H4_HUMAN Loading...

Histone H4

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

AlphaFold DB (A0A0G1Z8R5), UniProt , Accession P62805, Species HUMAN (Homo sapiens, Human), Gene H4C1/H4C2/H4C3/H4C4/H4C5/H4C6/H4C8/H4C9/H4C11/H4C12/H4C13/H4C14/H4C15/H4C16, Length 103 aa.

>H4_HUMAN|P62805|H4C1/H4C2/H4C3/H4C4/H4C5/H4C6/H4C8/H4C9/H4C11/H4C12/H4C13/H4C14/H4C15/H4C16
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M47.1Very low58.3Low247 Ų247138.9 Ų138.9100%1.21785%0.848SS**  0109.70-68.7170.485.900108.3G3M1-G3 PolarHBondContact O-N 3.33Å
2S49.7Very low58.7Low122 Ų122133.3 Ų133.385%0.85384%0.838SS**  trans-88.294.9-176.147.10000111R4S2-R4 VanDerWaalsContact C-N 3.33Å; S2-R4 PolarHBondContact O-N 3.14Å
3G56.1Low59.3Low83 Ų83138.3 Ų138.386%0.85684%0.84SS**  trans-79.773.1174.500000112.3M1 G5M1-G3 PolarHBondContact O-N 3.33Å; G3-G5 PolarHBondContact O-N 3.06Å
4R59.3Low59.6Low238 Ų238133.5 Ų133.590%0.89883%0.833SS**  trans-83.790.1172.6-164.1153.4179.2148.6-4.2109.1S2 K6S2-R4 VanDerWaalsContact C-N 3.33Å; S2-R4 PolarHBondContact O-N 3.14Å; R4-K6 PolarHBondContact O-N 3.35Å
5G61.1Low60.3Low68 Ų68129.5 Ų129.570%0.70183%0.827SS**  trans-54.3126.4172.200000110.5G3 G7G3-G5 PolarHBondContact O-N 3.06Å; G5-G7 VanDerWaalsContact C-N 3.31Å; G5-G7 PolarHBondContact O-N 3.18Å
6K62.2Low61.3Low212 Ų212127.1 Ų127.192%0.92282%0.823SS**  trans-66.793.3171.2-79.8-179.7175.6174.10108R4 G8R4-K6 PolarHBondContact O-N 3.35Å; K6-G8 VanDerWaalsContact C-N 3.3Å; K6-G8 PolarHBondContact O-N 3.07Å
7G59.7Low62.2Low73 Ų73131.4 Ų131.475%0.75383%0.826SS**  trans-58.799.3160.100000107.4G5 K9G5-G7 VanDerWaalsContact C-N 3.31Å; G5-G7 PolarHBondContact O-N 3.18Å; G7-K9 PolarHBondContact O-N 2.97Å
8G62Low63.3Low73 Ų73137.6 Ų137.675%0.75383%0.83SS**  trans-56.6107171.800000107K6 G10K6-G8 VanDerWaalsContact C-N 3.3Å; K6-G8 PolarHBondContact O-N 3.07Å; G8-G10 PolarHBondContact O-N 3.34Å
9K63.1Low64.3Low189 Ų189140.1 Ų140.182%0.82283%0.832SS**  trans-57.697164.5-101.4178.1173.6176.70105.2G7 L11G7-K9 PolarHBondContact O-N 2.97Å; K9-L11 PolarHBondContact O-N 3.36Å
10G60.9Low65.4Low76 Ų76144.9 Ų144.978%0.78484%0.835SS**  trans-57.792.2159.600000105.4G8 G12G8-G10 PolarHBondContact O-N 3.34Å; G10-G12 PolarHBondContact O-N 3.38Å
11L60.7Low66.5Low147 Ų147146.4 Ų146.477%0.7783%0.832SS**  trans-6483.4162-65.5172000103.9K9 K13K9-L11 PolarHBondContact O-N 3.36Å; L11-K13 PolarHBondContact O-N 3Å
12G63Low68.4Low71 Ų71139.5 Ų139.573%0.73280%0.803SS**  trans-54.6100.4163.300000104.3G10 G14G10-G12 PolarHBondContact O-N 3.38Å; G12-G14 VanDerWaalsContact C-N 3.33Å; G12-G14 PolarHBondContact O-N 2.65Å
13K66Low70.3Confident199 Ų199139.8 Ų139.887%0.86580%0.795SS**  trans-53.5105.4179.4-72.5-179.9176.2177.70105.2L11 G15L11-K13 PolarHBondContact O-N 3Å; K13-G15 PolarHBondContact O-N 3.14Å
14G63.9Low71.9Confident71 Ų71145.1 Ų145.173%0.73279%0.789SS**PPolyproline II helixtrans-48.4121.6169.900000106.3G12 A16G12-G14 VanDerWaalsContact C-N 3.33Å; G12-G14 PolarHBondContact O-N 2.65Å; G14-A16 PolarHBondContact O-N 2.76Å; G14-A16 VanDerWaalsContact O-N 3.16Å
15G70.5Confident73.4Confident73 Ų73140 Ų14075%0.75378%0.78SS**PPolyproline II helixtrans-47.2125.5-166.500000110.6K13 K17K13-G15 PolarHBondContact O-N 3.14Å; G15-K17 PolarHBondContact O-N 3.28Å
16A76.2Confident75Confident91 Ų91141.9 Ų141.975%0.75277%0.773SS**PPolyproline II helixtrans-47.1128.2179.900000109.4G14 R18G14-A16 PolarHBondContact O-N 2.76Å; G14-A16 VanDerWaalsContact O-N 3.16Å; A16-R18 PolarHBondContact O-N 3.37Å
17K76.9Confident76.6Confident201 Ų201134.3 Ų134.387%0.87474%0.742SS**  trans-57.3106.3179.9-163.4174.5-173.6176.80107.5G15 H19G15-K17 PolarHBondContact O-N 3.28Å; K17-H19 PolarHBondContact O-N 3.43Å
18R80.4Confident78.3Confident242 Ų242135.1 Ų135.191%0.91373%0.727SS**PPolyproline II helixtrans-65122.9-177.6-71.6-175177.2-178.2-0.7108.4A16A16-R18 PolarHBondContact O-N 3.37Å
