SYUA_MACMU Loading...

Alpha-synuclein

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (By similarity). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (By similarity). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (By similarity). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (By similarity). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (By similarity). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (By similarity).

AlphaFold DB (P61142), UniProt , Accession P61143, Species MACMU (Macaca mulatta, Rhesus macaque), Gene SNCA, Length 140 aa.

						>SYUA_MACMU|P61143|SNCA
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	88.6	Confident	92.2	Very high	192 Å²	192	118.6 Å²	118.6	95%	0.946	63%	0.631	S	S	*	*				0	-6	0	-74.4	177.1	-178.6	0	112.7	V3 F4 M5	M1-V3 PolarHBondContact O-N 2.92Å; M1-F4 WeakPolarHBondContact O-CB 3.02Å; M1-F4 PolarHBondContact O-N 2.86Å; M1-F4 VanDerWaalsContact O-N 3.08Å; M1-M5 PolarHBondContact O-N 3.34Å
2	D	92.1	Very high	92.1	Very high	136 Å²	136	121.4 Å²	121.4	73%	0.727	63%	0.633	S	S	*	*	H	α-helix	trans	-64.8	-38.6	-170.5	-48.9	-48.9	0	0	114	F4 M5 K6	D2-F4 VanDerWaalsContact C-N 3.27Å; D2-F4 PolarHBondContact O-N 3.35Å; D2-M5 PolarHBondContact O-N 2.95Å; D2-K6 WeakPolarHBondContact O-CB 3.46Å; D2-K6 PolarHBondContact O-N 3.11Å
3	V	93.9	Very high	92.1	Very high	130 Å²	130	122.2 Å²	122.2	79%	0.788	63%	0.632	S	S	*	*	H	α-helix	trans	-62.1	-38	175.7	-177.5	0	0	0	111.2	M1 G7	M1-V3 PolarHBondContact O-N 2.92Å; V3-G7 PolarHBondContact O-N 3.17Å
4	F	92.5	Very high	92.1	Very high	149 Å²	149	116.5 Å²	116.5	65%	0.654	62%	0.618	S	S	*	*	H	α-helix	trans	-67.6	-46.7	176.2	176.9	-94.3	0	0	111.3	M1 D2 K6 G7 L8	M1-F4 WeakPolarHBondContact O-CB 3.02Å; M1-F4 PolarHBondContact O-N 2.86Å; M1-F4 VanDerWaalsContact O-N 3.08Å; D2-F4 VanDerWaalsContact C-N 3.27Å; D2-F4 PolarHBondContact O-N 3.35Å; F4-K6 VanDerWaalsContact C-N 3.32Å; F4-K6 PolarHBondContact O-N 3.39Å; F4-G7 WeakPolarHBondContact O-CA 3.28Å; F4-G7 PolarHBondContact O-N 3.27Å; F4-G7 VanDerWaalsContact O-N 3.11Å; F4-L8 PolarHBondContact O-N 3.16Å
5	M	92.1	Very high	92.3	Very high	111 Å²	111	115.7 Å²	115.7	55%	0.547	62%	0.619	S	S	.	*	H	α-helix	trans	-59.4	-43.2	175.8	-70.8	-64.9	-144	0	111.6	M1 D2 G7 L8 S9	M1-M5 PolarHBondContact O-N 3.34Å; D2-M5 PolarHBondContact O-N 2.95Å; M5-G7 VanDerWaalsContact C-N 3.33Å; M5-G7 PolarHBondContact O-N 3.13Å; M5-L8 PolarHBondContact O-N 3.34Å; M5-S9 WeakPolarHBondContact O-CB 3.5Å; M5-S9 PolarHBondContact O-N 3.18Å; M5-S9 PolarHBondContact O-OG 3.23Å
6	K	92.9	Very high	92.4	Very high	167 Å²	167	112.6 Å²	112.6	73%	0.726	61%	0.605	S	S	*	*	H	α-helix	trans	-62	-41	174.5	-170.8	176.5	-176.7	174.4	111.7	D2 F4 K10	D2-K6 WeakPolarHBondContact O-CB 3.46Å; D2-K6 PolarHBondContact O-N 3.11Å; F4-K6 VanDerWaalsContact C-N 3.32Å; F4-K6 PolarHBondContact O-N 3.39Å; K6-K10 WeakPolarHBondContact O-CB 3.45Å; K6-K10 PolarHBondContact O-N 3.28Å
7	G	92.8	Very high	92.3	Very high	40 Å²	40	109.3 Å²	109.3	41%	0.412	60%	0.597	S	S	.	*	H	α-helix	trans	-63.2	-45.5	175.3	0	0	0	0	112.9	V3 F4 M5 K10 A11	V3-G7 PolarHBondContact O-N 3.17Å; F4-G7 WeakPolarHBondContact O-CA 3.28Å; F4-G7 PolarHBondContact O-N 3.27Å; F4-G7 VanDerWaalsContact O-N 3.11Å; M5-G7 VanDerWaalsContact C-N 3.33Å; M5-G7 PolarHBondContact O-N 3.13Å; G7-K10 PolarHBondContact O-N 3.1Å; G7-A11 WeakPolarHBondContact O-CB 3.29Å; G7-A11 PolarHBondContact O-N 2.92Å
8	L	92	Very high	92.3	Very high	100 Å²	100	106.3 Å²	106.3	52%	0.524	59%	0.589	S	S	.	*	H	α-helix	trans	-61.8	-45.8	176.7	179.4	63.1	0	0	111.5	F4 M5 A11 K12	F4-L8 PolarHBondContact O-N 3.16Å; M5-L8 PolarHBondContact O-N 3.34Å; L8-A11 PolarHBondContact O-N 3.45Å; L8-K12 WeakPolarHBondContact O-CB 3.26Å; L8-K12 PolarHBondContact O-N 3.08Å
9	S	92.8	Very high	92.3	Very high	64 Å²	64	103.5 Å²	103.5	45%	0.448	58%	0.581	S	S	.	*	H	α-helix	trans	-62.2	-44.6	176.6	-64.9	0	0	0	111.8	M5 A11 K12 E13	M5-S9 WeakPolarHBondContact O-CB 3.5Å; M5-S9 PolarHBondContact O-N 3.18Å; M5-S9 PolarHBondContact O-OG 3.23Å; S9-A11 VanDerWaalsContact C-N 3.32Å; S9-A11 PolarHBondContact O-N 2.88Å; S9-K12 WeakPolarHBondContact O-CB 3.36Å; S9-K12 PolarHBondContact O-N 3.34Å; S9-E13 WeakPolarHBondContact O-CG 3.3Å; S9-E13 PolarHBondContact O-N 3.39Å
10	K	92.9	Very high	92.2	Very high	158 Å²	158	104.6 Å²	104.6	69%	0.687	58%	0.581	S	S	*	*	H	α-helix	trans	-61.5	-39.3	176	-172.4	176.8	-177.7	179.9	112.2	K6 G7 G14	K6-K10 WeakPolarHBondContact O-CB 3.45Å; K6-K10 PolarHBondContact O-N 3.28Å; G7-K10 PolarHBondContact O-N 3.1Å; K10-G14 PolarHBondContact O-N 2.89Å
11	A	91.3	Very high	92.2	Very high	58 Å²	58	107.3 Å²	107.3	48%	0.479	59%	0.587	S	S	.	*	H	α-helix	trans	-64.9	-44.2	175	0	0	0	0	111.5	G7 L8 S9 G14 V15	G7-A11 WeakPolarHBondContact O-CB 3.29Å; G7-A11 PolarHBondContact O-N 2.92Å; L8-A11 PolarHBondContact O-N 3.45Å; S9-A11 VanDerWaalsContact C-N 3.32Å; S9-A11 PolarHBondContact O-N 2.88Å; A11-G14 PolarHBondContact O-N 2.9Å; A11-V15 WeakPolarHBondContact O-CG2 3.39Å; A11-V15 PolarHBondContact O-N 3.48Å
12	K	91.5	Very high	92.3	Very high	152 Å²	152	102.5 Å²	102.5	66%	0.661	57%	0.569	S	S	*	*	H	α-helix	trans	-59.9	-46.6	175.4	-177.9	-178.3	176.3	-175.8	111.7	L8 S9 G14 V15 V16	L8-K12 WeakPolarHBondContact O-CB 3.26Å; L8-K12 PolarHBondContact O-N 3.08Å; S9-K12 WeakPolarHBondContact O-CB 3.36Å; S9-K12 PolarHBondContact O-N 3.34Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 2.85Å; K12-V15 PolarHBondContact O-N 3.39Å; K12-V16 WeakPolarHBondContact O-CG2 3.34Å; K12-V16 PolarHBondContact O-N 3.44Å
13	E	92.3	Very high	92.1	Very high	132 Å²	132	103.8 Å²	103.8	62%	0.617	57%	0.568	S	S	*	*	H	α-helix	trans	-58.3	-43.2	175.4	-74.9	171.8	-173.8	0	111.7	S9 V15 V16 A17	S9-E13 WeakPolarHBondContact O-CG 3.3Å; S9-E13 PolarHBondContact O-N 3.39Å; E13-V15 PolarHBondContact O-N 3.28Å; E13-V16 PolarHBondContact O-N 2.85Å; E13-A17 VanDerWaalsContact O-CB 3.31Å; E13-A17 WeakPolarHBondContact O-CB 3.37Å; E13-A17 PolarHBondContact O-N 3.49Å
14	G	91.9	Very high	91.9	Very high	42 Å²	42	103.9 Å²	103.9	43%	0.433	56%	0.56	S	S	.	*	H	α-helix	trans	-61.3	-41.9	175.7	0	0	0	0	113.3	K10 A11 K12 A18	K10-G14 PolarHBondContact O-N 2.89Å; A11-G14 PolarHBondContact O-N 2.9Å; K12-G14 VanDerWaalsContact C-N 3.32Å; K12-G14 PolarHBondContact O-N 2.85Å; G14-A18 WeakPolarHBondContact O-CB 3.48Å; G14-A18 PolarHBondContact O-N 3.37Å
