	-35.2	176	170.5	0	0	0	110.8	G51 V52 A53 K58 T59	G51-V55 WeakPolarHBondContact O-CB 3.49Å; G51-V55 WeakPolarHBondContact O-CG2 3.32Å; G51-V55 PolarHBondContact O-N 3.48Å; V52-V55 PolarHBondContact O-N 3.13Å; A53-V55 PolarHBondContact O-N 3.41Å; V55-K58 PolarHBondContact O-N 3.23Å; V55-T59 WeakPolarHBondContact O-CA 3.14Å; V55-T59 WeakPolarHBondContact O-CB 3.48Å; V55-T59 PolarHBondContact O-N 3.43Å; V55-T59 PolarHBondContact O-OG1 3.17Å
56	A	76.9	Confident	77.7	Confident	55 Å²	55	100 Å²	100	46%	0.455	56%	0.56	S	S	.	*	H	α-helix	trans	-63.6	-42.2	177.3	0	0	0	0	111.7	V52 A53 T54 T59 K60	V52-A56 WeakPolarHBondContact O-CB 3.35Å; V52-A56 PolarHBondContact O-N 3.1Å; A53-A56 WeakPolarHBondContact O-CB 3.2Å; A53-A56 PolarHBondContact O-N 2.9Å; T54-A56 VanDerWaalsContact C-N 3.34Å; A56-T59 PolarHBondContact O-N 2.75Å; A56-K60 PolarHBondContact O-N 3.3Å
57	E	80.2	Confident	78.6	Confident	146 Å²	146	93.6 Å²	93.6	68%	0.682	54%	0.539	S	S	*	.	H	α-helix	trans	-62.5	-49.6	173.9	-71.8	-172.9	160.2	0	111.8	A53 T59 K60 E61	A53-E57 PolarHBondContact O-N 2.96Å; E57-T59 VanDerWaalsContact C-N 3.27Å; E57-T59 PolarHBondContact O-N 3.34Å; E57-K60 WeakPolarHBondContact O-CB 3.36Å; E57-K60 PolarHBondContact O-N 3.31Å; E57-K60 VanDerWaalsContact O-N 3.14Å; E57-E61 PolarHBondContact O-N 3.14Å
58	K	84	Confident	79.6	Confident	136 Å²	136	92.8 Å²	92.8	59%	0.591	53%	0.53	S	S	*	.	H	α-helix	trans	-61.7	-35.3	175.3	-70.1	-171.6	177.5	-169.6	112.9	T54 V55 E61 Q62	T54-K58 PolarHBondContact O-N 2.62Å; V55-K58 PolarHBondContact O-N 3.23Å; K58-E61 PolarHBondContact O-N 3.11Å; K58-Q62 WeakPolarHBondContact O-CG 3.26Å; K58-Q62 PolarHBondContact O-N 3.26Å
59	T	81.8	Confident	80.2	Confident	63 Å²	63	92.3 Å²	92.3	39%	0.387	54%	0.535	S	S	.	.	H	α-helix	trans	-68	-37.7	177.1	-60.7	0	0	0	110.4	V55 A56 E57 E61 Q62 V63	V55-T59 WeakPolarHBondContact O-CA 3.14Å; V55-T59 WeakPolarHBondContact O-CB 3.48Å; V55-T59 PolarHBondContact O-N 3.43Å; V55-T59 PolarHBondContact O-OG1 3.17Å; A56-T59 PolarHBondContact O-N 2.75Å; E57-T59 VanDerWaalsContact C-N 3.27Å; E57-T59 PolarHBondContact O-N 3.34Å; T59-E61 VanDerWaalsContact C-N 3.32Å; T59-E61 PolarHBondContact O-N 3.33Å; T59-Q62 PolarHBondContact O-N 2.73Å; T59-V63 HydrophobicContact CG2-CG2 3.95Å; T59-V63 WeakPolarHBondContact O-CB 3.39Å; T59-V63 WeakPolarHBondContact O-CG2 3.49Å; T59-V63 PolarHBondContact O-N 3.39Å
60	K	82.5	Confident	81	Confident	157 Å²	157	91.5 Å²	91.5	68%	0.683	53%	0.53	S	S	*	.	H	α-helix	trans	-60.8	-41.6	176.1	-173	179.9	178.6	-177.5	112	A56 E57 T64	A56-K60 PolarHBondContact O-N 3.3Å; E57-K60 WeakPolarHBondContact O-CB 3.36Å; E57-K60 PolarHBondContact O-N 3.31Å; E57-K60 VanDerWaalsContact O-N 3.14Å; K60-T64 PolarHBondContact O-N 2.8Å; K60-T64 PolarHBondContact O-OG1 3.27Å
61	E	79.6	Confident	81.6	Confident	138 Å²	138	89 Å²	89	65%	0.645	52%	0.524	S	S	*	.	H	α-helix	trans	-65.5	-44.7	174.1	-68.3	-178.9	171.5	0	111.5	E57 K58 T59 V63 T64 N65	E57-E61 PolarHBondContact O-N 3.14Å; K58-E61 PolarHBondContact O-N 3.11Å; T59-E61 VanDerWaalsContact C-N 3.32Å; T59-E61 PolarHBondContact O-N 3.33Å; E61-V63 PolarHBondContact O-N 3.48Å; E61-T64 WeakPolarHBondContact O-CB 3.42Å; E61-T64 PolarHBondContact O-N 3.43Å; E61-N65 PolarHBondContact O-N 3.11Å
62	Q	77.1	Confident	82.2	Confident	130 Å²	130	91.9 Å²	91.9	61%	0.607	54%	0.536	S	S	*	.	H	α-helix	trans	-64.1	-40	176	-73	-167	11.2	0	113.1	K58 T59 T64 N65 V66	K58-Q62 WeakPolarHBondContact O-CG 3.26Å; K58-Q62 PolarHBondContact O-N 3.26Å; T59-Q62 PolarHBondContact O-N 2.73Å; Q62-T64 VanDerWaalsContact C-N 3.28Å; Q62-T64 PolarHBondContact O-N 3.05Å; Q62-N65 PolarHBondContact O-N 2.78Å; Q62-V66 WeakPolarHBondContact O-CB 3.29Å; Q62-V66 VanDerWaalsContact O-CG2 3.26Å; Q62-V66 WeakPolarHBondContact O-CG2 3.45Å; Q62-V66 PolarHBondContact O-N 3.48Å