19H82.8Confident79.9Confident185 Ų185134.4 Ų134.486%0.85672%0.719SS**PPolyproline II helixtrans-61.7138.8168.8-72.1-88000109.3K17 K21K17-H19 PolarHBondContact O-N 3.43Å; H19-K21 PolarHBondContact O-N 3.12Å
20R86.6Confident81.5Confident237 Ų237128.3 Ų128.389%0.89470%0.695SS**PPolyproline II helixtrans-64.4130.1178.4-176.817465.3-178.60.1109.3
21K88.3Confident83.3Confident176 Ų176127.8 Ų127.877%0.76568%0.677SS**PPolyproline II helixtrans-62.4138.8173.3-171.1176.2-179.4179.20110H19 L23H19-K21 PolarHBondContact O-N 3.12Å; K21-L23 PolarHBondContact O-N 3.5Å
22V87.4Confident85.1Confident103 Ų103126.1 Ų126.162%0.62466%0.663SS**PPolyproline II helixtrans-70.7123.1169.9-176.20000108.3R24V22-R24 HydrophobicContact CG1-CG 4.11Å
23L89.4Confident86.8Confident128 Ų128126 Ų12667%0.6765%0.65SS**PPolyproline II helixtrans-88130175.9-61.5177000109K21K21-L23 PolarHBondContact O-N 3.5Å
24R90.1Very high88.3Confident194 Ų194117.6 Ų117.673%0.73262%0.617SS**  trans-140.8146176.8-62.9-174.3-178.7178.2-0.1109.4V22 N26V22-R24 HydrophobicContact CG1-CG 4.11Å; R24-N26 PolarHBondContact O-N 2.98Å; R24-N26 PolarHBondContact O-OD1 2.9Å
25D90.1Very high90Very high132 Ų132114.5 Ų114.571%0.70658%0.584SS**  trans5422.8169.6-51.8-40000117.2I27 Q28D25-I27 PolarHBondContact O-N 3.2Å; D25-Q28 PolarHBondContact O-N 3.33Å
26N94.4Very high91.3Very high106 Ų106116 Ų11657%0.56757%0.566SS**G310 helixtrans-57.9-19177.2-70.9-13.5000113.4R24 Q28 G29R24-N26 PolarHBondContact O-N 2.98Å; R24-N26 PolarHBondContact O-OD1 2.9Å; N26-Q28 PolarHBondContact O-N 3.44Å; N26-G29 WeakPolarHBondContact O-CA 3.46Å; N26-G29 PolarHBondContact O-N 3.06Å
27I95.6Very high92.4Very high53 Ų53119.3 Ų119.327%0.27256%0.56SS.*G310 helixtrans-59.3-28.8176-164.161000112.3D25 G29 I30 R56 K60D25-I27 PolarHBondContact O-N 3.2Å; I27-G29 PolarHBondContact O-N 3.33Å; I27-I30 WeakPolarHBondContact O-CB 3.4Å; I27-I30 PolarHBondContact O-N 3.42Å; I27-I30 VanDerWaalsContact O-N 3.15Å; I27-R56 HydrophobicContact CD1-CB 4.05Å; I27-R56 HydrophobicContact CD1-CG 4.31Å; I27-R56 HydrophobicContact CG1-CB 3.71Å; I27-R56 HydrophobicContact CG1-CG 4Å; I27-R56 WeakPolarHBondContact O-CD 3.34Å; I27-R56 PolarHBondContact O-NE 2.94Å; I27-K60 HydrophobicContact CD1-CB 4.44Å
28Q95.3Very high93.4Very high91 Ų91114.8 Ų114.843%0.42554%0.544SS..G310 helixtrans-71.9-16.7175-63-56.9-31.100112.8D25 N26 I30 E53 R56D25-Q28 PolarHBondContact O-N 3.33Å; N26-Q28 PolarHBondContact O-N 3.44Å; Q28-I30 PolarHBondContact O-N 2.96Å; Q28-E53 PolarHBondContact NE2-OE2 2.94Å; Q28-R56 VanDerWaalsContact OE1-CZ 3.23Å
29G96.1Very high94.2Very high58 Ų58104.2 Ų104.260%0.59851%0.509SS*.G310 helixtrans-63.3-19.2169.100000113.3N26 I27 T31N26-G29 WeakPolarHBondContact O-CA 3.46Å; N26-G29 PolarHBondContact O-N 3.06Å; I27-G29 PolarHBondContact O-N 3.33Å; G29-T31 VanDerWaalsContact C-N 3.34Å; G29-T31 PolarHBondContact O-N 3.38Å; G29-T31 VanDerWaalsContact O-N 3.07Å
30I97.4Very high95Very high60 Ų60100.8 Ų100.831%0.30849%0.488SS..SBendtrans-7989.6165.1-50.3-58.4000107.7I27 Q28 I35 R56 L59I27-I30 WeakPolarHBondContact O-CB 3.4Å; I27-I30 PolarHBondContact O-N 3.42Å; I27-I30 VanDerWaalsContact O-N 3.15Å; Q28-I30 PolarHBondContact O-N 2.96Å; I30-I35 HydrophobicContact CG2-CD1 4.29Å; I30-I35 HydrophobicContact CG2-CG1 3.97Å; I30-R56 HydrophobicContact CB-CG 4.47Å; I30-R56 PolarHBondContact O-NE 3.41Å; I30-R56 PolarHBondContact O-NH2 3.45Å; I30-L59 HydrophobicContact CD1-CD2 4.17Å; I30-L59 HydrophobicContact CG1-CD2 3.82Å; I30-L59 HydrophobicContact CG2-CD2 4.33Å
31T98.2Very high95.5Very high65 Ų6599.7 Ų99.740%0.39948%0.484SS..  trans-76.1155-170.862.30000112.8G29 P33 A34 I35G29-T31 VanDerWaalsContact C-N 3.34Å; G29-T31 PolarHBondContact O-N 3.38Å; G29-T31 VanDerWaalsContact O-N 3.07Å; T31-P33 VanDerWaalsContact C-CD 3.48Å; T31-P33 VanDerWaalsContact C-N 3.32Å; T31-A34 WeakPolarHBondContact O-CB 3.21Å; T31-A34 PolarHBondContact O-N 3.41Å; T31-I35 PolarHBondContact O-N 3.27Å; T31-I35 VanDerWaalsContact O-N 3.15Å