15	V	94.9	Very high	91.6	Very high	104 Å²	104	98.6 Å²	98.6	63%	0.63	55%	0.547	S	S	*	.	H	α-helix	trans	-65.1	-44.7	176.4	172.7	0	0	0	111.2	A11 K12 E13 A18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.39Å; A11-V15 PolarHBondContact O-N 3.48Å; K12-V15 PolarHBondContact O-N 3.39Å; E13-V15 PolarHBondContact O-N 3.28Å; V15-A18 PolarHBondContact O-N 2.94Å; V15-A19 WeakPolarHBondContact O-CB 3.29Å; V15-A19 PolarHBondContact O-N 2.94Å
16	V	93.6	Very high	91.5	Very high	67 Å²	67	98.2 Å²	98.2	41%	0.406	55%	0.551	S	S	.	*	H	α-helix	trans	-63.4	-47.9	177.8	173.5	0	0	0	110.6	K12 E13 A18 A19 E20	K12-V16 WeakPolarHBondContact O-CG2 3.34Å; K12-V16 PolarHBondContact O-N 3.44Å; E13-V16 PolarHBondContact O-N 2.85Å; V16-A18 VanDerWaalsContact C-N 3.32Å; V16-A18 PolarHBondContact O-N 3.35Å; V16-A19 PolarHBondContact O-N 3.37Å; V16-E20 HydrophobicContact CG1-CG 4.3Å; V16-E20 WeakPolarHBondContact O-CB 3.4Å; V16-E20 WeakPolarHBondContact O-CG 3.17Å; V16-E20 PolarHBondContact O-N 2.92Å
17	A	91	Very high	91.2	Very high	56 Å²	56	93.3 Å²	93.3	46%	0.463	54%	0.541	S	S	.	.	H	α-helix	trans	-61.3	-39.4	178.7	0	0	0	0	112.4	E13 K21	E13-A17 VanDerWaalsContact O-CB 3.31Å; E13-A17 WeakPolarHBondContact O-CB 3.37Å; E13-A17 PolarHBondContact O-N 3.49Å; A17-K21 VanDerWaalsContact O-CB 3.29Å; A17-K21 WeakPolarHBondContact O-CB 3.22Å; A17-K21 PolarHBondContact O-N 2.86Å
18	A	91.9	Very high	90.7	Very high	55 Å²	55	95.9 Å²	95.9	46%	0.455	54%	0.543	S	S	.	.	H	α-helix	trans	-65.2	-46.2	174.5	0	0	0	0	111.6	G14 V15 V16 E20 K21 T22	G14-A18 WeakPolarHBondContact O-CB 3.48Å; G14-A18 PolarHBondContact O-N 3.37Å; V15-A18 PolarHBondContact O-N 2.94Å; V16-A18 VanDerWaalsContact C-N 3.32Å; V16-A18 PolarHBondContact O-N 3.35Å; A18-E20 VanDerWaalsContact C-N 3.34Å; A18-E20 PolarHBondContact O-N 2.86Å; A18-K21 PolarHBondContact O-N 3.29Å; A18-T22 WeakPolarHBondContact O-CG2 3.38Å; A18-T22 PolarHBondContact O-N 3.38Å; A18-T22 PolarHBondContact O-OG1 3.46Å
19	A	92.6	Very high	90.3	Very high	54 Å²	54	93.8 Å²	93.8	45%	0.446	54%	0.539	S	S	.	.	H	α-helix	trans	-64.2	-36.5	177.8	0	0	0	0	112.7	V15 V16 T22 K23	V15-A19 WeakPolarHBondContact O-CB 3.29Å; V15-A19 PolarHBondContact O-N 2.94Å; V16-A19 PolarHBondContact O-N 3.37Å; A19-T22 WeakPolarHBondContact CA-OG1 3.49Å; A19-T22 PolarHBondContact O-OG1 3.11Å; A19-K23 VanDerWaalsContact O-CB 3.28Å; A19-K23 WeakPolarHBondContact O-CB 3.38Å; A19-K23 PolarHBondContact O-N 3.02Å
20	E	90.3	Very high	89.8	Confident	124 Å²	124	93.8 Å²	93.8	58%	0.579	54%	0.544	S	S	*	.	H	α-helix	trans	-69.3	-44.8	174.8	-75.9	-176.3	175.4	0	111.7	V16 A18 T22 K23 Q24	V16-E20 HydrophobicContact CG1-CG 4.3Å; V16-E20 WeakPolarHBondContact O-CB 3.4Å; V16-E20 WeakPolarHBondContact O-CG 3.17Å; V16-E20 PolarHBondContact O-N 2.92Å; A18-E20 VanDerWaalsContact C-N 3.34Å; A18-E20 PolarHBondContact O-N 2.86Å; E20-T22 VanDerWaalsContact C-N 3.3Å; E20-T22 PolarHBondContact O-N 2.83Å; E20-K23 PolarHBondContact O-N 3.08Å; E20-Q24 WeakPolarHBondContact O-CB 3.4Å; E20-Q24 PolarHBondContact O-N 3.46Å
21	K	92.5	Very high	89.2	Confident	163 Å²	163	88.8 Å²	88.8	71%	0.709	54%	0.537	S	S	*	.	H	α-helix	trans	-59.7	-40.6	176	-176.5	174.1	-179	177.4	111.7	A17 A18 G25	A17-K21 VanDerWaalsContact O-CB 3.29Å; A17-K21 WeakPolarHBondContact O-CB 3.22Å; A17-K21 PolarHBondContact O-N 2.86Å; A18-K21 PolarHBondContact O-N 3.29Å; K21-G25 PolarHBondContact O-N 2.97Å
22	T	90.3	Very high	88.6	Confident	90 Å²	90	93 Å²	93	55%	0.552	55%	0.545	S	S	*	.	H	α-helix	trans	-69.7	-43.5	175.4	56.7	0	0	0	111.9	A18 A19 E20 Q24 G25 V26	A18-T22 WeakPolarHBondContact O-CG2 3.38Å; A18-T22 PolarHBondContact O-N 3.38Å; A18-T22 PolarHBondContact O-OG1 3.46Å; A19-T22 WeakPolarHBondContact CA-OG1 3.49Å; A19-T22 PolarHBondContact O-OG1 3.11Å; E20-T22 VanDerWaalsContact C-N 3.3Å; E20-T22 PolarHBondContact O-N 2.83Å; T22-Q24 VanDerWaalsContact C-N 3.32Å; T22-Q24 PolarHBondContact O-N 3.42Å; T22-G25 PolarHBondContact O-N 3.15Å; T22-V26 WeakPolarHBondContact O-CB 3.41Å; T22-V26 VanDerWaalsContact O-CG2 3.26Å; T22-V26 WeakPolarHBondContact O-CG2 3.38Å; T22-V26 PolarHBondContact O-N 2.95Å
23	K	89.2	Confident	87.8	Confident	164 Å²	164	89.7 Å²	89.7	71%	0.713	54%	0.537	S	S	*	.	H	α-helix	trans	-57.7	-44.4	175.2	-175.5	-179.2	178.4	-175.9	111.8	A19 E20 A27	A19-K23 VanDerWaalsContact O-CB 3.28Å; A19-K23 WeakPolarHBondContact O-CB 3.38Å; A19-K23 PolarHBondContact O-N 3.02Å; E20-K23 PolarHBondContact O-N 3.08Å; K23-A27 VanDerWaalsContact O-CB 3.25Å; K23-A27 WeakPolarHBondContact O-CB 3.49Å; K23-A27 PolarHBondContact O-N 3.2Å
24	Q	87.8	Confident	86.3	Confident	132 Å²	132	91.4 Å²	91.4	62%	0.617	54%	0.542	S	S	*	.	H	α-helix	trans	-65.5	-46.7	177.4	-174.2	179.1	1.8	0	111.5	E20 T22 V26 A27 E28	E20-Q24 WeakPolarHBondContact O-CB 3.4Å; E20-Q24 PolarHBondContact O-N 3.46Å; T22-Q24 VanDerWaalsContact C-N 3.32Å; T22-Q24 PolarHBondContact O-N 3.42Å; Q24-V26 PolarHBondContact O-N 3.03Å; Q24-A27 PolarHBondContact O-N 2.64Å; Q24-E28 WeakPolarHBondContact O-CB 3.5Å; Q24-E28 PolarHBondContact O-N 3.28Å
25	G	87.2	Confident	84.7	Confident	37 Å²	37	98 Å²	98	38%	0.381	56%	0.562	S	S	.	*	H	α-helix	trans	-61.8	-41.8	178.8	0	0	0	0	112.9	K21 T22 A29	K21-G25 PolarHBondContact O-N 2.97Å; T22-G25 PolarHBondContact O-N 3.15Å; G25-A29 WeakPolarHBondContact O-CB 3.24Å; G25-A29 PolarHBondContact O-N 2.95Å
26	V	90.1	Very high	83.1	Confident	104 Å²	104	95 Å²	95	63%	0.63	55%	0.552	S	S	*	*	H	α-helix	trans	-66	-44.2	175.6	172.8	0	0	0	111	T22 Q24 A29 A30	T22-V26 WeakPolarHBondContact O-CB 3.41Å; T22-V26 VanDerWaalsContact O-CG2 3.26Å; T22-V26 WeakPolarHBondContact O-CG2 3.38Å; T22-V26 PolarHBondContact O-N 2.95Å; Q24-V26 PolarHBondContact O-N 3.03Å; V26-A29 PolarHBondContact O-N 2.98Å; V26-A30 WeakPolarHBondContact O-CB 3.47Å; V26-A30 PolarHBondContact O-N 3.19Å
27	A	85.7	Confident	81.2	Confident	64 Å²	64	96.9 Å²	96.9	53%	0.529	56%	0.564	S	S	.	*	H	α-helix	trans	-64.7	-40.7	178.2	0	0	0	0	112.4	K23 Q24 A30 G31	K23-A27 VanDerWaalsContact O-CB 3.25Å; K23-A27 WeakPolarHBondContact O-CB 3.49Å; K23-A27 PolarHBondContact O-N 3.2Å; Q24-A27 PolarHBondContact O-N 2.64Å; A27-A30 PolarHBondContact O-N 2.92Å; A27-G31 PolarHBondContact O-N 3.4Å
28	E	83.5	Confident	79.7	Confident	94 Å²	94	101.5 Å²	101.5	44%	0.439	58%	0.58	S	S	.	*	H	α-helix	trans	-67	-42.4	177.7	-169.9	-177.4	162	0	111.7	Q24 G31 K32	Q24-E28 WeakPolarHBondContact O-CB 3.5Å; Q24-E28 PolarHBondContact O-N 3.28Å; E28-G31 PolarHBondContact O-N 2.87Å; E28-K32 HydrophobicContact CG-CD 4.12Å; E28-K32 WeakPolarHBondContact O-CB 3.41Å; E28-K32 WeakPolarHBondContact O-CG 3.4Å; E28-K32 PolarHBondContact O-N 3.3Å; E28-K32 WeakPolarHBondContact OE1-CE 3.35Å; E28-K32 IonicContact OE1-NZ 2.62Å; E28-K32 PolarHBondContact OE1-NZ 3.29Å