63	V	78.5	Confident	82.7	Confident	92 Å²	92	89.5 Å²	89.5	56%	0.558	53%	0.528	S	S	*	.	H	α-helix	trans	-64.3	-36.7	177	168.8	0	0	0	110.5	T59 E61 V66 G67	T59-V63 HydrophobicContact CG2-CG2 3.95Å; T59-V63 WeakPolarHBondContact O-CB 3.39Å; T59-V63 WeakPolarHBondContact O-CG2 3.49Å; T59-V63 PolarHBondContact O-N 3.39Å; E61-V63 PolarHBondContact O-N 3.48Å; V63-V66 PolarHBondContact O-N 3.18Å; V63-G67 PolarHBondContact O-N 3.05Å
64	T	81.9	Confident	83.3	Confident	95 Å²	95	91.2 Å²	91.2	58%	0.583	53%	0.533	S	S	*	.	H	α-helix	trans	-62.5	-45.6	172.8	-55.1	0	0	0	111.1	K60 E61 Q62 G67 G68	K60-T64 PolarHBondContact O-N 2.8Å; K60-T64 PolarHBondContact O-OG1 3.27Å; E61-T64 WeakPolarHBondContact O-CB 3.42Å; E61-T64 PolarHBondContact O-N 3.43Å; Q62-T64 VanDerWaalsContact C-N 3.28Å; Q62-T64 PolarHBondContact O-N 3.05Å; T64-G67 PolarHBondContact O-N 3.05Å; T64-G68 PolarHBondContact O-N 3.45Å
65	N	82.1	Confident	83.8	Confident	119 Å²	119	91.3 Å²	91.3	64%	0.636	53%	0.533	S	S	*	.	H	α-helix	trans	-65.1	-42.3	177.5	-69.2	-21.2	0	0	112.6	E61 Q62 G67 G68 A69	E61-N65 PolarHBondContact O-N 3.11Å; Q62-N65 PolarHBondContact O-N 2.78Å; N65-G67 VanDerWaalsContact C-N 3.32Å; N65-G68 PolarHBondContact O-N 2.84Å; N65-A69 PolarHBondContact O-N 3.01Å
66	V	86.8	Confident	84.1	Confident	90 Å²	90	89.6 Å²	89.6	55%	0.545	53%	0.528	S	S	.	.	H	α-helix	trans	-64	-40.2	174.2	172.3	0	0	0	110.2	Q62 V63 G68 A69 V70	Q62-V66 WeakPolarHBondContact O-CB 3.29Å; Q62-V66 VanDerWaalsContact O-CG2 3.26Å; Q62-V66 WeakPolarHBondContact O-CG2 3.45Å; Q62-V66 PolarHBondContact O-N 3.48Å; V63-V66 PolarHBondContact O-N 3.18Å; V66-G68 VanDerWaalsContact C-N 3.34Å; V66-G68 PolarHBondContact O-N 2.86Å; V66-A69 PolarHBondContact O-N 3.23Å; V66-V70 HydrophobicContact CG1-CG2 4.26Å; V66-V70 VanDerWaalsContact O-CG2 3.29Å; V66-V70 WeakPolarHBondContact O-CG2 3.32Å; V66-V70 PolarHBondContact O-N 3.41Å
67	G	84.1	Confident	84.8	Confident	34 Å²	34	91.5 Å²	91.5	35%	0.351	53%	0.534	S	S	.	.	H	α-helix	trans	-58	-46.7	174.2	0	0	0	0	111.7	V63 T64 N65 V70 V71	V63-G67 PolarHBondContact O-N 3.05Å; T64-G67 PolarHBondContact O-N 3.05Å; N65-G67 VanDerWaalsContact C-N 3.32Å; G67-V70 PolarHBondContact O-N 3.37Å; G67-V71 WeakPolarHBondContact O-CG2 3.45Å; G67-V71 PolarHBondContact O-N 2.95Å
68	G	86.4	Confident	85.1	Confident	36 Å²	36	87 Å²	87	37%	0.371	52%	0.522	S	S	.	.	H	α-helix	trans	-57.8	-48.5	172.6	0	0	0	0	112.4	T64 N65 V66 V70 V71 T72	T64-G68 PolarHBondContact O-N 3.45Å; N65-G68 PolarHBondContact O-N 2.84Å; V66-G68 VanDerWaalsContact C-N 3.34Å; V66-G68 PolarHBondContact O-N 2.86Å; G68-V70 VanDerWaalsContact C-N 3.35Å; G68-V70 PolarHBondContact O-N 2.84Å; G68-V71 PolarHBondContact O-N 3.05Å; G68-T72 PolarHBondContact O-N 3.37Å; G68-T72 PolarHBondContact O-OG1 3.23Å; G68-T72 VanDerWaalsContact O-OG1 3.05Å
69	A	85.6	Confident	85.3	Confident	67 Å²	67	86.1 Å²	86.1	55%	0.554	52%	0.519	S	S	*	.	H	α-helix	trans	-62.1	-39	179.3	0	0	0	0	113.1	N65 V66 G73	N65-A69 PolarHBondContact O-N 3.01Å; V66-A69 PolarHBondContact O-N 3.23Å; A69-G73 PolarHBondContact O-N 3.5Å