32K98.3Very high96Very high112 Ų11294.4 Ų94.449%0.48748%0.479SS..Hα-helixtrans-52.5-40.9177-61.3-175.7178.4177.60113.4A34 I35 R36 Y52K32-A34 VanDerWaalsContact C-N 3.34Å; K32-A34 PolarHBondContact O-N 3.15Å; K32-I35 PolarHBondContact O-N 3.37Å; K32-R36 PolarHBondContact O-N 3.3Å; K32-Y52 HydrophobicContact CB-CD1 3.93Å; K32-Y52 HydrophobicContact CB-CE1 3.88Å; K32-Y52 HydrophobicContact CB-CG 4.45Å; K32-Y52 HydrophobicContact CD-CD1 4.37Å; K32-Y52 HydrophobicContact CD-CD2 3.88Å; K32-Y52 HydrophobicContact CD-CE1 4.47Å; K32-Y52 HydrophobicContact CD-CE2 4.02Å; K32-Y52 HydrophobicContact CD-CG 4.1Å; K32-Y52 HydrophobicContact CG-CD1 3.79Å; K32-Y52 HydrophobicContact CG-CD2 4.14Å; K32-Y52 HydrophobicContact CG-CE1 4.12Å; K32-Y52 HydrophobicContact CG-CE2 4.47Å; K32-Y52 HydrophobicContact CG-CG 3.82Å
33P98.3Very high96.5Very high69 Ų6992.6 Ų92.645%0.44848%0.481SS..Hα-helixtrans-62.2-36.2174-24.936.1000113.9T31 R36 R37T31-P33 VanDerWaalsContact C-CD 3.48Å; T31-P33 VanDerWaalsContact C-N 3.32Å; P33-R36 PolarHBondContact O-N 2.96Å; P33-R37 WeakPolarHBondContact O-CG 3.45Å; P33-R37 PolarHBondContact O-N 2.94Å
34A98.5Very high96.9Very high22 Ų2289.3 Ų89.318%0.18247%0.467CS..Hα-helixtrans-65.4-45.6176.700000111.6T31 K32 R36 R37 L38T31-A34 WeakPolarHBondContact O-CB 3.21Å; T31-A34 PolarHBondContact O-N 3.41Å; K32-A34 VanDerWaalsContact C-N 3.34Å; K32-A34 PolarHBondContact O-N 3.15Å; A34-R36 VanDerWaalsContact C-N 3.31Å; A34-R36 PolarHBondContact O-N 2.67Å; A34-R37 PolarHBondContact O-N 3.31Å; A34-L38 PolarHBondContact O-N 2.87Å; A34-L38 VanDerWaalsContact O-N 3.12Å
35I98.5Very high97.3Very high6 Ų688.9 Ų88.93%0.03147%0.47CS..Hα-helixtrans-59.7-43.4174.7-63.1172.6000110.4I30 T31 K32 R37 L38 A39 Y52 T55 R56I30-I35 HydrophobicContact CG2-CD1 4.29Å; I30-I35 HydrophobicContact CG2-CG1 3.97Å; T31-I35 PolarHBondContact O-N 3.27Å; T31-I35 VanDerWaalsContact O-N 3.15Å; K32-I35 PolarHBondContact O-N 3.37Å; I35-R37 PolarHBondContact O-N 3.04Å; I35-L38 PolarHBondContact O-N 3.38Å; I35-A39 WeakPolarHBondContact O-CB 3.24Å; I35-A39 PolarHBondContact O-N 3.44Å; I35-Y52 HydrophobicContact CB-CD1 4.29Å; I35-Y52 HydrophobicContact CD1-CD1 4.22Å; I35-Y52 HydrophobicContact CG2-CD1 4.13Å; I35-T55 HydrophobicContact CD1-CG2 4.43Å; I35-T55 HydrophobicContact CG1-CG2 4.29Å; I35-T55 HydrophobicContact CG2-CG2 4.17Å; I35-R56 HydrophobicContact CD1-CG 4.4Å
36R98.4Very high97.7Very high104 Ų10493.4 Ų93.439%0.39248%0.477SS..Hα-helixtrans-60.1-44.7176.5-167.3-176.1-57.5-76.51.5111.6K32 P33 A34 L38 A39 R40 I47 Y52K32-R36 PolarHBondContact O-N 3.3Å; P33-R36 PolarHBondContact O-N 2.96Å; A34-R36 VanDerWaalsContact C-N 3.31Å; A34-R36 PolarHBondContact O-N 2.67Å; R36-L38 VanDerWaalsContact C-N 3.33Å; R36-L38 PolarHBondContact O-N 3.47Å; R36-A39 PolarHBondContact O-N 2.98Å; R36-R40 HydrophobicContact CG-CG 4.32Å; R36-R40 WeakPolarHBondContact O-CB 3.44Å; R36-R40 WeakPolarHBondContact O-CG 3.42Å; R36-R40 PolarHBondContact O-N 3.42Å; R36-I47 HydrophobicContact CG-CD1 4.13Å; R36-Y52 PolarHBondContact NH2-OH 3.49Å
37R98.6Very high97.8Very high162 Ų16290 Ų9061%0.61146%0.459SS*.Hα-helixtrans-59.5-42.5177.6-73.3-172.3-61.2-92.55.6112.3P33 A34 I35 R40 R41P33-R37 WeakPolarHBondContact O-CG 3.45Å; P33-R37 PolarHBondContact O-N 2.94Å; A34-R37 PolarHBondContact O-N 3.31Å; I35-R37 PolarHBondContact O-N 3.04Å; R37-R40 PolarHBondContact O-N 3.49Å; R37-R41 PolarHBondContact O-N 3.17Å
38L98.3Very high97.9Very high105 Ų10590.9 Ų90.955%0.5547%0.469SS..Hα-helixtrans-64.2-48.3176-68.9172.1000111.9A34 I35 R36 R40 R41 G42A34-L38 PolarHBondContact O-N 2.87Å; A34-L38 VanDerWaalsContact O-N 3.12Å; I35-L38 PolarHBondContact O-N 3.38Å; R36-L38 VanDerWaalsContact C-N 3.33Å; R36-L38 PolarHBondContact O-N 3.47Å; L38-R40 VanDerWaalsContact C-N 3.31Å; L38-R40 PolarHBondContact O-N 3.15Å; L38-R41 WeakPolarHBondContact O-CB 3.18Å; L38-R41 PolarHBondContact O-N 3.1Å; L38-G42 PolarHBondContact O-N 3.28Å