29	A	83.4	Confident	78.1	Confident	55 Å²	55	107.8 Å²	107.8	46%	0.455	59%	0.593	S	S	.	*	H	α-helix	trans	-62.6	-42.9	174.3	0	0	0	0	111.9	G25 V26 G31 K32 T33	G25-A29 WeakPolarHBondContact O-CB 3.24Å; G25-A29 PolarHBondContact O-N 2.95Å; V26-A29 PolarHBondContact O-N 2.98Å; A29-G31 PolarHBondContact O-N 2.87Å; A29-K32 PolarHBondContact O-N 3.01Å; A29-T33 PolarHBondContact O-N 3.25Å; A29-T33 PolarHBondContact O-OG1 2.87Å
30	A	82.2	Confident	76.7	Confident	65 Å²	65	108.9 Å²	108.9	54%	0.537	59%	0.594	S	S	.	*	H	α-helix	trans	-62.4	-41.2	176	0	0	0	0	111.9	V26 A27	V26-A30 WeakPolarHBondContact O-CB 3.47Å; V26-A30 PolarHBondContact O-N 3.19Å; A27-A30 PolarHBondContact O-N 2.92Å
31	G	79.3	Confident	75.3	Confident	53 Å²	53	104.7 Å²	104.7	55%	0.546	58%	0.584	S	S	.	*	H	α-helix	trans	-74	-33.7	178.5	0	0	0	0	114.6	A27 E28 A29 T33	A27-G31 PolarHBondContact O-N 3.4Å; E28-G31 PolarHBondContact O-N 2.87Å; A29-G31 PolarHBondContact O-N 2.87Å; G31-T33 VanDerWaalsContact C-N 3.26Å; G31-T33 PolarHBondContact O-N 3.03Å
32	K	79.9	Confident	73.9	Confident	147 Å²	147	101.9 Å²	101.9	64%	0.639	59%	0.585	S	S	*	*	H	α-helix	trans	-69.6	-25.7	174.9	-78.5	177.6	170.6	172.6	112.2	E28 A29 K34	E28-K32 HydrophobicContact CG-CD 4.12Å; E28-K32 WeakPolarHBondContact O-CB 3.41Å; E28-K32 WeakPolarHBondContact O-CG 3.4Å; E28-K32 PolarHBondContact O-N 3.3Å; E28-K32 WeakPolarHBondContact OE1-CE 3.35Å; E28-K32 IonicContact OE1-NZ 2.62Å; E28-K32 PolarHBondContact OE1-NZ 3.29Å; A29-K32 PolarHBondContact O-N 3.01Å; K32-K34 PolarHBondContact O-N 3.14Å
33	T	73.9	Confident	72.6	Confident	81 Å²	81	106.1 Å²	106.1	50%	0.497	60%	0.596	S	S	.	*			trans	-77.3	67.3	176.2	-50	0	0	0	111	A29 G31 E35	A29-T33 PolarHBondContact O-N 3.25Å; A29-T33 PolarHBondContact O-OG1 2.87Å; G31-T33 VanDerWaalsContact C-N 3.26Å; G31-T33 PolarHBondContact O-N 3.03Å; T33-E35 PolarHBondContact O-N 2.94Å
34	K	62.1	Low	71.7	Confident	169 Å²	169	101.3 Å²	101.3	74%	0.735	58%	0.58	S	S	*	*	H	α-helix	trans	-66.9	-15.7	176.9	-68.6	-176.2	177.9	-179.5	113.5	K32	K32-K34 PolarHBondContact O-N 3.14Å
35	E	58.1	Low	70.8	Confident	179 Å²	179	102.2 Å²	102.2	84%	0.836	58%	0.582	S	S	*	*	H	α-helix	trans	-79.2	-32.8	-175.2	-116.3	173.2	171.4	0	113.9	T33	T33-E35 PolarHBondContact O-N 2.94Å
36	G	60	Low	69.9	Low	42 Å²	42	108.3 Å²	108.3	43%	0.433	60%	0.601	S	S	.	*	H	α-helix	trans	-78.7	-27	-178.6	0	0	0	0	114.4
37	V	55.4	Low	69.2	Low	106 Å²	106	105.9 Å²	105.9	64%	0.642	60%	0.596	S	S	*	*	H	α-helix	trans	-87.8	-30.7	-164.5	-175.6	0	0	0	113.2
38	L	59.1	Low	69	Low	153 Å²	153	106.3 Å²	106.3	80%	0.801	59%	0.592	S	S	*	*	H	α-helix	trans	-77.7	-30.5	179	-92.4	149.7	0	0	113.4
39	Y	58.8	Low	68.7	Low	187 Å²	187	106.5 Å²	106.5	73%	0.733	60%	0.599	S	S	*	*	H	α-helix	trans	-88.8	-37.1	-170.1	-171.2	-104.5	0	0	114.2
40	V	61.3	Low	68.4	Low	77 Å²	77	110.5 Å²	110.5	47%	0.467	61%	0.608	S	S	.	*	H	α-helix	trans	-102.3	-27.2	-175.2	-177.1	0	0	0	112.1	S42 K43 T44	V40-S42 PolarHBondContact O-N 2.89Å; V40-K43 PolarHBondContact O-N 3.4Å; V40-T44 WeakPolarHBondContact CG1-OG1 3.47Å; V40-T44 WeakPolarHBondContact O-CB 3.36Å; V40-T44 PolarHBondContact O-N 3.35Å; V40-T44 PolarHBondContact O-OG1 2.91Å
41	G	61.6	Low	68.3	Low	36 Å²	36	108.8 Å²	108.8	37%	0.371	60%	0.597	S	S	.	*	H	α-helix	trans	-54.9	-47.1	-173.3	0	0	0	0	113.9	K45	G41-K45 VanDerWaalsContact O-CB 3.23Å; G41-K45 WeakPolarHBondContact O-CB 3.23Å; G41-K45 PolarHBondContact O-N 3.16Å
42	S	63.2	Low	68.6	Low	104 Å²	104	110.3 Å²	110.3	73%	0.727	60%	0.596	S	S	*	*	H	α-helix	trans	-71.3	-35.9	-177.1	-54.9	0	0	0	113.5	V40	V40-S42 PolarHBondContact O-N 2.89Å
43	K	63.7	Low	68.7	Low	180 Å²	180	105.9 Å²	105.9	78%	0.783	59%	0.587	S	S	*	*	H	α-helix	trans	-75.4	-30.7	179.6	-73.4	-170.3	176.7	-177.2	112.8	V40	V40-K43 PolarHBondContact O-N 3.4Å
44	T	70.1	Confident	69.1	Low	62 Å²	62	104.7 Å²	104.7	38%	0.38	58%	0.579	S	S	.	*	H	α-helix	trans	-98.7	-14.4	-173.3	-56.4	0	0	0	112.3	V40 E46 G47 V48	V40-T44 WeakPolarHBondContact CG1-OG1 3.47Å; V40-T44 WeakPolarHBondContact O-CB 3.36Å; V40-T44 PolarHBondContact O-N 3.35Å; V40-T44 PolarHBondContact O-OG1 2.91Å; T44-E46 PolarHBondContact O-N 2.87Å; T44-G47 PolarHBondContact O-N 3.47Å; T44-V48 HydrophobicContact CG2-CG2 3.47Å; T44-V48 VanDerWaalsContact CG2-CG2 3.47Å; T44-V48 WeakPolarHBondContact O-CB 3.31Å; T44-V48 VanDerWaalsContact O-CG2 3.26Å; T44-V48 WeakPolarHBondContact O-CG2 3.34Å; T44-V48 PolarHBondContact O-N 3.38Å
45	K	68.6	Low	70.4	Confident	151 Å²	151	100.6 Å²	100.6	66%	0.657	57%	0.568	S	S	*	*	H	α-helix	trans	-55.6	-46.9	-180	-172.5	173.9	-177.2	-177.3	113	G41 V48 V49	G41-K45 VanDerWaalsContact O-CB 3.23Å; G41-K45 WeakPolarHBondContact O-CB 3.23Å; G41-K45 PolarHBondContact O-N 3.16Å; K45-V48 PolarHBondContact O-N 3.27Å; K45-V49 VanDerWaalsContact O-CG2 3.27Å; K45-V49 WeakPolarHBondContact O-CG2 3.34Å; K45-V49 PolarHBondContact O-N 2.89Å
46	E	68.8	Low	71.6	Confident	166 Å²	166	94.8 Å²	94.8	78%	0.776	55%	0.551	S	S	*	*	H	α-helix	trans	-68	-44	179.8	-67.1	-178.5	173.4	0	112	T44 V48 V49 H50	T44-E46 PolarHBondContact O-N 2.87Å; E46-V48 VanDerWaalsContact C-N 3.33Å; E46-V48 PolarHBondContact O-N 3.18Å; E46-V49 PolarHBondContact O-N 3.48Å; E46-H50 PolarHBondContact O-N 2.98Å
47	G	74.9	Confident	72.8	Confident	52 Å²	52	99.6 Å²	99.6	54%	0.536	56%	0.562	S	S	.	*	H	α-helix	trans	-64.2	-36	176	0	0	0	0	113.3	T44 G51	T44-G47 PolarHBondContact O-N 3.47Å; G47-G51 PolarHBondContact O-N 3.24Å
48	V	80.6	Confident	74.3	Confident	74 Å²	74	100.7 Å²	100.7	45%	0.448	56%	0.558	S	S	.	*	H	α-helix	trans	-70.4	-39.5	175.4	168.5	0	0	0	111	T44 K45 E46 H50 G51 V52	T44-V48 HydrophobicContact CG2-CG2 3.47Å; T44-V48 VanDerWaalsContact CG2-CG2 3.47Å; T44-V48 WeakPolarHBondContact O-CB 3.31Å; T44-V48 VanDerWaalsContact O-CG2 3.26Å; T44-V48 WeakPolarHBondContact O-CG2 3.34Å; T44-V48 PolarHBondContact O-N 3.38Å; K45-V48 PolarHBondContact O-N 3.27Å; E46-V48 VanDerWaalsContact C-N 3.33Å; E46-V48 PolarHBondContact O-N 3.18Å; V48-H50 VanDerWaalsContact C-N 3.31Å; V48-H50 PolarHBondContact O-N 2.93Å; V48-G51 CarbonylContact O-C 3.56Å; V48-G51 PolarHBondContact O-N 3.36Å; V48-V52 HydrophobicContact CG1-CG2 3.72Å; V48-V52 VanDerWaalsContact O-CB 3.23Å; V48-V52 WeakPolarHBondContact O-CB 3.41Å; V48-V52 WeakPolarHBondContact O-CG2 3.4Å; V48-V52 PolarHBondContact O-N 3.37Å