70	V	89.3	Confident	85.8	Confident	86 Å²	86	90.7 Å²	90.7	52%	0.521	53%	0.534	S	S	.	.	H	α-helix	trans	-64.7	-46.2	175.4	171.4	0	0	0	110.3	V66 G67 G68 T72 G73 V74	V66-V70 HydrophobicContact CG1-CG2 4.26Å; V66-V70 VanDerWaalsContact O-CG2 3.29Å; V66-V70 WeakPolarHBondContact O-CG2 3.32Å; V66-V70 PolarHBondContact O-N 3.41Å; G67-V70 PolarHBondContact O-N 3.37Å; G68-V70 VanDerWaalsContact C-N 3.35Å; G68-V70 PolarHBondContact O-N 2.84Å; V70-T72 PolarHBondContact O-N 2.85Å; V70-G73 PolarHBondContact O-N 3.2Å; V70-V74 HydrophobicContact CG1-CG2 4.34Å; V70-V74 VanDerWaalsContact O-CG2 3.32Å; V70-V74 WeakPolarHBondContact O-CG2 3.33Å; V70-V74 PolarHBondContact O-N 2.95Å
71	V	85.6	Confident	86.1	Confident	94 Å²	94	87.5 Å²	87.5	57%	0.57	53%	0.528	S	S	*	.	H	α-helix	trans	-61.1	-46.7	177.5	172.5	0	0	0	110.9	G67 G68 G73 V74 T75	G67-V71 WeakPolarHBondContact O-CG2 3.45Å; G67-V71 PolarHBondContact O-N 2.95Å; G68-V71 PolarHBondContact O-N 3.05Å; V71-G73 VanDerWaalsContact C-N 3.32Å; V71-G73 PolarHBondContact O-N 3.47Å; V71-V74 PolarHBondContact O-N 3.45Å; V71-T75 WeakPolarHBondContact O-CB 3.27Å; V71-T75 PolarHBondContact O-N 3.45Å; V71-T75 PolarHBondContact O-OG1 2.89Å
72	T	88.6	Confident	86.6	Confident	96 Å²	96	86 Å²	86	59%	0.589	53%	0.528	S	S	*	.	H	α-helix	trans	-60.8	-42.3	175.8	-55.5	0	0	0	111.6	G68 V70 T75 A76	G68-T72 PolarHBondContact O-N 3.37Å; G68-T72 PolarHBondContact O-OG1 3.23Å; G68-T72 VanDerWaalsContact O-OG1 3.05Å; V70-T72 PolarHBondContact O-N 2.85Å; T72-T75 PolarHBondContact O-N 3.25Å; T72-A76 VanDerWaalsContact O-CB 3.27Å; T72-A76 WeakPolarHBondContact O-CB 3.27Å; T72-A76 PolarHBondContact O-N 2.66Å
73	G	89.1	Confident	87.2	Confident	34 Å²	34	86.3 Å²	86.3	35%	0.351	53%	0.53	S	S	.	.	H	α-helix	trans	-61.8	-47.5	177.1	0	0	0	0	112.5	A69 V70 V71 A76 V77	A69-G73 PolarHBondContact O-N 3.5Å; V70-G73 PolarHBondContact O-N 3.2Å; V71-G73 VanDerWaalsContact C-N 3.32Å; V71-G73 PolarHBondContact O-N 3.47Å; G73-A76 PolarHBondContact O-N 3.31Å; G73-V77 WeakPolarHBondContact O-CB 3.4Å; G73-V77 VanDerWaalsContact O-CG2 3.24Å; G73-V77 WeakPolarHBondContact O-CG2 3.36Å; G73-V77 PolarHBondContact O-N 2.88Å
74	V	88.9	Confident	87.7	Confident	94 Å²	94	83.3 Å²	83.3	57%	0.57	52%	0.517	S	S	*	.	H	α-helix	trans	-62.2	-46.1	178	172.5	0	0	0	110.8	V70 V71 A76 V77 A78	V70-V74 HydrophobicContact CG1-CG2 4.34Å; V70-V74 VanDerWaalsContact O-CG2 3.32Å; V70-V74 WeakPolarHBondContact O-CG2 3.33Å; V70-V74 PolarHBondContact O-N 2.95Å; V71-V74 PolarHBondContact O-N 3.45Å; V74-A76 PolarHBondContact O-N 2.94Å; V74-V77 PolarHBondContact O-N 3.5Å; V74-A78 WeakPolarHBondContact O-CB 3.49Å; V74-A78 PolarHBondContact O-N 3.39Å
75	T	87.6	Confident	88	Confident	69 Å²	69	81.5 Å²	81.5	42%	0.423	51%	0.511	S	S	.	.	H	α-helix	trans	-61	-46.6	177.7	-60.9	0	0	0	111.5	V71 T72 V77 A78 Q79	V71-T75 WeakPolarHBondContact O-CB 3.27Å; V71-T75 PolarHBondContact O-N 3.45Å; V71-T75 PolarHBondContact O-OG1 2.89Å; T72-T75 PolarHBondContact O-N 3.25Å; T75-V77 PolarHBondContact O-N 3.46Å; T75-A78 PolarHBondContact O-N 3.29Å; T75-Q79 HydrophobicContact CG2-CG 4.49Å; T75-Q79 WeakPolarHBondContact O-CB 3.24Å; T75-Q79 WeakPolarHBondContact O-CG 3.44Å; T75-Q79 PolarHBondContact O-N 3.27Å
76	A	89.2	Confident	88.2	Confident	50 Å²	50	77.8 Å²	77.8	41%	0.413	50%	0.501	S	S	.	.	H	α-helix	trans	-63.4	-40.8	178.8	0	0	0	0	112.2	T72 G73 V74 K80	T72-A76 VanDerWaalsContact O-CB 3.27Å; T72-A76 WeakPolarHBondContact O-CB 3.27Å; T72-A76 PolarHBondContact O-N 2.66Å; G73-A76 PolarHBondContact O-N 3.31Å; V74-A76 PolarHBondContact O-N 2.94Å; A76-K80 WeakPolarHBondContact O-CB 3.45Å; A76-K80 PolarHBondContact O-N 2.9Å