39A98.1Very high98Very high20 Ų2089.2 Ų89.217%0.16548%0.477CS..Hα-helixtrans-60.5-40.2178.200000112.1I35 R36 G42 G43 V44 I47I35-A39 WeakPolarHBondContact O-CB 3.24Å; I35-A39 PolarHBondContact O-N 3.44Å; R36-A39 PolarHBondContact O-N 2.98Å; A39-G42 CarbonylContact O-C 3.52Å; A39-G42 WeakPolarHBondContact O-CA 3.47Å; A39-G42 PolarHBondContact O-N 3.38Å; A39-G42 VanDerWaalsContact O-N 3.14Å; A39-G43 PolarHBondContact O-N 3.11Å; A39-V44 HydrophobicContact CB-CB 4.04Å; A39-V44 HydrophobicContact CB-CG1 4.49Å; A39-V44 HydrophobicContact CB-CG2 4.12Å; A39-V44 VanDerWaalsContact O-CB 3.24Å; A39-V44 WeakPolarHBondContact O-CB 3.32Å; A39-V44 VanDerWaalsContact O-CG2 3.29Å; A39-V44 WeakPolarHBondContact O-CG2 3.38Å; A39-V44 PolarHBondContact O-N 2.64Å; A39-I47 HydrophobicContact CB-CD1 3.59Å; A39-I47 HydrophobicContact CB-CG1 4.41Å
40R98.4Very high98.1Very high114 Ų11493.3 Ų93.343%0.4348%0.484SS..Hα-helixtrans-64.1-41.3175.5-68.7-59.5-175.6-131.510.1112.3R36 R37 L38 G42 G43 V44 K45R36-R40 HydrophobicContact CG-CG 4.32Å; R36-R40 WeakPolarHBondContact O-CB 3.44Å; R36-R40 WeakPolarHBondContact O-CG 3.42Å; R36-R40 PolarHBondContact O-N 3.42Å; R37-R40 PolarHBondContact O-N 3.49Å; L38-R40 VanDerWaalsContact C-N 3.31Å; L38-R40 PolarHBondContact O-N 3.15Å; R40-G42 PolarHBondContact O-N 2.89Å; R40-G43 PolarHBondContact O-N 3.07Å; R40-V44 WeakPolarHBondContact CD-O 3.29Å; R40-V44 PolarHBondContact NH1-O 3.28Å; R40-K45 VanDerWaalsContact CZ-O 3.32Å; R40-K45 PolarHBondContact NH1-O 2.94Å; R40-K45 PolarHBondContact NH2-O 3.47Å; R40-K45 VanDerWaalsContact NH2-O 3.14Å
41R98.5Very high98.1Very high214 Ų21494 Ų9481%0.80849%0.488SS*.Hα-helixtrans-59.1-34.7172.6-174.7-178.8-65.3163.2-2.3111.8R37 L38 G43R37-R41 PolarHBondContact O-N 3.17Å; L38-R41 WeakPolarHBondContact O-CB 3.18Å; L38-R41 PolarHBondContact O-N 3.1Å; R41-G43 PolarHBondContact O-N 3.46Å
42G97.9Very high98.1Very high64 Ų6492 Ų9266%0.6647%0.473SS*.THydrogen-bonded Turntrans-78.69.5172.900000115.4L38 A39 R40 V44L38-G42 PolarHBondContact O-N 3.28Å; A39-G42 CarbonylContact O-C 3.52Å; A39-G42 WeakPolarHBondContact O-CA 3.47Å; A39-G42 PolarHBondContact O-N 3.38Å; A39-G42 VanDerWaalsContact O-N 3.14Å; R40-G42 PolarHBondContact O-N 2.89Å; G42-V44 VanDerWaalsContact C-N 3.3Å; G42-V44 PolarHBondContact O-N 2.94Å
43G98.2Very high98.1Very high65 Ų6591.5 Ų91.567%0.6747%0.473SS*.THydrogen-bonded Turntrans77.58.8177.800000115.2A39 R40 R41 K45A39-G43 PolarHBondContact O-N 3.11Å; R40-G43 PolarHBondContact O-N 3.07Å; R41-G43 PolarHBondContact O-N 3.46Å; G43-K45 PolarHBondContact O-N 3.31Å
44V98.2Very high98Very high60 Ų6094.1 Ų94.136%0.36448%0.479SS..  trans-68.6127.2-179.7-178.80000109.8A39 R40 G42 R46 I47A39-V44 HydrophobicContact CB-CB 4.04Å; A39-V44 HydrophobicContact CB-CG1 4.49Å; A39-V44 HydrophobicContact CB-CG2 4.12Å; A39-V44 VanDerWaalsContact O-CB 3.24Å; A39-V44 WeakPolarHBondContact O-CB 3.32Å; A39-V44 VanDerWaalsContact O-CG2 3.29Å; A39-V44 WeakPolarHBondContact O-CG2 3.38Å; A39-V44 PolarHBondContact O-N 2.64Å; R40-V44 WeakPolarHBondContact CD-O 3.29Å; R40-V44 PolarHBondContact NH1-O 3.28Å; G42-V44 VanDerWaalsContact C-N 3.3Å; G42-V44 PolarHBondContact O-N 2.94Å; V44-R46 WeakPolarHBondContact CG1-O 3.44Å; V44-I47 HydrophobicContact CG1-CD1 4.48Å; V44-I47 HydrophobicContact CG1-CG1 3.72Å
45K97.8Very high98Very high185 Ų18595.3 Ų95.380%0.80448%0.484SS*.  trans-92-42.6-179.6-168.1174.9-176.8174.70113.8R40 G43R40-K45 VanDerWaalsContact CZ-O 3.32Å; R40-K45 PolarHBondContact NH1-O 2.94Å; R40-K45 PolarHBondContact NH2-O 3.47Å; R40-K45 VanDerWaalsContact NH2-O 3.14Å; G43-K45 PolarHBondContact O-N 3.31Å