49	V	77.5	Confident	75.5	Confident	97 Å²	97	96.1 Å²	96.1	59%	0.588	54%	0.536	S	S	*	.	H	α-helix	trans	-60.7	-44.1	177.2	170.1	0	0	0	110.7	K45 E46 V52 A53	K45-V49 VanDerWaalsContact O-CG2 3.27Å; K45-V49 WeakPolarHBondContact O-CG2 3.34Å; K45-V49 PolarHBondContact O-N 2.89Å; E46-V49 PolarHBondContact O-N 3.48Å; V49-V52 PolarHBondContact O-N 3.43Å; V49-A53 PolarHBondContact O-N 3.35Å; V49-A53 VanDerWaalsContact O-N 3.16Å
50	H	77.2	Confident	76.8	Confident	139 Å²	139	94.7 Å²	94.7	64%	0.644	53%	0.534	S	S	*	.	H	α-helix	trans	-64.9	-46	174.4	-170.9	72.1	0	0	111.8	E46 V48 V52 A53 T54	E46-H50 PolarHBondContact O-N 2.98Å; V48-H50 VanDerWaalsContact C-N 3.31Å; V48-H50 PolarHBondContact O-N 2.93Å; H50-V52 VanDerWaalsContact C-N 3.31Å; H50-V52 PolarHBondContact O-N 2.99Å; H50-A53 WeakPolarHBondContact O-CB 3.35Å; H50-A53 PolarHBondContact O-N 2.95Å; H50-T54 PolarHBondContact O-N 3.23Å; H50-T54 PolarHBondContact O-OG1 2.85Å
51	G	81.2	Confident	77.8	Confident	29 Å²	29	97.6 Å²	97.6	30%	0.299	54%	0.543	S	S	.	.	H	α-helix	trans	-60.7	-37.7	176.8	0	0	0	0	113.2	G47 V48 T54 V55	G47-G51 PolarHBondContact O-N 3.24Å; V48-G51 CarbonylContact O-C 3.56Å; V48-G51 PolarHBondContact O-N 3.36Å; G51-T54 PolarHBondContact O-N 3.44Å; G51-V55 WeakPolarHBondContact O-CB 3.36Å; G51-V55 WeakPolarHBondContact O-CG2 3.29Å; G51-V55 PolarHBondContact O-N 3.49Å
52	V	84.5	Confident	78.7	Confident	85 Å²	85	101.8 Å²	101.8	52%	0.515	55%	0.552	S	S	.	*	H	α-helix	trans	-68	-35.3	178	167.4	0	0	0	110.8	V48 V49 H50 V55 A56	V48-V52 HydrophobicContact CG1-CG2 3.72Å; V48-V52 VanDerWaalsContact O-CB 3.23Å; V48-V52 WeakPolarHBondContact O-CB 3.41Å; V48-V52 WeakPolarHBondContact O-CG2 3.4Å; V48-V52 PolarHBondContact O-N 3.37Å; V49-V52 PolarHBondContact O-N 3.43Å; H50-V52 VanDerWaalsContact C-N 3.31Å; H50-V52 PolarHBondContact O-N 2.99Å; V52-V55 PolarHBondContact O-N 2.95Å; V52-A56 WeakPolarHBondContact O-CB 3.28Å; V52-A56 PolarHBondContact O-N 2.86Å
53	A	82.2	Confident	79.7	Confident	55 Å²	55	101.1 Å²	101.1	46%	0.455	54%	0.544	S	S	.	.	H	α-helix	trans	-62.9	-49	173	0	0	0	0	111.3	V49 H50 V55 A56 E57	V49-A53 PolarHBondContact O-N 3.35Å; V49-A53 VanDerWaalsContact O-N 3.16Å; H50-A53 WeakPolarHBondContact O-CB 3.35Å; H50-A53 PolarHBondContact O-N 2.95Å; A53-V55 PolarHBondContact O-N 2.92Å; A53-A56 WeakPolarHBondContact O-CB 3.43Å; A53-A56 PolarHBondContact O-N 3Å; A53-E57 PolarHBondContact O-N 3.48Å; A53-E57 VanDerWaalsContact O-N 3.14Å
54	T	82.9	Confident	80.8	Confident	56 Å²	56	97.1 Å²	97.1	34%	0.344	54%	0.535	S	S	.	.	H	α-helix	trans	-62.7	-41.3	176	-54.1	0	0	0	112.4	H50 G51 E57 K58	H50-T54 PolarHBondContact O-N 3.23Å; H50-T54 PolarHBondContact O-OG1 2.85Å; G51-T54 PolarHBondContact O-N 3.44Å; T54-E57 PolarHBondContact O-N 3.31Å; T54-K58 WeakPolarHBondContact O-CG 3.48Å; T54-K58 PolarHBondContact O-N 2.9Å; T54-K58 VanDerWaalsContact O-N 3.15Å
55	V	88.7	Confident	81.5	Confident	83 Å²	83	99.8 Å²	99.8	50%	0.503	55%	0.547	S	S	.	.	H	α-helix	trans	-65.6	-40.9	176	169.5	0	0	0	109.9	G51 V52 A53 E57 K58 T59	G51-V55 WeakPolarHBondContact O-CB 3.36Å; G51-V55 WeakPolarHBondContact O-CG2 3.29Å; G51-V55 PolarHBondContact O-N 3.49Å; V52-V55 PolarHBondContact O-N 2.95Å; A53-V55 PolarHBondContact O-N 2.92Å; V55-E57 VanDerWaalsContact C-N 3.31Å; V55-E57 PolarHBondContact O-N 3.35Å; V55-K58 CarbonylContact O-C 3.59Å; V55-K58 PolarHBondContact O-N 2.92Å; V55-T59 WeakPolarHBondContact O-CA 3.43Å; V55-T59 WeakPolarHBondContact O-CB 3.46Å; V55-T59 PolarHBondContact O-N 3.44Å; V55-T59 PolarHBondContact O-OG1 2.99Å
56	A	82.8	Confident	82.5	Confident	56 Å²	56	96.8 Å²	96.8	46%	0.463	54%	0.541	S	S	.	.	H	α-helix	trans	-60	-40.8	178.7	0	0	0	0	111.9	V52 A53 T59 K60	V52-A56 WeakPolarHBondContact O-CB 3.28Å; V52-A56 PolarHBondContact O-N 2.86Å; A53-A56 WeakPolarHBondContact O-CB 3.43Å; A53-A56 PolarHBondContact O-N 3Å; A56-T59 PolarHBondContact O-N 3.45Å; A56-K60 PolarHBondContact O-N 3.23Å
57	E	85.4	Confident	83.3	Confident	143 Å²	143	90.5 Å²	90.5	67%	0.668	52%	0.52	S	S	*	.	H	α-helix	trans	-62.2	-50.5	173.4	-70.3	-176.6	161.6	0	111.7	A53 T54 V55 T59 K60 E61	A53-E57 PolarHBondContact O-N 3.48Å; A53-E57 VanDerWaalsContact O-N 3.14Å; T54-E57 PolarHBondContact O-N 3.31Å; V55-E57 VanDerWaalsContact C-N 3.31Å; V55-E57 PolarHBondContact O-N 3.35Å; E57-T59 VanDerWaalsContact C-N 3.3Å; E57-T59 PolarHBondContact O-N 2.9Å; E57-K60 WeakPolarHBondContact O-CB 3.26Å; E57-K60 PolarHBondContact O-N 2.94Å; E57-E61 PolarHBondContact O-N 3.2Å
58	K	88	Confident	83.9	Confident	129 Å²	129	89.8 Å²	89.8	56%	0.561	51%	0.513	S	S	*	.	H	α-helix	trans	-62.2	-37.2	176.3	-68.4	-178.1	179.8	-174.8	112.7	T54 V55 K60 E61 Q62	T54-K58 WeakPolarHBondContact O-CG 3.48Å; T54-K58 PolarHBondContact O-N 2.9Å; T54-K58 VanDerWaalsContact O-N 3.15Å; V55-K58 CarbonylContact O-C 3.59Å; V55-K58 PolarHBondContact O-N 2.92Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K58-E61 PolarHBondContact O-N 3.03Å; K58-Q62 WeakPolarHBondContact O-CG 3.47Å; K58-Q62 PolarHBondContact O-N 3.41Å
59	T	84.7	Confident	84.3	Confident	57 Å²	57	89 Å²	89	35%	0.35	52%	0.515	S	S	.	.	H	α-helix	trans	-67.4	-35.7	177.7	-65.6	0	0	0	110.2	V55 A56 E57 E61 Q62 V63	V55-T59 WeakPolarHBondContact O-CA 3.43Å; V55-T59 WeakPolarHBondContact O-CB 3.46Å; V55-T59 PolarHBondContact O-N 3.44Å; V55-T59 PolarHBondContact O-OG1 2.99Å; A56-T59 PolarHBondContact O-N 3.45Å; E57-T59 VanDerWaalsContact C-N 3.3Å; E57-T59 PolarHBondContact O-N 2.9Å; T59-E61 VanDerWaalsContact C-N 3.34Å; T59-E61 PolarHBondContact O-N 3.3Å; T59-Q62 CarbonylContact O-C 3.56Å; T59-Q62 PolarHBondContact O-N 3.38Å; T59-V63 HydrophobicContact CG2-CG2 3.79Å; T59-V63 VanDerWaalsContact O-CB 3.28Å; T59-V63 WeakPolarHBondContact O-CB 3.41Å; T59-V63 WeakPolarHBondContact O-CG2 3.31Å; T59-V63 PolarHBondContact O-N 2.83Å
60	K	84.9	Confident	85	Confident	157 Å²	157	88.6 Å²	88.6	68%	0.683	51%	0.512	S	S	*	.	H	α-helix	trans	-60	-44.2	174.5	-171.9	-178	179.8	-177.5	111.7	A56 E57 K58 T64	A56-K60 PolarHBondContact O-N 3.23Å; E57-K60 WeakPolarHBondContact O-CB 3.26Å; E57-K60 PolarHBondContact O-N 2.94Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K60-T64 WeakPolarHBondContact O-CB 3.23Å; K60-T64 PolarHBondContact O-N 2.92Å; K60-T64 PolarHBondContact O-OG1 2.9Å
61	E	83.3	Confident	85.5	Confident	138 Å²	138	86.3 Å²	86.3	65%	0.645	51%	0.508	S	S	*	.	H	α-helix	trans	-63.4	-45.6	174.5	-65.1	-179.1	169.5	0	111.3	E57 K58 T59 T64 N65	E57-E61 PolarHBondContact O-N 3.2Å; K58-E61 PolarHBondContact O-N 3.03Å; T59-E61 VanDerWaalsContact C-N 3.34Å; T59-E61 PolarHBondContact O-N 3.3Å; E61-T64 WeakPolarHBondContact O-CB 3.38Å; E61-T64 PolarHBondContact O-N 3.38Å; E61-N65 PolarHBondContact O-N 3.3Å