77	V	91.3	Very high	88.4	Confident	95 Å²	95	77.3 Å²	77.3	58%	0.576	50%	0.502	S	S	*	.	H	α-helix	trans	-64.9	-44	175.9	170.4	0	0	0	110.7	G73 V74 T75 K80 T81	G73-V77 WeakPolarHBondContact O-CB 3.4Å; G73-V77 VanDerWaalsContact O-CG2 3.24Å; G73-V77 WeakPolarHBondContact O-CG2 3.36Å; G73-V77 PolarHBondContact O-N 2.88Å; V74-V77 PolarHBondContact O-N 3.5Å; T75-V77 PolarHBondContact O-N 3.46Å; V77-K80 PolarHBondContact O-N 3.35Å; V77-T81 VanDerWaalsContact O-CB 3.27Å; V77-T81 WeakPolarHBondContact O-CB 3.31Å; V77-T81 PolarHBondContact O-N 2.91Å; V77-T81 PolarHBondContact O-OG1 2.96Å
78	A	87.5	Confident	88.5	Confident	52 Å²	52	81 Å²	81	43%	0.43	51%	0.513	S	S	.	.	H	α-helix	trans	-61.7	-49.6	178.3	0	0	0	0	111.6	V74 T75 K80 T81 V82	V74-A78 WeakPolarHBondContact O-CB 3.49Å; V74-A78 PolarHBondContact O-N 3.39Å; T75-A78 PolarHBondContact O-N 3.29Å; A78-K80 PolarHBondContact O-N 2.94Å; A78-T81 PolarHBondContact O-N 3.5Å; A78-V82 WeakPolarHBondContact O-CG2 3.36Å; A78-V82 PolarHBondContact O-N 3.43Å
79	Q	87.9	Confident	88.5	Confident	117 Å²	117	80.7 Å²	80.7	55%	0.547	51%	0.506	S	S	.	.	H	α-helix	trans	-58.1	-51.4	177.2	-72.9	177.2	-43.3	0	111.4	T75 T81 V82 E83	T75-Q79 HydrophobicContact CG2-CG 4.49Å; T75-Q79 WeakPolarHBondContact O-CB 3.24Å; T75-Q79 WeakPolarHBondContact O-CG 3.44Å; T75-Q79 PolarHBondContact O-N 3.27Å; Q79-T81 VanDerWaalsContact C-N 3.27Å; Q79-T81 PolarHBondContact O-N 2.9Å; Q79-V82 PolarHBondContact O-N 3.02Å; Q79-E83 WeakPolarHBondContact O-CG 3.23Å; Q79-E83 PolarHBondContact O-N 3.12Å
80	K	91.5	Very high	88.5	Confident	159 Å²	159	80.5 Å²	80.5	69%	0.691	51%	0.505	S	S	*	.	H	α-helix	trans	-64.2	-31.6	-179.7	-167.7	172.9	-175.4	175.3	112.9	A76 V77 A78 G84	A76-K80 WeakPolarHBondContact O-CB 3.45Å; A76-K80 PolarHBondContact O-N 2.9Å; V77-K80 PolarHBondContact O-N 3.35Å; A78-K80 PolarHBondContact O-N 2.94Å; K80-G84 PolarHBondContact O-N 3.46Å
81	T	89.9	Confident	88.4	Confident	90 Å²	90	80.7 Å²	80.7	55%	0.552	52%	0.516	S	S	*	.	H	α-helix	trans	-69.3	-42.2	176.5	-58.7	0	0	0	111.1	V77 A78 Q79 G84 A85	V77-T81 VanDerWaalsContact O-CB 3.27Å; V77-T81 WeakPolarHBondContact O-CB 3.31Å; V77-T81 PolarHBondContact O-N 2.91Å; V77-T81 PolarHBondContact O-OG1 2.96Å; A78-T81 PolarHBondContact O-N 3.5Å; Q79-T81 VanDerWaalsContact C-N 3.27Å; Q79-T81 PolarHBondContact O-N 2.9Å; T81-G84 PolarHBondContact O-N 3.47Å; T81-A85 WeakPolarHBondContact O-CB 3.47Å; T81-A85 PolarHBondContact O-N 3.36Å
82	V	90.6	Very high	88.3	Confident	108 Å²	108	80.1 Å²	80.1	66%	0.655	51%	0.513	S	S	*	.	H	α-helix	trans	-65.4	-46.4	176.6	173.4	0	0	0	110.8	A78 Q79 G84 A85 G86	A78-V82 WeakPolarHBondContact O-CG2 3.36Å; A78-V82 PolarHBondContact O-N 3.43Å; Q79-V82 PolarHBondContact O-N 3.02Å; V82-G84 PolarHBondContact O-N 3.17Å; V82-A85 PolarHBondContact O-N 2.88Å; V82-G86 PolarHBondContact O-N 3.48Å
83	E	89.7	Confident	88.1	Confident	136 Å²	136	77.8 Å²	77.8	64%	0.636	51%	0.508	S	S	*	.	H	α-helix	trans	-61.2	-43.5	175.8	-70.7	171.6	-166.8	0	111.8	Q79 G86 S87	Q79-E83 WeakPolarHBondContact O-CG 3.23Å; Q79-E83 PolarHBondContact O-N 3.12Å; E83-G86 PolarHBondContact O-N 2.91Å; E83-S87 WeakPolarHBondContact O-CB 3.21Å; E83-S87 PolarHBondContact O-N 3.45Å
84	G	87.9	Confident	88	Confident	29 Å²	29	84 Å²	84	30%	0.299	53%	0.525	S	S	.	.	H	α-helix	trans	-63	-44.9	176.8	0	0	0	0	112.5	K80 T81 V82 G86 S87 I88	K80-G84 PolarHBondContact O-N 3.46Å; T81-G84 PolarHBondContact O-N 3.47Å; V82-G84 PolarHBondContact O-N 3.17Å; G84-G86 VanDerWaalsContact C-N 3.34Å; G84-G86 PolarHBondContact O-N 2.85Å; G84-S87 PolarHBondContact O-N 3.15Å; G84-I88 WeakPolarHBondContact O-CD1 3.44Å; G84-I88 VanDerWaalsContact O-CG1 3.23Å; G84-I88 WeakPolarHBondContact O-CG1 3.42Å; G84-I88 PolarHBondContact O-N 2.92Å