46R97.8Very high98Very high226 Ų22695.5 Ų95.585%0.85348%0.484SS*.  trans-126.6147.2176.3-71.3-173.2166.9-152.5-2.2110.4V44V44-R46 WeakPolarHBondContact CG1-O 3.44Å
47I97.4Very high98Very high36 Ų3692.3 Ų92.319%0.18548%0.484CS..  trans-133127.1-174.8-55.3174.5000108.2R36 A39 V44 I51R36-I47 HydrophobicContact CG-CD1 4.13Å; A39-I47 HydrophobicContact CB-CD1 3.59Å; A39-I47 HydrophobicContact CB-CG1 4.41Å; V44-I47 HydrophobicContact CG1-CD1 4.48Å; V44-I47 HydrophobicContact CG1-CG1 3.72Å; I47-I51 HydrophobicContact CG2-CB 3.89Å; I47-I51 HydrophobicContact CG2-CG1 4.24Å; I47-I51 HydrophobicContact CG2-CG2 3.99Å
48S97.8Very high98Very high70 Ų7088.9 Ų88.949%0.4948%0.481SS..  trans-72.4152172.9174.40000111.4L50 I51S48-L50 PolarHBondContact O-N 3.31Å; S48-I51 WeakPolarHBondContact O-CB 3.08Å; S48-I51 PolarHBondContact O-N 3.42Å
49G97Very high98Very high56 Ų5686.5 Ų86.558%0.57747%0.468SS*.THydrogen-bonded Turntrans-60.6-30.3177.300000114I51 Y52G49-I51 VanDerWaalsContact C-N 3.27Å; G49-I51 PolarHBondContact O-N 3.17Å; G49-Y52 WeakPolarHBondContact O-CD2 3.46Å
50L97.6Very high97.9Very high145 Ų14591.1 Ų91.176%0.75948%0.484SS*.THydrogen-bonded Turntrans-71.1-21.4-178.9-62.9176.9000113.2S48 Y52 E53 E54S48-L50 PolarHBondContact O-N 3.31Å; L50-Y52 PolarHBondContact O-N 3.44Å; L50-E53 PolarHBondContact O-N 3.34Å; L50-E54 PolarHBondContact O-N 3.25Å
51I98.1Very high97.9Very high73 Ų7389.4 Ų89.437%0.37449%0.487SS..Hα-helixtrans-64.3-24.6-176.3-63.5-63.9000112.5I47 S48 G49 T55I47-I51 HydrophobicContact CG2-CB 3.89Å; I47-I51 HydrophobicContact CG2-CG1 4.24Å; I47-I51 HydrophobicContact CG2-CG2 3.99Å; S48-I51 WeakPolarHBondContact O-CB 3.08Å; S48-I51 PolarHBondContact O-N 3.42Å; G49-I51 VanDerWaalsContact C-N 3.27Å; G49-I51 PolarHBondContact O-N 3.17Å; I51-T55 VanDerWaalsContact O-CB 3.28Å; I51-T55 WeakPolarHBondContact O-CB 3.37Å; I51-T55 PolarHBondContact O-N 2.89Å; I51-T55 PolarHBondContact O-OG1 2.99Å
52Y97.8Very high97.8Very high23 Ų2382.1 Ų82.19%0.0946%0.461CS..Hα-helixtrans-67.2-42.6-178.1-55.8-62.8000112.8K32 I35 R36 G49 L50 R56K32-Y52 HydrophobicContact CB-CD1 3.93Å; K32-Y52 HydrophobicContact CB-CE1 3.88Å; K32-Y52 HydrophobicContact CB-CG 4.45Å; K32-Y52 HydrophobicContact CD-CD1 4.37Å; K32-Y52 HydrophobicContact CD-CD2 3.88Å; K32-Y52 HydrophobicContact CD-CE1 4.47Å; K32-Y52 HydrophobicContact CD-CE2 4.02Å; K32-Y52 HydrophobicContact CD-CG 4.1Å; K32-Y52 HydrophobicContact CG-CD1 3.79Å; K32-Y52 HydrophobicContact CG-CD2 4.14Å; K32-Y52 HydrophobicContact CG-CE1 4.12Å; K32-Y52 HydrophobicContact CG-CE2 4.47Å; K32-Y52 HydrophobicContact CG-CG 3.82Å; I35-Y52 HydrophobicContact CB-CD1 4.29Å; I35-Y52 HydrophobicContact CD1-CD1 4.22Å; I35-Y52 HydrophobicContact CG2-CD1 4.13Å; R36-Y52 PolarHBondContact NH2-OH 3.49Å; G49-Y52 WeakPolarHBondContact O-CD2 3.46Å; L50-Y52 PolarHBondContact O-N 3.44Å; Y52-R56 WeakPolarHBondContact O-CG 3.35Å; Y52-R56 PolarHBondContact O-N 3.18Å; Y52-R56 PolarHBondContact O-NH1 3.39Å
53E97.8Very high97.8Very high103 Ų10382.8 Ų82.848%0.48145%0.449SS..Hα-helixtrans-76.9-38.2176.3-62.8-50.9143.700111.1Q28 L50 T55 R56 G57Q28-E53 PolarHBondContact NE2-OE2 2.94Å; L50-E53 PolarHBondContact O-N 3.34Å; E53-T55 VanDerWaalsContact C-N 3.35Å; E53-T55 PolarHBondContact O-N 3.32Å; E53-R56 WeakPolarHBondContact O-CB 3.42Å; E53-R56 PolarHBondContact O-N 3.45Å; E53-R56 VanDerWaalsContact O-N 3.1Å; E53-R56 IonicContact OE1-CZ 3.69Å; E53-R56 IonicContact OE1-NH1 2.64Å; E53-R56 PolarHBondContact OE1-NH1 3.44Å; E53-R56 IonicContact OE2-NH1 3.28Å; E53-R56 PolarHBondContact OE2-NH1 2.93Å; E53-G57 PolarHBondContact O-N 3.26Å
54E98Very high97.8Very high123 Ų12383.7 Ų83.758%0.57544%0.436SS*.Hα-helixtrans-57.6-47.3176-172.259.6-15600111.8L50 R56 G57 V58L50-E54 PolarHBondContact O-N 3.25Å; E54-R56 VanDerWaalsContact C-N 3.25Å; E54-R56 PolarHBondContact O-N 3.29Å; E54-G57 PolarHBondContact O-N 3.33Å; E54-G57 VanDerWaalsContact O-N 3.11Å; E54-V58 WeakPolarHBondContact O-CG2 3.45Å; E54-V58 PolarHBondContact O-N 3.29Å