62	Q	80.7	Confident	86	Confident	124 Å²	124	89.4 Å²	89.4	58%	0.579	52%	0.521	S	S	*	.	H	α-helix	trans	-63.5	-43.3	176.9	-72.6	-174.1	-3.7	0	112.9	K58 T59 T64 N65 V66	K58-Q62 WeakPolarHBondContact O-CG 3.47Å; K58-Q62 PolarHBondContact O-N 3.41Å; T59-Q62 CarbonylContact O-C 3.56Å; T59-Q62 PolarHBondContact O-N 3.38Å; Q62-T64 PolarHBondContact O-N 2.77Å; Q62-N65 WeakPolarHBondContact O-CB 3.28Å; Q62-N65 PolarHBondContact O-N 3.29Å; Q62-N65 VanDerWaalsContact O-N 3.15Å; Q62-V66 WeakPolarHBondContact O-CB 3.33Å; Q62-V66 VanDerWaalsContact O-CG2 3.23Å; Q62-V66 WeakPolarHBondContact O-CG2 3.18Å; Q62-V66 PolarHBondContact O-N 3.32Å
63	V	83.9	Confident	86.3	Confident	91 Å²	91	86.9 Å²	86.9	55%	0.552	51%	0.512	S	S	*	.	H	α-helix	trans	-62.6	-35.1	177.3	168	0	0	0	110.4	T59 G67	T59-V63 HydrophobicContact CG2-CG2 3.79Å; T59-V63 VanDerWaalsContact O-CB 3.28Å; T59-V63 WeakPolarHBondContact O-CB 3.41Å; T59-V63 WeakPolarHBondContact O-CG2 3.31Å; T59-V63 PolarHBondContact O-N 2.83Å; V63-G67 WeakPolarHBondContact O-CA 3.42Å; V63-G67 PolarHBondContact O-N 2.81Å
64	T	85.2	Confident	86.7	Confident	95 Å²	95	88.9 Å²	88.9	58%	0.583	52%	0.518	S	S	*	.	H	α-helix	trans	-65.9	-45.6	173.8	-55.2	0	0	0	110.8	K60 E61 Q62 G67 G68	K60-T64 WeakPolarHBondContact O-CB 3.23Å; K60-T64 PolarHBondContact O-N 2.92Å; K60-T64 PolarHBondContact O-OG1 2.9Å; E61-T64 WeakPolarHBondContact O-CB 3.38Å; E61-T64 PolarHBondContact O-N 3.38Å; Q62-T64 PolarHBondContact O-N 2.77Å; T64-G67 PolarHBondContact O-N 2.81Å; T64-G68 PolarHBondContact O-N 3.48Å
65	N	85.8	Confident	87	Confident	118 Å²	118	89.4 Å²	89.4	63%	0.631	52%	0.522	S	S	*	.	H	α-helix	trans	-63.9	-43.4	176	-69.1	-20.2	0	0	112.5	E61 Q62 G67 G68 A69	E61-N65 PolarHBondContact O-N 3.3Å; Q62-N65 WeakPolarHBondContact O-CB 3.28Å; Q62-N65 PolarHBondContact O-N 3.29Å; Q62-N65 VanDerWaalsContact O-N 3.15Å; N65-G67 VanDerWaalsContact C-N 3.35Å; N65-G68 PolarHBondContact O-N 2.99Å; N65-A69 PolarHBondContact O-N 3.46Å
66	V	89.2	Confident	87.1	Confident	89 Å²	89	87.9 Å²	87.9	54%	0.539	52%	0.518	S	S	.	.	H	α-helix	trans	-63.9	-42.4	175.3	172	0	0	0	110.1	Q62 G68 A69 V70	Q62-V66 WeakPolarHBondContact O-CB 3.33Å; Q62-V66 VanDerWaalsContact O-CG2 3.23Å; Q62-V66 WeakPolarHBondContact O-CG2 3.18Å; Q62-V66 PolarHBondContact O-N 3.32Å; V66-G68 VanDerWaalsContact C-N 3.32Å; V66-G68 PolarHBondContact O-N 3.13Å; V66-A69 CarbonylContact O-C 3.59Å; V66-A69 PolarHBondContact O-N 3.45Å; V66-A69 VanDerWaalsContact O-N 3.13Å; V66-V70 HydrophobicContact CG1-CG2 4.31Å; V66-V70 VanDerWaalsContact O-CG2 3.31Å; V66-V70 WeakPolarHBondContact O-CG2 3.25Å; V66-V70 PolarHBondContact O-N 2.62Å
67	G	86.1	Confident	87.6	Confident	33 Å²	33	89.7 Å²	89.7	34%	0.34	52%	0.523	S	S	.	.	H	α-helix	trans	-57.8	-45.8	174.2	0	0	0	0	111.5	V63 T64 N65 A69 V70 V71	V63-G67 WeakPolarHBondContact O-CA 3.42Å; V63-G67 PolarHBondContact O-N 2.81Å; T64-G67 PolarHBondContact O-N 2.81Å; N65-G67 VanDerWaalsContact C-N 3.35Å; G67-A69 PolarHBondContact O-N 2.91Å; G67-V70 PolarHBondContact O-N 2.75Å; G67-V71 WeakPolarHBondContact O-CG2 3.34Å; G67-V71 PolarHBondContact O-N 2.96Å
68	G	87.6	Confident	87.8	Confident	37 Å²	37	85.4 Å²	85.4	38%	0.381	51%	0.512	S	S	.	.	H	α-helix	trans	-57.8	-46.6	172	0	0	0	0	112.6	T64 N65 V66 V70 V71 T72	T64-G68 PolarHBondContact O-N 3.48Å; N65-G68 PolarHBondContact O-N 2.99Å; V66-G68 VanDerWaalsContact C-N 3.32Å; V66-G68 PolarHBondContact O-N 3.13Å; G68-V70 PolarHBondContact O-N 3.17Å; G68-V71 PolarHBondContact O-N 3.42Å; G68-T72 WeakPolarHBondContact O-CG2 3.39Å; G68-T72 PolarHBondContact O-N 3Å; G68-T72 PolarHBondContact O-OG1 3.34Å
69	A	88.6	Confident	87.9	Confident	59 Å²	59	84.8 Å²	84.8	49%	0.488	51%	0.511	S	S	.	.	H	α-helix	trans	-64.8	-35.6	178.5	0	0	0	0	113.4	N65 V66 G67 T72 G73	N65-A69 PolarHBondContact O-N 3.46Å; V66-A69 CarbonylContact O-C 3.59Å; V66-A69 PolarHBondContact O-N 3.45Å; V66-A69 VanDerWaalsContact O-N 3.13Å; G67-A69 PolarHBondContact O-N 2.91Å; A69-T72 WeakPolarHBondContact CA-OG1 3.16Å; A69-T72 PolarHBondContact O-OG1 2.87Å; A69-G73 PolarHBondContact O-N 2.85Å
70	V	92.1	Very high	88.3	Confident	87 Å²	87	89.6 Å²	89.6	53%	0.527	53%	0.527	S	S	.	.	H	α-helix	trans	-67.2	-45.4	174.7	170.7	0	0	0	109.9	V66 G67 G68 G73 V74	V66-V70 HydrophobicContact CG1-CG2 4.31Å; V66-V70 VanDerWaalsContact O-CG2 3.31Å; V66-V70 WeakPolarHBondContact O-CG2 3.25Å; V66-V70 PolarHBondContact O-N 2.62Å; G67-V70 PolarHBondContact O-N 2.75Å; G68-V70 PolarHBondContact O-N 3.17Å; V70-G73 PolarHBondContact O-N 3.48Å; V70-V74 HydrophobicContact CG1-CG2 4.34Å; V70-V74 WeakPolarHBondContact O-CB 3.36Å; V70-V74 VanDerWaalsContact O-CG2 3.28Å; V70-V74 WeakPolarHBondContact O-CG2 3.36Å; V70-V74 PolarHBondContact O-N 3.48Å
71	V	88.6	Confident	88.6	Confident	92 Å²	92	86.3 Å²	86.3	56%	0.558	52%	0.52	S	S	*	.	H	α-helix	trans	-62.3	-46.9	177.7	172.8	0	0	0	111	G67 G68 G73 V74 T75	G67-V71 WeakPolarHBondContact O-CG2 3.34Å; G67-V71 PolarHBondContact O-N 2.96Å; G68-V71 PolarHBondContact O-N 3.42Å; V71-G73 VanDerWaalsContact C-N 3.32Å; V71-G73 PolarHBondContact O-N 3.29Å; V71-V74 PolarHBondContact O-N 3.33Å; V71-T75 WeakPolarHBondContact O-CB 3.28Å; V71-T75 PolarHBondContact O-N 3.24Å; V71-T75 PolarHBondContact O-OG1 3.47Å
72	T	90.7	Very high	89	Confident	93 Å²	93	85 Å²	85	57%	0.571	52%	0.521	S	S	*	.	H	α-helix	trans	-63.2	-39.9	177.1	56	0	0	0	111.7	G68 A69 T75 A76	G68-T72 WeakPolarHBondContact O-CG2 3.39Å; G68-T72 PolarHBondContact O-N 3Å; G68-T72 PolarHBondContact O-OG1 3.34Å; A69-T72 WeakPolarHBondContact CA-OG1 3.16Å; A69-T72 PolarHBondContact O-OG1 2.87Å; T72-T75 PolarHBondContact O-N 3.5Å; T72-A76 VanDerWaalsContact O-CB 3.23Å; T72-A76 WeakPolarHBondContact O-CB 3.45Å; T72-A76 PolarHBondContact O-N 3.24Å
73	G	90.2	Very high	89.5	Confident	33 Å²	33	85.6 Å²	85.6	34%	0.34	52%	0.524	S	S	.	.	H	α-helix	trans	-61	-48.6	174.6	0	0	0	0	112.6	A69 V70 V71 A76 V77	A69-G73 PolarHBondContact O-N 2.85Å; V70-G73 PolarHBondContact O-N 3.48Å; V71-G73 VanDerWaalsContact C-N 3.32Å; V71-G73 PolarHBondContact O-N 3.29Å; G73-A76 PolarHBondContact O-N 2.96Å; G73-V77 WeakPolarHBondContact O-CB 3.45Å; G73-V77 VanDerWaalsContact O-CG2 3.24Å; G73-V77 WeakPolarHBondContact O-CG2 3.49Å; G73-V77 PolarHBondContact O-N 2.99Å