85	A	88.1	Confident	87.8	Confident	56 Å²	56	84.1 Å²	84.1	46%	0.463	53%	0.526	S	S	.	.	H	α-helix	trans	-61.5	-43.1	175.7	0	0	0	0	111.7	T81 V82 I88 A89	T81-A85 WeakPolarHBondContact O-CB 3.47Å; T81-A85 PolarHBondContact O-N 3.36Å; V82-A85 PolarHBondContact O-N 2.88Å; A85-I88 PolarHBondContact O-N 3.38Å; A85-A89 WeakPolarHBondContact O-CB 3.42Å; A85-A89 PolarHBondContact O-N 3.26Å
86	G	86.4	Confident	87.6	Confident	41 Å²	41	91 Å²	91	42%	0.423	55%	0.55	S	S	.	*	H	α-helix	trans	-62.3	-41.8	174.7	0	0	0	0	112.6	V82 E83 G84 A89 A90	V82-G86 PolarHBondContact O-N 3.48Å; E83-G86 PolarHBondContact O-N 2.91Å; G84-G86 VanDerWaalsContact C-N 3.34Å; G84-G86 PolarHBondContact O-N 2.85Å; G86-A89 PolarHBondContact O-N 3.48Å; G86-A90 VanDerWaalsContact O-CB 3.31Å; G86-A90 WeakPolarHBondContact O-CB 3.34Å; G86-A90 PolarHBondContact O-N 3.3Å
87	S	91.3	Very high	87.3	Confident	81 Å²	81	95.8 Å²	95.8	57%	0.566	56%	0.561	S	S	*	*	H	α-helix	trans	-64.2	-41.2	176.3	-176.9	0	0	0	112.2	E83 G84 A90 A91	E83-S87 WeakPolarHBondContact O-CB 3.21Å; E83-S87 PolarHBondContact O-N 3.45Å; G84-S87 PolarHBondContact O-N 3.15Å; S87-A90 PolarHBondContact O-N 2.86Å; S87-A91 VanDerWaalsContact O-CB 3.27Å; S87-A91 WeakPolarHBondContact O-CB 3.07Å; S87-A91 PolarHBondContact O-N 3.5Å
88	I	87	Confident	86.9	Confident	112 Å²	112	99.2 Å²	99.2	57%	0.574	58%	0.576	S	S	*	*	H	α-helix	trans	-65.2	-47.2	175.8	-66	161.7	0	0	110.3	G84 A85 A90 A91 T92	G84-I88 WeakPolarHBondContact O-CD1 3.44Å; G84-I88 VanDerWaalsContact O-CG1 3.23Å; G84-I88 WeakPolarHBondContact O-CG1 3.42Å; G84-I88 PolarHBondContact O-N 2.92Å; A85-I88 PolarHBondContact O-N 3.38Å; I88-A90 VanDerWaalsContact C-N 3.33Å; I88-A90 PolarHBondContact O-N 3.27Å; I88-A91 PolarHBondContact O-N 2.97Å; I88-T92 HydrophobicContact CG2-CG2 4.19Å; I88-T92 WeakPolarHBondContact O-CB 3.16Å; I88-T92 WeakPolarHBondContact O-CG2 3.47Å; I88-T92 PolarHBondContact O-N 3.06Å; I88-T92 PolarHBondContact O-OG1 3.45Å; I88-T92 VanDerWaalsContact O-OG1 3.12Å
89	A	84.9	Confident	86.5	Confident	28 Å²	28	102.7 Å²	102.7	23%	0.231	58%	0.584	C	S	.	*	H	α-helix	trans	-59.2	-44.8	177.9	0	0	0	0	111.5	A85 G86 T92 G93 F94	A85-A89 WeakPolarHBondContact O-CB 3.42Å; A85-A89 PolarHBondContact O-N 3.26Å; G86-A89 PolarHBondContact O-N 3.48Å; A89-T92 WeakPolarHBondContact CA-OG1 3.27Å; A89-T92 PolarHBondContact O-N 3Å; A89-T92 PolarHBondContact O-OG1 3.39Å; A89-G93 PolarHBondContact O-N 2.88Å; A89-F94 HydrophobicContact CB-CD1 4.5Å; A89-F94 HydrophobicContact CB-CE1 3.85Å; A89-F94 HydrophobicContact CB-CZ 3.94Å; A89-F94 PolarHBondContact O-N 3.39Å
90	A	87.1	Confident	85.8	Confident	64 Å²	64	105.9 Å²	105.9	53%	0.529	60%	0.604	S	S	.	*	H	α-helix	trans	-62.5	-44.7	175.3	0	0	0	0	112.4	G86 S87 I88 T92 G93	G86-A90 VanDerWaalsContact O-CB 3.31Å; G86-A90 WeakPolarHBondContact O-CB 3.34Å; G86-A90 PolarHBondContact O-N 3.3Å; S87-A90 PolarHBondContact O-N 2.86Å; I88-A90 VanDerWaalsContact C-N 3.33Å; I88-A90 PolarHBondContact O-N 3.27Å; A90-T92 VanDerWaalsContact C-N 3.33Å; A90-T92 PolarHBondContact O-N 2.96Å; A90-G93 PolarHBondContact O-N 2.95Å; A90-G93 VanDerWaalsContact O-N 3.12Å
91	A	85.7	Confident	85.1	Confident	90 Å²	90	101.5 Å²	101.5	74%	0.744	60%	0.604	S	S	*	*	H	α-helix	trans	-65.7	-34.9	178.9	0	0	0	0	112.7	S87 I88 G93	S87-A91 VanDerWaalsContact O-CB 3.27Å; S87-A91 WeakPolarHBondContact O-CB 3.07Å; S87-A91 PolarHBondContact O-N 3.5Å; I88-A91 PolarHBondContact O-N 2.97Å; A91-G93 PolarHBondContact O-N 3.2Å