55T98.3Very high97.7Very high47 Ų4783.8 Ų83.829%0.28843%0.434SS..Hα-helixtrans-60.4-37178.1-55.40000111.7I35 I51 E53 L59I35-T55 HydrophobicContact CD1-CG2 4.43Å; I35-T55 HydrophobicContact CG1-CG2 4.29Å; I35-T55 HydrophobicContact CG2-CG2 4.17Å; I51-T55 VanDerWaalsContact O-CB 3.28Å; I51-T55 WeakPolarHBondContact O-CB 3.37Å; I51-T55 PolarHBondContact O-N 2.89Å; I51-T55 PolarHBondContact O-OG1 2.99Å; E53-T55 VanDerWaalsContact C-N 3.35Å; E53-T55 PolarHBondContact O-N 3.32Å; T55-L59 VanDerWaalsContact O-CB 3.3Å; T55-L59 WeakPolarHBondContact O-CB 3.3Å; T55-L59 PolarHBondContact O-N 3.05Å
56R98.3Very high97.7Very high11 Ų1175.5 Ų75.54%0.04240%0.399CS..Hα-helixtrans-68.3-40.7176.6-76-179.4-167.2124.3-26.4111.6I27 Q28 I30 I35 Y52 E53 E54 L59 K60I27-R56 HydrophobicContact CD1-CB 4.05Å; I27-R56 HydrophobicContact CD1-CG 4.31Å; I27-R56 HydrophobicContact CG1-CB 3.71Å; I27-R56 HydrophobicContact CG1-CG 4Å; I27-R56 WeakPolarHBondContact O-CD 3.34Å; I27-R56 PolarHBondContact O-NE 2.94Å; Q28-R56 VanDerWaalsContact OE1-CZ 3.23Å; I30-R56 HydrophobicContact CB-CG 4.47Å; I30-R56 PolarHBondContact O-NE 3.41Å; I30-R56 PolarHBondContact O-NH2 3.45Å; I35-R56 HydrophobicContact CD1-CG 4.4Å; Y52-R56 WeakPolarHBondContact O-CG 3.35Å; Y52-R56 PolarHBondContact O-N 3.18Å; Y52-R56 PolarHBondContact O-NH1 3.39Å; E53-R56 WeakPolarHBondContact O-CB 3.42Å; E53-R56 PolarHBondContact O-N 3.45Å; E53-R56 VanDerWaalsContact O-N 3.1Å; E53-R56 IonicContact OE1-CZ 3.69Å; E53-R56 IonicContact OE1-NH1 2.64Å; E53-R56 PolarHBondContact OE1-NH1 3.44Å; E53-R56 IonicContact OE2-NH1 3.28Å; E53-R56 PolarHBondContact OE2-NH1 2.93Å; E54-R56 VanDerWaalsContact C-N 3.25Å; E54-R56 PolarHBondContact O-N 3.29Å; R56-L59 PolarHBondContact O-N 3.29Å; R56-K60 WeakPolarHBondContact O-CB 3.48Å; R56-K60 PolarHBondContact O-N 3.13Å
57G98Very high97.7Very high37 Ų3769.3 Ų69.338%0.38138%0.382SS..Hα-helixtrans-57.4-52.4173.400000111.8E53 E54 L59 K60 V61E53-G57 PolarHBondContact O-N 3.26Å; E54-G57 PolarHBondContact O-N 3.33Å; E54-G57 VanDerWaalsContact O-N 3.11Å; G57-L59 PolarHBondContact O-N 3.41Å; G57-K60 WeakPolarHBondContact O-CB 3.47Å; G57-K60 PolarHBondContact O-N 3.33Å; G57-V61 PolarHBondContact O-N 3Å; G57-V61 VanDerWaalsContact O-N 3.1Å
58V98Very high97.8Very high90 Ų9074 Ų7455%0.54540%0.397SS..Hα-helixtrans-60.4-44.9178.5177.10000111.8E54 K60 V61 F62E54-V58 WeakPolarHBondContact O-CG2 3.45Å; E54-V58 PolarHBondContact O-N 3.29Å; V58-K60 VanDerWaalsContact C-N 3.31Å; V58-K60 PolarHBondContact O-N 3.22Å; V58-V61 PolarHBondContact O-N 3.34Å; V58-F62 WeakPolarHBondContact O-CB 3.28Å; V58-F62 PolarHBondContact O-N 3.41Å
59L98.1Very high97.8Very high55 Ų5571.8 Ų71.829%0.28838%0.38SS..Hα-helixtrans-60.8-41.2178.217762.1000111.8I30 T55 R56 G57 F62 L63I30-L59 HydrophobicContact CD1-CD2 4.17Å; I30-L59 HydrophobicContact CG1-CD2 3.82Å; I30-L59 HydrophobicContact CG2-CD2 4.33Å; T55-L59 VanDerWaalsContact O-CB 3.3Å; T55-L59 WeakPolarHBondContact O-CB 3.3Å; T55-L59 PolarHBondContact O-N 3.05Å; R56-L59 PolarHBondContact O-N 3.29Å; G57-L59 PolarHBondContact O-N 3.41Å; L59-F62 PolarHBondContact O-N 2.99Å; L59-L63 HydrophobicContact CD1-CD1 4.05Å; L59-L63 HydrophobicContact CD1-CG 4.13Å; L59-L63 HydrophobicContact CG-CD1 4.1Å; L59-L63 WeakPolarHBondContact O-CG 3.42Å; L59-L63 PolarHBondContact O-N 3.38Å
60K97Very high97.8Very high116 Ų11669.3 Ų69.350%0.50435%0.353SS..Hα-helixtrans-61.5-50.4178.2-178.8178.4171.3-174.60111.1I27 R56 G57 V58 F62 L63 E64I27-K60 HydrophobicContact CD1-CB 4.44Å; R56-K60 WeakPolarHBondContact O-CB 3.48Å; R56-K60 PolarHBondContact O-N 3.13Å; G57-K60 WeakPolarHBondContact O-CB 3.47Å; G57-K60 PolarHBondContact O-N 3.33Å; V58-K60 VanDerWaalsContact C-N 3.31Å; V58-K60 PolarHBondContact O-N 3.22Å; K60-F62 VanDerWaalsContact C-N 3.3Å; K60-F62 PolarHBondContact O-N 3.16Å; K60-L63 PolarHBondContact O-N 3.1Å; K60-E64 WeakPolarHBondContact CE-OE1 3.46Å; K60-E64 HydrophobicContact CG-CG 4.45Å; K60-E64 IonicContact NZ-OE1 3.98Å; K60-E64 WeakPolarHBondContact O-CG 3.21Å; K60-E64 PolarHBondContact O-N 2.96Å