74	V	91.1	Very high	89.7	Confident	96 Å²	96	82.7 Å²	82.7	58%	0.582	51%	0.513	S	S	*	.	H	α-helix	trans	-62	-46	177.9	170.9	0	0	0	110.8	V70 V71 V77 A78	V70-V74 HydrophobicContact CG1-CG2 4.34Å; V70-V74 WeakPolarHBondContact O-CB 3.36Å; V70-V74 VanDerWaalsContact O-CG2 3.28Å; V70-V74 WeakPolarHBondContact O-CG2 3.36Å; V70-V74 PolarHBondContact O-N 3.48Å; V71-V74 PolarHBondContact O-N 3.33Å; V74-V77 PolarHBondContact O-N 3.25Å; V74-A78 WeakPolarHBondContact O-CB 3.49Å; V74-A78 PolarHBondContact O-N 3.15Å
75	T	90	Very high	89.8	Confident	67 Å²	67	80.9 Å²	80.9	41%	0.411	51%	0.508	S	S	.	.	H	α-helix	trans	-61.1	-47.3	177.1	-61.7	0	0	0	111.5	V71 T72 V77 A78 Q79	V71-T75 WeakPolarHBondContact O-CB 3.28Å; V71-T75 PolarHBondContact O-N 3.24Å; V71-T75 PolarHBondContact O-OG1 3.47Å; T72-T75 PolarHBondContact O-N 3.5Å; T75-V77 PolarHBondContact O-N 3.01Å; T75-A78 PolarHBondContact O-N 3.01Å; T75-Q79 HydrophobicContact CG2-CG 4.42Å; T75-Q79 WeakPolarHBondContact O-CB 3.36Å; T75-Q79 WeakPolarHBondContact O-CG 3.37Å; T75-Q79 PolarHBondContact O-N 3.37Å
76	A	91.2	Very high	89.9	Confident	51 Å²	51	77.2 Å²	77.2	42%	0.421	50%	0.498	S	S	.	.	H	α-helix	trans	-63.5	-41.1	179.3	0	0	0	0	112.2	T72 G73 K80	T72-A76 VanDerWaalsContact O-CB 3.23Å; T72-A76 WeakPolarHBondContact O-CB 3.45Å; T72-A76 PolarHBondContact O-N 3.24Å; G73-A76 PolarHBondContact O-N 2.96Å; A76-K80 WeakPolarHBondContact O-CB 3.19Å; A76-K80 PolarHBondContact O-N 3.26Å
77	V	92.7	Very high	90	Very high	94 Å²	94	76.8 Å²	76.8	57%	0.57	50%	0.499	S	S	*	.	H	α-helix	trans	-64.4	-44	175	170.3	0	0	0	110.7	G73 V74 T75 T81	G73-V77 WeakPolarHBondContact O-CB 3.45Å; G73-V77 VanDerWaalsContact O-CG2 3.24Å; G73-V77 WeakPolarHBondContact O-CG2 3.49Å; G73-V77 PolarHBondContact O-N 2.99Å; V74-V77 PolarHBondContact O-N 3.25Å; T75-V77 PolarHBondContact O-N 3.01Å; V77-T81 VanDerWaalsContact O-CB 3.22Å; V77-T81 WeakPolarHBondContact O-CB 3.33Å; V77-T81 PolarHBondContact O-N 3.02Å; V77-T81 PolarHBondContact O-OG1 3.32Å
78	A	89.5	Confident	90	Very high	53 Å²	53	80.6 Å²	80.6	44%	0.438	51%	0.51	S	S	.	.	H	α-helix	trans	-62.3	-50.1	178.7	0	0	0	0	111.7	V74 T75 T81 V82	V74-A78 WeakPolarHBondContact O-CB 3.49Å; V74-A78 PolarHBondContact O-N 3.15Å; T75-A78 PolarHBondContact O-N 3.01Å; A78-T81 PolarHBondContact O-N 2.76Å; A78-V82 WeakPolarHBondContact O-CG2 3.5Å; A78-V82 PolarHBondContact O-N 3.35Å
79	Q	90.9	Very high	89.9	Confident	117 Å²	117	80.3 Å²	80.3	55%	0.547	50%	0.504	S	S	.	.	H	α-helix	trans	-58.4	-51.5	177.2	-72.7	177.6	-39.7	0	111.4	T75 T81 V82 E83	T75-Q79 HydrophobicContact CG2-CG 4.42Å; T75-Q79 WeakPolarHBondContact O-CB 3.36Å; T75-Q79 WeakPolarHBondContact O-CG 3.37Å; T75-Q79 PolarHBondContact O-N 3.37Å; Q79-T81 VanDerWaalsContact C-N 3.28Å; Q79-T81 PolarHBondContact O-N 2.72Å; Q79-V82 PolarHBondContact O-N 3.4Å; Q79-E83 WeakPolarHBondContact O-CG 3.2Å; Q79-E83 PolarHBondContact O-N 3.26Å
80	K	92.9	Very high	89.8	Confident	158 Å²	158	80.5 Å²	80.5	69%	0.687	51%	0.505	S	S	*	.	H	α-helix	trans	-63.9	-32.1	179.9	-169.8	174.7	-176.6	178.3	112.8	A76 G84	A76-K80 WeakPolarHBondContact O-CB 3.19Å; A76-K80 PolarHBondContact O-N 3.26Å; K80-G84 PolarHBondContact O-N 2.95Å
81	T	91	Very high	89.5	Confident	88 Å²	88	80.5 Å²	80.5	54%	0.54	52%	0.515	S	S	.	.	H	α-helix	trans	-69.7	-41.9	176.5	-59.4	0	0	0	111.2	V77 A78 Q79 G84 A85	V77-T81 VanDerWaalsContact O-CB 3.22Å; V77-T81 WeakPolarHBondContact O-CB 3.33Å; V77-T81 PolarHBondContact O-N 3.02Å; V77-T81 PolarHBondContact O-OG1 3.32Å; A78-T81 PolarHBondContact O-N 2.76Å; Q79-T81 VanDerWaalsContact C-N 3.28Å; Q79-T81 PolarHBondContact O-N 2.72Å; T81-G84 PolarHBondContact O-N 2.89Å; T81-A85 VanDerWaalsContact O-CB 3.29Å; T81-A85 WeakPolarHBondContact O-CB 3.49Å; T81-A85 PolarHBondContact O-N 3.19Å
82	V	91.1	Very high	89.5	Confident	110 Å²	110	79.8 Å²	79.8	67%	0.667	51%	0.511	S	S	*	.	H	α-helix	trans	-65	-46.4	175.9	173.4	0	0	0	110.8	A78 Q79 G84 A85 G86	A78-V82 WeakPolarHBondContact O-CG2 3.5Å; A78-V82 PolarHBondContact O-N 3.35Å; Q79-V82 PolarHBondContact O-N 3.4Å; V82-G84 PolarHBondContact O-N 3.36Å; V82-A85 PolarHBondContact O-N 3.17Å; V82-G86 PolarHBondContact O-N 3.45Å
83	E	90.1	Very high	89.2	Confident	137 Å²	137	77.5 Å²	77.5	64%	0.64	51%	0.506	S	S	*	.	H	α-helix	trans	-60.6	-44.2	175.3	-71.4	172.4	-167.9	0	111.8	Q79 G86 S87	Q79-E83 WeakPolarHBondContact O-CG 3.2Å; Q79-E83 PolarHBondContact O-N 3.26Å; E83-G86 PolarHBondContact O-N 2.88Å; E83-S87 WeakPolarHBondContact O-CB 3.37Å; E83-S87 PolarHBondContact O-N 3.48Å
84	G	88.7	Confident	89	Confident	30 Å²	30	83.8 Å²	83.8	31%	0.309	52%	0.524	S	S	.	.	H	α-helix	trans	-63.7	-43.7	177.2	0	0	0	0	112.7	K80 T81 V82 S87 I88	K80-G84 PolarHBondContact O-N 2.95Å; T81-G84 PolarHBondContact O-N 2.89Å; V82-G84 PolarHBondContact O-N 3.36Å; G84-S87 PolarHBondContact O-N 2.68Å; G84-I88 VanDerWaalsContact O-CG1 3.26Å; G84-I88 WeakPolarHBondContact O-CG1 3.37Å; G84-I88 PolarHBondContact O-N 3.38Å
85	A	88.2	Confident	88.7	Confident	57 Å²	57	84.5 Å²	84.5	47%	0.471	52%	0.523	S	S	.	.	H	α-helix	trans	-63	-42.6	175.6	0	0	0	0	111.6	T81 V82 I88 A89	T81-A85 VanDerWaalsContact O-CB 3.29Å; T81-A85 WeakPolarHBondContact O-CB 3.49Å; T81-A85 PolarHBondContact O-N 3.19Å; V82-A85 PolarHBondContact O-N 3.17Å; A85-I88 PolarHBondContact O-N 2.92Å; A85-A89 WeakPolarHBondContact O-CB 3.42Å; A85-A89 PolarHBondContact O-N 3.15Å
86	G	87.1	Confident	88.4	Confident	41 Å²	41	91.5 Å²	91.5	42%	0.423	55%	0.548	S	S	.	.	H	α-helix	trans	-62.1	-42.2	173.9	0	0	0	0	112.5	V82 E83 A89 A90	V82-G86 PolarHBondContact O-N 3.45Å; E83-G86 PolarHBondContact O-N 2.88Å; G86-A89 PolarHBondContact O-N 3.38Å; G86-A90 WeakPolarHBondContact O-CB 3.26Å; G86-A90 PolarHBondContact O-N 2.78Å
87	S	90.7	Very high	88	Confident	80 Å²	80	96.4 Å²	96.4	56%	0.559	56%	0.56	S	S	*	*	H	α-helix	trans	-63.3	-41	175.8	-177.8	0	0	0	112.2	E83 G84 A90 A91	E83-S87 WeakPolarHBondContact O-CB 3.37Å; E83-S87 PolarHBondContact O-N 3.48Å; G84-S87 PolarHBondContact O-N 2.68Å; S87-A90 PolarHBondContact O-N 3.29Å; S87-A91 VanDerWaalsContact O-CB 3.29Å; S87-A91 WeakPolarHBondContact O-CB 3.33Å; S87-A91 PolarHBondContact O-N 3.24Å
88	I	87.5	Confident	87.4	Confident	113 Å²	113	99.7 Å²	99.7	58%	0.579	57%	0.574	S	S	*	*	H	α-helix	trans	-63.9	-47.7	174.7	-67.5	162.6	0	0	110.3	G84 A85 A90 A91 T92	G84-I88 VanDerWaalsContact O-CG1 3.26Å; G84-I88 WeakPolarHBondContact O-CG1 3.37Å; G84-I88 PolarHBondContact O-N 3.38Å; A85-I88 PolarHBondContact O-N 2.92Å; I88-A90 VanDerWaalsContact C-N 3.3Å; I88-A90 PolarHBondContact O-N 3.43Å; I88-A91 PolarHBondContact O-N 3.37Å; I88-T92 HydrophobicContact CG2-CG2 4.29Å; I88-T92 WeakPolarHBondContact O-CG2 3.12Å; I88-T92 PolarHBondContact O-N 3.42Å; I88-T92 PolarHBondContact O-OG1 3.16Å; I88-T92 VanDerWaalsContact O-OG1 3.13Å