92	T	83.9	Confident	84.7	Confident	82 Å²	82	106.6 Å²	106.6	50%	0.503	62%	0.618	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.8	-5.9	175.5	63.7	0	0	0	113.4	I88 A89 A90 F94 V95	I88-T92 HydrophobicContact CG2-CG2 4.19Å; I88-T92 WeakPolarHBondContact O-CB 3.16Å; I88-T92 WeakPolarHBondContact O-CG2 3.47Å; I88-T92 PolarHBondContact O-N 3.06Å; I88-T92 PolarHBondContact O-OG1 3.45Å; I88-T92 VanDerWaalsContact O-OG1 3.12Å; A89-T92 WeakPolarHBondContact CA-OG1 3.27Å; A89-T92 PolarHBondContact O-N 3Å; A89-T92 PolarHBondContact O-OG1 3.39Å; A90-T92 VanDerWaalsContact C-N 3.33Å; A90-T92 PolarHBondContact O-N 2.96Å; T92-F94 PolarHBondContact O-N 3.24Å; T92-V95 WeakPolarHBondContact O-CG2 3.48Å; T92-V95 PolarHBondContact O-N 3.45Å
93	G	85.3	Confident	84.1	Confident	47 Å²	47	107.1 Å²	107.1	49%	0.485	62%	0.617	S	S	.	*	T	Hydrogen-bonded Turn	trans	65.7	20.2	177.2	0	0	0	0	114.6	A89 A90 A91 V95	A89-G93 PolarHBondContact O-N 2.88Å; A90-G93 PolarHBondContact O-N 2.95Å; A90-G93 VanDerWaalsContact O-N 3.12Å; A91-G93 PolarHBondContact O-N 3.2Å; G93-V95 PolarHBondContact O-N 2.87Å
94	F	85.9	Confident	83.4	Confident	164 Å²	164	109.9 Å²	109.9	72%	0.719	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.5	31.2	-176.7	-62.3	-90.1	0	0	114.4	A89 T92	A89-F94 HydrophobicContact CB-CD1 4.5Å; A89-F94 HydrophobicContact CB-CE1 3.85Å; A89-F94 HydrophobicContact CB-CZ 3.94Å; A89-F94 PolarHBondContact O-N 3.39Å; T92-F94 PolarHBondContact O-N 3.24Å
95	V	85.5	Confident	83	Confident	97 Å²	97	117.2 Å²	117.2	59%	0.588	66%	0.657	S	S	*	*			trans	-82.4	130.9	-178.8	-171.2	0	0	0	110.7	T92 G93 K97	T92-V95 WeakPolarHBondContact O-CG2 3.48Å; T92-V95 PolarHBondContact O-N 3.45Å; G93-V95 PolarHBondContact O-N 2.87Å; V95-K97 WeakPolarHBondContact CG1-O 3.4Å
96	K	83.4	Confident	82.6	Confident	214 Å²	214	117.9 Å²	117.9	93%	0.93	67%	0.669	S	S	*	*	S	Bend	trans	-72.5	-31.4	-180	-68	-178.4	-178.6	178.1	113.8
97	K	83.4	Confident	82.1	Confident	149 Å²	149	119.6 Å²	119.6	65%	0.648	68%	0.679	S	S	*	*	S	Bend	trans	-139.1	126.7	175.7	-77.2	-166.6	177.2	89.5	108.8	V95 Q99	V95-K97 WeakPolarHBondContact CG1-O 3.4Å; K97-Q99 VanDerWaalsContact C-N 3.34Å; K97-Q99 HydrophobicContact CB-CG 4.46Å; K97-Q99 PolarHBondContact O-N 3.23Å
98	D	81.3	Confident	81.5	Confident	167 Å²	167	122.4 Å²	122.4	89%	0.893	70%	0.695	S	S	*	*			trans	-71.8	93	171.6	-166.7	14.2	0	0	108.8
99	Q	80.1	Confident	81.2	Confident	126 Å²	126	125.7 Å²	125.7	59%	0.589	71%	0.709	S	S	*	*			trans	-128.8	128.4	177.2	-83.8	-175.6	96	0	108.8	K97	K97-Q99 VanDerWaalsContact C-N 3.34Å; K97-Q99 HydrophobicContact CB-CG 4.46Å; K97-Q99 PolarHBondContact O-N 3.23Å
100	L	73.5	Confident	81.3	Confident	184 Å²	184	134 Å²	134	96%	0.963	74%	0.743	S	S	*	*			trans	-106.9	118.8	176.7	-169.3	69.8	0	0	109.2
101	G	77.4	Confident	81.3	Confident	67 Å²	67	134.5 Å²	134.5	69%	0.691	75%	0.754	S	S	*	*	S	Bend	trans	124.6	170.2	-177.5	0	0	0	0	112.6
102	K	79.6	Confident	81.4	Confident	196 Å²	196	137.7 Å²	137.7	85%	0.852	76%	0.757	S	S	*	*			trans	-90.1	140	169.9	-66.6	-178.3	178.7	179.9	108.1	E104	K102-E104 PolarHBondContact O-N 3.48Å
103	N	79.4	Confident	81.6	Confident	119 Å²	119	141.8 Å²	141.8	64%	0.636	77%	0.774	S	S	*	*			trans	-66.8	100.6	162.3	-78	-6.8	0	0	107	E105	N103-E105 PolarHBondContact O-N 3.39Å; N103-E105 VanDerWaalsContact O-N 3.16Å
104	E	74.9	Confident	81.7	Confident	194 Å²	194	148.7 Å²	148.7	91%	0.907	79%	0.794	S	S	*	*			trans	-72	103.9	169.9	-78.6	-170.3	140.3	0	108.4	K102	K102-E104 PolarHBondContact O-N 3.48Å
105	E	79.3	Confident	82	Confident	184 Å²	184	147.8 Å²	147.8	86%	0.86	80%	0.797	S	S	*	*			trans	-90.8	124.8	170.3	-71.9	174.9	178.1	0	108.7	N103	N103-E105 PolarHBondContact O-N 3.39Å; N103-E105 VanDerWaalsContact O-N 3.16Å
106	G	78.9	Confident	82.2	Confident	70 Å²	70	151.2 Å²	151.2	72%	0.722	81%	0.809	S	S	*	*			trans	-146.4	156.1	179.5	0	0	0	0	111.6