61V97.7Very high97.9Very high79 Ų7964.8 Ų64.848%0.47933%0.332SS..Hα-helixtrans-59.5-42.8178.6174.20000111.2G57 V58 E64 N65G57-V61 PolarHBondContact O-N 3Å; G57-V61 VanDerWaalsContact O-N 3.1Å; V58-V61 PolarHBondContact O-N 3.34Å; V61-E64 PolarHBondContact O-N 3.34Å; V61-N65 PolarHBondContact O-N 3.38Å; V61-N65 VanDerWaalsContact O-N 3.16Å; V61-N65 PolarHBondContact O-ND2 3.21Å
62F97.6Very high97.9Very high61 Ų6165.1 Ų65.127%0.26834%0.338SS..Hα-helixtrans-58.9-49.7176.5174.3-104.6000111.9V58 L59 K60 N65 V66 L91V58-F62 WeakPolarHBondContact O-CB 3.28Å; V58-F62 PolarHBondContact O-N 3.41Å; L59-F62 PolarHBondContact O-N 2.99Å; K60-F62 VanDerWaalsContact C-N 3.3Å; K60-F62 PolarHBondContact O-N 3.16Å; F62-N65 PolarHBondContact O-N 3.44Å; F62-V66 HydrophobicContact CD2-CG2 4.32Å; F62-V66 HydrophobicContact CE1-CG2 4.22Å; F62-V66 HydrophobicContact CE2-CG2 3.76Å; F62-V66 HydrophobicContact CZ-CG2 3.73Å; F62-V66 WeakPolarHBondContact O-CG2 3.37Å; F62-V66 PolarHBondContact O-N 2.97Å; F62-V66 VanDerWaalsContact O-N 3.13Å; F62-L91 HydrophobicContact CZ-CD2 4.05Å
63L97.5Very high97.8Very high77 Ų7767.8 Ų67.840%0.40335%0.348SS..Hα-helixtrans-66.2-39.4-179.6-70.4174.9000112.4L59 K60 N65 V66 I67L59-L63 HydrophobicContact CD1-CD1 4.05Å; L59-L63 HydrophobicContact CD1-CG 4.13Å; L59-L63 HydrophobicContact CG-CD1 4.1Å; L59-L63 WeakPolarHBondContact O-CG 3.42Å; L59-L63 PolarHBondContact O-N 3.38Å; K60-L63 PolarHBondContact O-N 3.1Å; L63-N65 VanDerWaalsContact C-N 3.28Å; L63-N65 PolarHBondContact O-N 3.41Å; L63-V66 PolarHBondContact O-N 3.26Å; L63-I67 HydrophobicContact CB-CD1 4.21Å; L63-I67 VanDerWaalsContact O-CB 3.24Å; L63-I67 WeakPolarHBondContact O-CB 3.5Å; L63-I67 WeakPolarHBondContact O-CG1 3.37Å; L63-I67 PolarHBondContact O-N 3.15Å
64E97.6Very high97.9Very high85 Ų8563.1 Ų63.140%0.39733%0.327SS..Hα-helixtrans-57.5-43176-77.2174.8175.800111.6K60 V61 R68K60-E64 WeakPolarHBondContact CE-OE1 3.46Å; K60-E64 HydrophobicContact CG-CG 4.45Å; K60-E64 IonicContact NZ-OE1 3.98Å; K60-E64 WeakPolarHBondContact O-CG 3.21Å; K60-E64 PolarHBondContact O-N 2.96Å; V61-E64 PolarHBondContact O-N 3.34Å; E64-R68 WeakPolarHBondContact O-CB 3.32Å; E64-R68 PolarHBondContact O-N 2.91Å
65N97.4Very high97.9Very high62 Ų6263.6 Ų63.633%0.33233%0.329SS..Hα-helixtrans-69.3-46.3179.5-68.3-23.3000112.6V61 F62 L63 R68 D69 Q94V61-N65 PolarHBondContact O-N 3.38Å; V61-N65 VanDerWaalsContact O-N 3.16Å; V61-N65 PolarHBondContact O-ND2 3.21Å; F62-N65 PolarHBondContact O-N 3.44Å; L63-N65 VanDerWaalsContact C-N 3.28Å; L63-N65 PolarHBondContact O-N 3.41Å; N65-R68 PolarHBondContact OD1-NH1 3.24Å; N65-D69 PolarHBondContact O-N 3.04Å; N65-Q94 PolarHBondContact O-NE2 2.91Å
66V97.9Very high97.8Very high11 Ų1169.4 Ų69.47%0.06735%0.352CS..Hα-helixtrans-66-44.3179.5175.50000111.6F62 L63 D69 A70 V87 A90 L91F62-V66 HydrophobicContact CD2-CG2 4.32Å; F62-V66 HydrophobicContact CE1-CG2 4.22Å; F62-V66 HydrophobicContact CE2-CG2 3.76Å; F62-V66 HydrophobicContact CZ-CG2 3.73Å; F62-V66 WeakPolarHBondContact O-CG2 3.37Å; F62-V66 PolarHBondContact O-N 2.97Å; F62-V66 VanDerWaalsContact O-N 3.13Å; L63-V66 PolarHBondContact O-N 3.26Å; V66-D69 PolarHBondContact O-N 3.46Å; V66-A70 WeakPolarHBondContact O-CB 3.39Å; V66-A70 PolarHBondContact O-N 3.24Å; V66-V87 HydrophobicContact CG1-CG1 4.39Å; V66-A90 HydrophobicContact CG1-CB 4.32Å; V66-L91 HydrophobicContact CG1-CD2 4.07Å; V66-L91 HydrophobicContact CG1-CG 4.26Å; V66-L91 HydrophobicContact CG2-CD2 3.82Å