89	A	85.7	Confident	86.9	Confident	30 Å²	30	103 Å²	103	25%	0.248	58%	0.581	C	S	.	*	H	α-helix	trans	-61.8	-38.1	178.9	0	0	0	0	112.6	A85 G86 T92 G93 F94	A85-A89 WeakPolarHBondContact O-CB 3.42Å; A85-A89 PolarHBondContact O-N 3.15Å; G86-A89 PolarHBondContact O-N 3.38Å; A89-T92 WeakPolarHBondContact CA-OG1 3.23Å; A89-T92 PolarHBondContact O-OG1 3.2Å; A89-T92 VanDerWaalsContact O-OG1 3.1Å; A89-G93 PolarHBondContact O-N 2.75Å; A89-F94 HydrophobicContact CB-CD1 4.4Å; A89-F94 HydrophobicContact CB-CE1 3.83Å; A89-F94 HydrophobicContact CB-CZ 4.12Å; A89-F94 PolarHBondContact O-N 3.45Å
90	A	86.2	Confident	86.2	Confident	63 Å²	63	106.2 Å²	106.2	52%	0.521	60%	0.601	S	S	.	*	H	α-helix	trans	-66.9	-42.4	173.9	0	0	0	0	111.9	G86 S87 I88 G93	G86-A90 WeakPolarHBondContact O-CB 3.26Å; G86-A90 PolarHBondContact O-N 2.78Å; S87-A90 PolarHBondContact O-N 3.29Å; I88-A90 VanDerWaalsContact C-N 3.3Å; I88-A90 PolarHBondContact O-N 3.43Å; A90-G93 PolarHBondContact O-N 3.47Å; A90-G93 VanDerWaalsContact O-N 3.17Å
91	A	86	Confident	85.4	Confident	88 Å²	88	101.8 Å²	101.8	73%	0.727	60%	0.599	S	S	*	*	H	α-helix	trans	-68.8	-34.4	178.7	0	0	0	0	113	S87 I88 G93	S87-A91 VanDerWaalsContact O-CB 3.29Å; S87-A91 WeakPolarHBondContact O-CB 3.33Å; S87-A91 PolarHBondContact O-N 3.24Å; I88-A91 PolarHBondContact O-N 3.37Å; A91-G93 PolarHBondContact O-N 2.89Å
92	T	87.4	Confident	84.9	Confident	77 Å²	77	106.9 Å²	106.9	47%	0.472	61%	0.614	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.5	-3.8	173.5	59.7	0	0	0	112.9	I88 A89 F94 I95	I88-T92 HydrophobicContact CG2-CG2 4.29Å; I88-T92 WeakPolarHBondContact O-CG2 3.12Å; I88-T92 PolarHBondContact O-N 3.42Å; I88-T92 PolarHBondContact O-OG1 3.16Å; I88-T92 VanDerWaalsContact O-OG1 3.13Å; A89-T92 WeakPolarHBondContact CA-OG1 3.23Å; A89-T92 PolarHBondContact O-OG1 3.2Å; A89-T92 VanDerWaalsContact O-OG1 3.1Å; T92-F94 PolarHBondContact O-N 2.69Å; T92-I95 WeakPolarHBondContact O-CD1 3.5Å; T92-I95 VanDerWaalsContact O-CG1 3.28Å; T92-I95 WeakPolarHBondContact O-CG1 3.15Å; T92-I95 PolarHBondContact O-N 3.38Å
93	G	85.3	Confident	84.4	Confident	45 Å²	45	107 Å²	107	46%	0.464	61%	0.611	S	S	.	*	T	Hydrogen-bonded Turn	trans	65.6	22	176.8	0	0	0	0	114.3	A89 A90 A91 I95	A89-G93 PolarHBondContact O-N 2.75Å; A90-G93 PolarHBondContact O-N 3.47Å; A90-G93 VanDerWaalsContact O-N 3.17Å; A91-G93 PolarHBondContact O-N 2.89Å; G93-I95 PolarHBondContact O-N 3.23Å; G93-I95 VanDerWaalsContact O-N 3.16Å
94	F	85.8	Confident	83.7	Confident	164 Å²	164	109.7 Å²	109.7	72%	0.719	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.3	27.8	-175.2	-59.1	-88.8	0	0	114.2	A89 T92	A89-F94 HydrophobicContact CB-CD1 4.4Å; A89-F94 HydrophobicContact CB-CE1 3.83Å; A89-F94 HydrophobicContact CB-CZ 4.12Å; A89-F94 PolarHBondContact O-N 3.45Å; T92-F94 PolarHBondContact O-N 2.69Å
95	I	84.2	Confident	83.2	Confident	112 Å²	112	116.8 Å²	116.8	57%	0.574	65%	0.649	S	S	*	*			trans	-76.9	129.5	-177.4	-58.5	171	0	0	109.9	T92 G93 K97	T92-I95 WeakPolarHBondContact O-CD1 3.5Å; T92-I95 VanDerWaalsContact O-CG1 3.28Å; T92-I95 WeakPolarHBondContact O-CG1 3.15Å; T92-I95 PolarHBondContact O-N 3.38Å; G93-I95 PolarHBondContact O-N 3.23Å; G93-I95 VanDerWaalsContact O-N 3.16Å; I95-K97 WeakPolarHBondContact CG2-O 3.47Å
96	K	84	Confident	83	Confident	214 Å²	214	117.3 Å²	117.3	93%	0.93	66%	0.66	S	S	*	*	S	Bend	trans	-71.7	-34.8	178.9	-68.5	-177	-179	179.6	113.6
97	K	82.6	Confident	82.5	Confident	153 Å²	153	119 Å²	119	67%	0.665	67%	0.67	S	S	*	*	S	Bend	trans	-139.1	123.8	179.9	-71.4	177.7	-179.3	159	108.5	I95 Q99	I95-K97 WeakPolarHBondContact CG2-O 3.47Å; K97-Q99 VanDerWaalsContact C-N 3.34Å; K97-Q99 HydrophobicContact CB-CG 4.23Å; K97-Q99 PolarHBondContact O-N 3.46Å
98	D	80.8	Confident	82	Confident	164 Å²	164	121.9 Å²	121.9	88%	0.877	69%	0.687	S	S	*	*			trans	-68.6	93.1	173	-170.2	14.1	0	0	108.9
99	Q	78.9	Confident	81.9	Confident	122 Å²	122	125.2 Å²	125.2	57%	0.57	70%	0.7	S	S	*	*			trans	-128.6	124.1	177.1	-71.1	-167.4	105.7	0	108.8	K97	K97-Q99 VanDerWaalsContact C-N 3.34Å; K97-Q99 HydrophobicContact CB-CG 4.23Å; K97-Q99 PolarHBondContact O-N 3.46Å
100	L	75.5	Confident	81.9	Confident	185 Å²	185	133.5 Å²	133.5	97%	0.969	73%	0.733	S	S	*	*			trans	-100.8	116.9	173.9	-172.2	66.6	0	0	109.2
101	G	77.4	Confident	81.9	Confident	64 Å²	64	134 Å²	134	66%	0.66	74%	0.744	S	S	*	*	S	Bend	trans	128.1	162.8	-178.4	0	0	0	0	112.3
102	K	79.7	Confident	82	Confident	195 Å²	195	137.5 Å²	137.5	85%	0.848	75%	0.749	S	S	*	*			trans	-84.4	137.3	168.7	-64.4	-179.2	-179.3	179.4	107.5	E104	K102-E104 VanDerWaalsContact C-N 3.32Å; K102-E104 PolarHBondContact O-N 2.79Å
103	N	79.9	Confident	81.9	Confident	114 Å²	114	141.6 Å²	141.6	61%	0.61	77%	0.768	S	S	*	*			trans	-66.4	99.2	163.5	-69.8	-14.7	0	0	106.6	E105	N103-E105 PolarHBondContact O-N 3.48Å; N103-E105 VanDerWaalsContact O-N 3.11Å
104	E	75	Confident	81.9	Confident	193 Å²	193	148.6 Å²	148.6	90%	0.902	79%	0.788	S	S	*	*			trans	-72.5	101.3	170.9	-75.7	-168.8	153.2	0	108.1	K102	K102-E104 VanDerWaalsContact C-N 3.32Å; K102-E104 PolarHBondContact O-N 2.79Å
105	E	80	Confident	82.1	Confident	178 Å²	178	147.5 Å²	147.5	83%	0.832	79%	0.79	S	S	*	*			trans	-94.2	128.5	171.5	-68.7	176.3	-171.5	0	108.8	N103	N103-E105 PolarHBondContact O-N 3.48Å; N103-E105 VanDerWaalsContact O-N 3.11Å
106	G	82.3	Confident	82.1	Confident	69 Å²	69	150.4 Å²	150.4	71%	0.711	80%	0.803	S	S	*	*			trans	-156.8	163.4	178.6	0	0	0	0	110.7
107	A	77.6	Confident	82.4	Confident	77 Å²	77	145.9 Å²	145.9	64%	0.636	80%	0.795	S	S	*	*			trans	67.2	86.8	-172.5	0	0	0	0	114	Q109	A107-Q109 PolarHBondContact O-N 3.47Å
108	P	80.2	Confident	82.7	Confident	139 Å²	139	145.2 Å²	145.2	90%	0.903	80%	0.804	S	S	*	*			trans	-60.7	131.5	173	26.4	-32.9	0	0	110
109	Q	84.6	Confident	82.9	Confident	183 Å²	183	141.8 Å²	141.8	86%	0.855	79%	0.786	S	S	*	*			trans	-123	130.7	173.9	-63.7	-176.8	13.4	0	108.4	A107	A107-Q109 PolarHBondContact O-N 3.47Å
110	E	86.7	Confident	83.4	Confident	204 Å²	204	141.5 Å²	141.5	95%	0.953	79%	0.794	S	S	*	*			trans	-99	137	171.4	-67.1	-176.3	167	0	109.1
111	G	86.4	Confident	84.1	Confident	73 Å²	73	138.3 Å²	138.3	75%	0.753	78%	0.778	S	S	*	*			trans	-162.4	152.5	177.5	0	0	0	0	110.5
112	I	86.8	Confident	84.6	Confident	163 Å²	163	141 Å²	141	84%	0.836	78%	0.778	S	S	*	*			trans	-96.1	131.2	169.3	56.5	175.1	0	0	108.3
113	L	85.9	Confident	84.9	Confident	163 Å²	163	140.1 Å²	140.1	85%	0.853	78%	0.776	S	S	*	*			trans	-75.5	127.4	168	-60	179.7	0	0	107.6	D115	L113-D115 VanDerWaalsContact C-N 3.32Å