107	A	76.5	Confident	82.5	Confident	77 Å²	77	146.8 Å²	146.8	64%	0.636	80%	0.802	S	S	*	*			trans	63.7	95.9	-177	0	0	0	0	114.5	Q109	A107-Q109 PolarHBondContact O-N 3.23Å
108	P	77.7	Confident	82.9	Confident	139 Å²	139	146.2 Å²	146.2	90%	0.903	81%	0.81	S	S	*	*			trans	-64.5	131.6	173.8	27.2	-31.9	0	0	110
109	Q	82.4	Confident	83.3	Confident	182 Å²	182	142.7 Å²	142.7	85%	0.85	79%	0.791	S	S	*	*			trans	-122.9	131.9	172.7	-64.5	-176.8	23.6	0	108.5	A107	A107-Q109 PolarHBondContact O-N 3.23Å
110	E	86.3	Confident	83.8	Confident	203 Å²	203	142.1 Å²	142.1	95%	0.949	80%	0.798	S	S	*	*			trans	-104.9	136.1	174.3	-64.9	-175.6	171.2	0	109.2
111	G	86	Confident	84.7	Confident	74 Å²	74	139 Å²	139	76%	0.763	78%	0.783	S	S	*	*			trans	-164.8	157.4	179.6	0	0	0	0	111.1
112	I	89.7	Confident	85.2	Confident	157 Å²	157	141.3 Å²	141.3	81%	0.805	78%	0.779	S	S	*	*			trans	-96.5	132.6	172	54.1	168.3	0	0	109.2
113	L	87.3	Confident	85.6	Confident	167 Å²	167	140.2 Å²	140.2	87%	0.874	78%	0.777	S	S	*	*			trans	-75.6	124.6	167.1	-62.4	177.2	0	0	107.6	D115	L113-D115 VanDerWaalsContact C-N 3.34Å
114	Q	86.9	Confident	86.2	Confident	193 Å²	193	137.7 Å²	137.7	90%	0.902	77%	0.773	S	S	*	*	S	Bend	trans	-73.3	-30.1	178.2	-73.3	172.1	4	0	111.9
115	D	92.1	Very high	86.8	Confident	145 Å²	145	140 Å²	140	78%	0.775	78%	0.775	S	S	*	*	S	Bend	trans	-79.6	129.3	171.9	-110.7	-18	0	0	109.6	L113	L113-D115 VanDerWaalsContact C-N 3.34Å
116	M	89.8	Confident	87.1	Confident	169 Å²	169	138.9 Å²	138.9	83%	0.833	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-63.4	138.4	169.8	-67.7	-169.3	-64.5	0	108.9
117	P	89.6	Confident	87.5	Confident	121 Å²	121	141.1 Å²	141.1	79%	0.786	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-60.2	142.9	175.4	26.9	-33.5	0	0	109.4	D119	P117-D119 PolarHBondContact O-N 3.4Å; P117-D119 VanDerWaalsContact O-N 3.12Å
118	V	92.7	Very high	88	Confident	136 Å²	136	141.4 Å²	141.4	82%	0.824	76%	0.758	S	S	*	*			trans	-67.9	111.7	167.1	179.4	0	0	0	106.5	P120	V118-P120 VanDerWaalsContact O-CD 3.31Å; V118-P120 WeakPolarHBondContact O-CD 3.49Å
119	D	89.7	Confident	88.4	Confident	93 Å²	93	140.4 Å²	140.4	50%	0.497	75%	0.754	S	S	.	*			trans	-83.3	111.2	166.4	-154.1	-38.6	0	0	108.1	P117 D121	P117-D119 PolarHBondContact O-N 3.4Å; P117-D119 VanDerWaalsContact O-N 3.12Å; D119-D121 PolarHBondContact O-N 3.22Å; D119-D121 WeakPolarHBondContact OD1-CB 3.31Å; D119-D121 PolarHBondContact OD1-N 2.86Å
120	P	89.9	Confident	88.7	Confident	114 Å²	114	140.4 Å²	140.4	74%	0.74	75%	0.754	S	S	*	*			trans	-71.6	-18.6	177.2	31.4	-34.8	0	0	111.9	V118	V118-P120 VanDerWaalsContact O-CD 3.31Å; V118-P120 WeakPolarHBondContact O-CD 3.49Å
121	D	91.9	Very high	88.5	Confident	120 Å²	120	138 Å²	138	64%	0.642	74%	0.743	S	S	*	*	S	Bend	trans	-81.4	131.1	177.3	-67.1	-32.9	0	0	109.1	D119 E123	D119-D121 PolarHBondContact O-N 3.22Å; D119-D121 WeakPolarHBondContact OD1-CB 3.31Å; D119-D121 PolarHBondContact OD1-N 2.86Å; D121-E123 PolarHBondContact O-N 3.12Å
122	N	88.7	Confident	88.1	Confident	114 Å²	114	136.4 Å²	136.4	61%	0.61	73%	0.727	S	S	*	*			trans	-76.6	1	-176.7	-163.1	23.1	0	0	112.9	A124	N122-A124 WeakPolarHBondContact O-CB 3.4Å; N122-A124 PolarHBondContact O-N 3.42Å
123	E	88.6	Confident	87.8	Confident	173 Å²	173	137.1 Å²	137.1	81%	0.808	72%	0.721	S	S	*	*			trans	42.6	27.9	-175.2	-62.3	-164.9	155.3	0	115	D121	D121-E123 PolarHBondContact O-N 3.12Å
124	A	91.7	Very high	87.8	Confident	66 Å²	66	136.8 Å²	136.8	55%	0.545	71%	0.714	S	S	.	*	S	Bend	trans	-136.4	145.1	-173.9	0	0	0	0	110.6	N122 E126	N122-A124 WeakPolarHBondContact O-CB 3.4Å; N122-A124 PolarHBondContact O-N 3.42Å; A124-E126 PolarHBondContact O-N 2.9Å; A124-E126 VanDerWaalsContact O-N 3.15Å
125	Y	86.1	Confident	87.9	Confident	244 Å²	244	135 Å²	135	96%	0.957	71%	0.711	S	S	*	*			trans	-70.5	106.7	166.2	-75.8	-80.1	0	0	108.8
126	E	86.3	Confident	87.5	Confident	160 Å²	160	136.3 Å²	136.3	75%	0.748	71%	0.706	S	S	*	*	P	Polyproline II helix	trans	-87.3	127.1	175.2	-151.3	170.4	-161.2	0	109.3	A124	A124-E126 PolarHBondContact O-N 2.9Å; A124-E126 VanDerWaalsContact O-N 3.15Å
127	M	88.2	Confident	87.2	Confident	117 Å²	117	135.8 Å²	135.8	58%	0.576	70%	0.702	S	S	*	*	P	Polyproline II helix	trans	-69.4	137.2	176.7	-64.7	-160.2	-52.5	0	109.4	S129 Y133	M127-S129 PolarHBondContact O-N 3.41Å; M127-Y133 HydrophobicContact CE-CE1 3.95Å
128	P	86.7	Confident	86.8	Confident	83 Å²	83	135.9 Å²	135.9	54%	0.539	70%	0.702	S	S	.	*	P	Polyproline II helix	trans	-61.5	139.1	177.5	26.5	-33.1	0	0	109.7	E130 E131	P128-E130 PolarHBondContact O-N 2.96Å; P128-E131 HydrophobicContact CG-CG 4.33Å; P128-E131 PolarHBondContact O-N 2.87Å
129	S	86.9	Confident	86.1	Confident	117 Å²	117	138.5 Å²	138.5	82%	0.818	71%	0.705	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.2	-7.7	178.4	56.8	0	0	0	114.1	M127 G132	M127-S129 PolarHBondContact O-N 3.41Å; S129-G132 PolarHBondContact O-N 3.36Å
130	E	88.6	Confident	84.8	Confident	182 Å²	182	141.5 Å²	141.5	85%	0.85	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.9	-32.1	176.8	-169.7	173.3	178.4	0	113	P128 G132	P128-E130 PolarHBondContact O-N 2.96Å; E130-G132 PolarHBondContact O-N 3.16Å
131	E	80.4	Confident	84.5	Confident	153 Å²	153	142.9 Å²	142.9	72%	0.715	74%	0.744	S	S	*	*	S	Bend	trans	-67.1	-21.3	177.3	-68.2	-67.3	152.1	0	112.1	P128	P128-E131 HydrophobicContact CG-CG 4.33Å; P128-E131 PolarHBondContact O-N 2.87Å
132	G	78	Confident	84.1	Confident	40 Å²	40	144.1 Å²	144.1	41%	0.412	75%	0.749	S	S	.	*			trans	59.9	179	-178	0	0	0	0	113.1	S129 E130	S129-G132 PolarHBondContact O-N 3.36Å; E130-G132 PolarHBondContact O-N 3.16Å
133	Y	84.4	Confident	83.9	Confident	173 Å²	173	145.8 Å²	145.8	68%	0.678	76%	0.757	S	S	*	*			trans	-126.3	134.2	170.5	-64.4	-83.1	0	0	107.7	M127 D135	M127-Y133 HydrophobicContact CE-CE1 3.95Å; Y133-D135 PolarHBondContact O-N 2.99Å
134	Q	86.3	Confident	83.6	Confident	159 Å²	159	144.2 Å²	144.2	74%	0.743	75%	0.754	S	S	*	*			trans	-78.9	106.8	172.6	-76.4	-177.2	-7.6	0	108.7	Y136	Q134-Y136 VanDerWaalsContact C-N 3.27Å
135	D	89.1	Confident	83.1	Confident	155 Å²	155	149.1 Å²	149.1	83%	0.829	77%	0.767	S	S	*	*			trans	-86.3	5.4	177.9	-64.2	-32.8	0	0	113.1	Y133	Y133-D135 PolarHBondContact O-N 2.99Å
136	Y	84.9	Confident	82.9	Confident	173 Å²	173	142.7 Å²	142.7	68%	0.678	75%	0.754	S	S	*	*	S	Bend	trans	-135.3	142.3	-179.7	55.4	-91.1	0	0	111.6	Q134	Q134-Y136 VanDerWaalsContact C-N 3.27Å
137	E	82.3	Confident	82.6	Confident	159 Å²	159	141.5 Å²	141.5	74%	0.743	76%	0.755	S	S	*	*			trans	-83.1	142.5	175.2	-69.7	-173	156.3	0	110.9	E139	E137-E139 PolarHBondContact O-N 3.12Å
138	P	81.8	Confident	82.2	Confident	122 Å²	122	143.4 Å²	143.4	79%	0.792	77%	0.768	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.6	-8.3	-176.5	28.2	-35.1	0	0	114.8
139	E	78.5	Confident	81.8	Confident	191 Å²	191	148.4 Å²	148.4	89%	0.893	79%	0.787	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.2	19.4	-173.5	-62.5	-153.2	168.4	0	115.3	E137	E137-E139 PolarHBondContact O-N 3.12Å
140	A	61	Low	81.4	Confident	157 Å²	157	151.3 Å²	151.3	100%	1.298	79%	0.785	S	S	*	*			trans	-117.6	0	173.1	0	0	0	0	113

Retrieved 140 of 140 residues in 486.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).