114	Q	84.9	Confident	85.2	Confident	191 Å²	191	137.6 Å²	137.6	89%	0.893	77%	0.772	S	S	*	*	S	Bend	trans	-72.1	-32.2	176.7	-68.2	177.6	20.2	0	111.4
115	D	89.8	Confident	85.7	Confident	141 Å²	141	140.1 Å²	140.1	75%	0.754	78%	0.775	S	S	*	*	S	Bend	trans	-78.2	126	173.7	-71.6	-26.3	0	0	109.5	L113	L113-D115 VanDerWaalsContact C-N 3.32Å
116	M	86	Confident	86	Confident	173 Å²	173	139.4 Å²	139.4	85%	0.852	77%	0.771	S	S	*	*	P	Polyproline II helix	trans	-59.6	138.7	168.4	-64.5	-172.7	-57.4	0	108.8	V118	M116-V118 PolarHBondContact O-N 3.36Å
117	P	88.3	Confident	86.1	Confident	119 Å²	119	141.2 Å²	141.2	77%	0.773	76%	0.762	S	S	*	*	P	Polyproline II helix	trans	-59	142.1	175.6	26.4	-33.6	0	0	109.5	D119	P117-D119 PolarHBondContact O-N 3.23Å; P117-D119 VanDerWaalsContact O-N 3.08Å
118	V	89.9	Confident	86.5	Confident	140 Å²	140	141 Å²	141	85%	0.848	76%	0.755	S	S	*	*			trans	-69.2	107.5	166.1	-179.7	0	0	0	106.2	M116 P120	M116-V118 PolarHBondContact O-N 3.36Å; V118-P120 VanDerWaalsContact O-CD 3.3Å; V118-P120 WeakPolarHBondContact O-CD 3.23Å
119	D	85.6	Confident	86.8	Confident	92 Å²	92	139.7 Å²	139.7	49%	0.492	75%	0.749	S	S	.	*			trans	-81.1	110.9	168	-155.2	-37.5	0	0	107.9	P117 D121	P117-D119 PolarHBondContact O-N 3.23Å; P117-D119 VanDerWaalsContact O-N 3.08Å; D119-D121 PolarHBondContact O-N 3.14Å; D119-D121 WeakPolarHBondContact OD1-CB 3.27Å; D119-D121 PolarHBondContact OD1-N 3.18Å
120	P	89.2	Confident	87	Confident	115 Å²	115	139.8 Å²	139.8	75%	0.747	75%	0.749	S	S	*	*			trans	-70.2	-21.5	176.8	31.7	-35.5	0	0	111.6	V118	V118-P120 VanDerWaalsContact O-CD 3.3Å; V118-P120 WeakPolarHBondContact O-CD 3.23Å
121	D	90.2	Very high	86.6	Confident	119 Å²	119	137.1 Å²	137.1	64%	0.636	74%	0.737	S	S	*	*	S	Bend	trans	-81	128.6	177.7	-64.8	-35.4	0	0	108.3	D119 E123	D119-D121 PolarHBondContact O-N 3.14Å; D119-D121 WeakPolarHBondContact OD1-CB 3.27Å; D119-D121 PolarHBondContact OD1-N 3.18Å; D121-E123 PolarHBondContact O-N 3.29Å; D121-E123 VanDerWaalsContact O-N 3.15Å
122	N	86.7	Confident	86.2	Confident	121 Å²	121	135.5 Å²	135.5	65%	0.647	72%	0.72	S	S	*	*			trans	-74.4	-0.4	-179.1	-165.7	29.7	0	0	112.7	A124	N122-A124 WeakPolarHBondContact O-CB 3.49Å; N122-A124 PolarHBondContact O-N 3.01Å
123	E	86	Confident	86	Confident	175 Å²	175	135.9 Å²	135.9	82%	0.818	71%	0.712	S	S	*	*	S	Bend	trans	43.3	27.2	-172.9	-61.6	-160.9	145.1	0	114.8	D121	D121-E123 PolarHBondContact O-N 3.29Å; D121-E123 VanDerWaalsContact O-N 3.15Å
124	A	88.2	Confident	85.9	Confident	62 Å²	62	135.4 Å²	135.4	51%	0.512	71%	0.706	S	S	.	*	S	Bend	trans	-133.8	144	-173.8	0	0	0	0	110.3	N122 E126	N122-A124 WeakPolarHBondContact O-CB 3.49Å; N122-A124 PolarHBondContact O-N 3.01Å; A124-E126 PolarHBondContact O-N 3.27Å; A124-E126 VanDerWaalsContact O-N 3.16Å
125	Y	85.4	Confident	86	Confident	245 Å²	245	133.7 Å²	133.7	96%	0.961	70%	0.703	S	S	*	*			trans	-69	109.1	164.1	-74.3	-83.5	0	0	108.3
126	E	84.8	Confident	85.8	Confident	163 Å²	163	135 Å²	135	76%	0.762	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-87.6	127.2	172.4	-164.6	169.7	-176.6	0	109.2	A124	A124-E126 PolarHBondContact O-N 3.27Å; A124-E126 VanDerWaalsContact O-N 3.16Å
127	M	84.3	Confident	85.5	Confident	107 Å²	107	134.9 Å²	134.9	53%	0.527	70%	0.695	S	S	.	*	P	Polyproline II helix	trans	-62.7	133.6	174.4	-75.7	-80.1	-67.2	0	108.8	S129 E131	M127-S129 PolarHBondContact O-N 3.06Å; M127-E131 HydrophobicContact CE-CB 4.37Å; M127-E131 HydrophobicContact CE-CG 4.07Å
128	P	86.6	Confident	85.2	Confident	74 Å²	74	134.8 Å²	134.8	48%	0.481	70%	0.695	S	S	.	*	P	Polyproline II helix	trans	-60.8	136	176.7	26.3	-33	0	0	109.5	E130 E131	P128-E130 PolarHBondContact O-N 3.28Å; P128-E131 HydrophobicContact CG-CG 4.27Å; P128-E131 PolarHBondContact O-N 2.79Å
129	S	87.6	Confident	84.6	Confident	111 Å²	111	136.9 Å²	136.9	78%	0.776	70%	0.696	S	S	*	*	G	3₁₀ helix	trans	-62.4	-11.4	178.8	56.8	0	0	0	113.9	M127 E131 G132	M127-S129 PolarHBondContact O-N 3.06Å; S129-E131 VanDerWaalsContact C-N 3.31Å; S129-E131 PolarHBondContact O-N 3.36Å; S129-G132 PolarHBondContact O-N 2.99Å
130	E	87	Confident	83.5	Confident	185 Å²	185	140.3 Å²	140.3	86%	0.864	74%	0.736	S	S	*	*	G	3₁₀ helix	trans	-64.7	-30.9	176.3	-67	-169.5	152	0	113.4	P128 G132	P128-E130 PolarHBondContact O-N 3.28Å; E130-G132 PolarHBondContact O-N 3.47Å
131	E	78.4	Confident	83.2	Confident	147 Å²	147	141.6 Å²	141.6	69%	0.687	74%	0.736	S	S	*	*	G	3₁₀ helix	trans	-65.7	-22	178.5	-70.6	-93.7	144.4	0	111.7	M127 P128 S129	M127-E131 HydrophobicContact CE-CB 4.37Å; M127-E131 HydrophobicContact CE-CG 4.07Å; P128-E131 HydrophobicContact CG-CG 4.27Å; P128-E131 PolarHBondContact O-N 2.79Å; S129-E131 VanDerWaalsContact C-N 3.31Å; S129-E131 PolarHBondContact O-N 3.36Å
132	G	78.4	Confident	82.8	Confident	39 Å²	39	142.7 Å²	142.7	40%	0.402	74%	0.741	S	S	.	*			trans	59.6	174.9	-172.7	0	0	0	0	112.1	S129 E130	S129-G132 PolarHBondContact O-N 2.99Å; E130-G132 PolarHBondContact O-N 3.47Å
133	Y	82.3	Confident	82.6	Confident	172 Å²	172	143.9 Å²	143.9	68%	0.675	75%	0.746	S	S	*	*			trans	-124.1	134	169	-64.4	-82.2	0	0	107.4	D135	Y133-D135 PolarHBondContact O-N 3.3Å
134	Q	84	Confident	82.4	Confident	153 Å²	153	142.1 Å²	142.1	72%	0.715	74%	0.742	S	S	*	*			trans	-79.6	109.5	172.1	-78.2	-177.5	6.7	0	108.5	Y136	Q134-Y136 PolarHBondContact O-N 3.22Å
135	D	87.5	Confident	82.1	Confident	155 Å²	155	147.1 Å²	147.1	83%	0.829	76%	0.756	S	S	*	*			trans	-83.8	5.8	178.9	-57.6	-29.1	0	0	112.9	Y133	Y133-D135 PolarHBondContact O-N 3.3Å
136	Y	85.3	Confident	81.8	Confident	169 Å²	169	140.6 Å²	140.6	66%	0.663	74%	0.743	S	S	*	*	S	Bend	trans	-134.9	138.1	-178.6	55.7	-91	0	0	111.4	Q134	Q134-Y136 PolarHBondContact O-N 3.22Å
137	E	79.9	Confident	81.6	Confident	169 Å²	169	139 Å²	139	79%	0.79	74%	0.741	S	S	*	*			trans	-79.5	142	171	-77.7	-174.7	153.7	0	110.6	E139	E137-E139 PolarHBondContact O-N 3.44Å
138	P	82.7	Confident	81.4	Confident	117 Å²	117	141.5 Å²	141.5	76%	0.76	76%	0.758	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.1	-3.5	-177	28.1	-34.8	0	0	115.2
139	E	76.4	Confident	81	Confident	185 Å²	185	147.1 Å²	147.1	86%	0.864	78%	0.781	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.9	22.7	-167.8	-70.1	-97.9	160.2	0	114.3	E137	E137-E139 PolarHBondContact O-N 3.44Å
140	A	62.7	Low	80.4	Confident	163 Å²	163	150.4 Å²	150.4	100%	1.347	78%	0.781	S	S	*	*			trans	-94.5	0	174.5	0	0	0	0	113.5

Retrieved 140 of 140 residues in 409.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).