67I97.9Very high97.8Very high96 Ų9671.1 Ų71.149%0.49237%0.369SS..Hα-helixtrans-68.3-37.8-178.1-66.4168.7000110.7L63 D69 A70 V71L63-I67 HydrophobicContact CB-CD1 4.21Å; L63-I67 VanDerWaalsContact O-CB 3.24Å; L63-I67 WeakPolarHBondContact O-CB 3.5Å; L63-I67 WeakPolarHBondContact O-CG1 3.37Å; L63-I67 PolarHBondContact O-N 3.15Å; I67-D69 VanDerWaalsContact C-N 3.34Å; I67-D69 PolarHBondContact O-N 2.67Å; I67-A70 PolarHBondContact O-N 2.78Å; I67-V71 HydrophobicContact CG2-CG2 4.02Å; I67-V71 WeakPolarHBondContact O-CB 3.48Å; I67-V71 VanDerWaalsContact O-CG2 3.27Å; I67-V71 WeakPolarHBondContact O-CG2 3.47Å; I67-V71 PolarHBondContact O-N 2.84Å
68R98.1Very high97.8Very high135 Ų13579 Ų7951%0.50939%0.393SS..Hα-helixtrans-55.3-51.1175.6-173.3-177.7-57.7112.62110.9E64 N65 V71 T72E64-R68 WeakPolarHBondContact O-CB 3.32Å; E64-R68 PolarHBondContact O-N 2.91Å; N65-R68 PolarHBondContact OD1-NH1 3.24Å; R68-V71 PolarHBondContact O-N 3.44Å; R68-T72 PolarHBondContact O-N 2.87Å; R68-T72 VanDerWaalsContact O-N 3.08Å; R68-T72 PolarHBondContact O-OG1 3.35Å
69D97.6Very high97.8Very high23 Ų2379 Ų7912%0.12338%0.383CS..Hα-helixtrans-65.5-42.2179-71.1-9.7000112N65 V66 I67 V71 T72 Y73 A90 R93 Q94N65-D69 PolarHBondContact O-N 3.04Å; V66-D69 PolarHBondContact O-N 3.46Å; I67-D69 VanDerWaalsContact C-N 3.34Å; I67-D69 PolarHBondContact O-N 2.67Å; D69-V71 VanDerWaalsContact C-N 3.35Å; D69-V71 PolarHBondContact O-N 3.43Å; D69-T72 WeakPolarHBondContact O-CB 3.47Å; D69-T72 PolarHBondContact O-N 3.44Å; D69-Y73 WeakPolarHBondContact O-CD2 3.43Å; D69-Y73 PolarHBondContact O-N 3.3Å; D69-Y73 VanDerWaalsContact O-N 3.1Å; D69-A90 HydrophobicContact CB-CB 3.72Å; D69-R93 IonicContact OD1-NH1 2.73Å; D69-R93 PolarHBondContact OD1-NH1 2.79Å; D69-R93 IonicContact OD2-CZ 3.44Å; D69-R93 IonicContact OD2-NH1 3.55Å; D69-R93 PolarHBondContact OD2-NH1 2.78Å; D69-Q94 PolarHBondContact OD2-NE2 2.73Å; D69-Q94 VanDerWaalsContact OD2-NE2 3.16Å
70A98.2Very high97.8Very high3 Ų386.5 Ų86.53%0.02541%0.413CS..Hα-helixtrans-63.8-38.1178.600000112.7V66 I67 Y73 T74 V82 D86 V87 A90V66-A70 WeakPolarHBondContact O-CB 3.39Å; V66-A70 PolarHBondContact O-N 3.24Å; I67-A70 PolarHBondContact O-N 2.78Å; A70-Y73 PolarHBondContact O-N 2.97Å; A70-T74 PolarHBondContact O-N 2.9Å; A70-T74 VanDerWaalsContact O-N 3.08Å; A70-T74 PolarHBondContact O-OG1 2.8Å; A70-V82 HydrophobicContact CB-CG1 4.4Å; A70-D86 HydrophobicContact CB-CB 4.4Å; A70-V87 HydrophobicContact CB-CG2 4.31Å; A70-A90 HydrophobicContact CB-CB 4.16Å
71V98.4Very high97.8Very high51 Ų5185.9 Ų85.931%0.30942%0.419SS..Hα-helixtrans-66.4-40.6174.2171.30000110.3I67 R68 D69 Y73 T74 E75I67-V71 HydrophobicContact CG2-CG2 4.02Å; I67-V71 WeakPolarHBondContact O-CB 3.48Å; I67-V71 VanDerWaalsContact O-CG2 3.27Å; I67-V71 WeakPolarHBondContact O-CG2 3.47Å; I67-V71 PolarHBondContact O-N 2.84Å; R68-V71 PolarHBondContact O-N 3.44Å; D69-V71 VanDerWaalsContact C-N 3.35Å; D69-V71 PolarHBondContact O-N 3.43Å; V71-Y73 VanDerWaalsContact C-N 3.34Å; V71-Y73 PolarHBondContact O-N 3.19Å; V71-T74 WeakPolarHBondContact O-CB 3.39Å; V71-T74 PolarHBondContact O-N 3.16Å; V71-T74 VanDerWaalsContact O-N 3.1Å; V71-E75 HydrophobicContact CG1-CG 4.15Å; V71-E75 WeakPolarHBondContact O-CG 3.44Å; V71-E75 PolarHBondContact O-N 3.05Å
72T97.9Very high97.8Very high80 Ų8085.6 Ų85.649%0.49142%0.417SS..Hα-helixtrans-57.1-44.4174.6-57.30000112.3R68 D69 T74 E75 H76R68-T72 PolarHBondContact O-N 2.87Å; R68-T72 VanDerWaalsContact O-N 3.08Å; R68-T72 PolarHBondContact O-OG1 3.35Å; D69-T72 WeakPolarHBondContact O-CB 3.47Å; D69-T72 PolarHBondContact O-N 3.44Å; T72-T74 PolarHBondContact O-N 3.44Å; T72-E75 PolarHBondContact O-N 2.87Å; T72-H76 WeakPolarHBondContact O-CB 3.42Å; T72-H76 PolarHBondContact O-N 2.81Å
73Y97.6Very high97.8Very high78 Ų7885.3 Ų85.331%0.30642%0.421SS..Hα-helixtrans-63.8-40.6175-69.2-57000112.8D69 A70 V71 H76 A77 A90D69-Y73 WeakPolarHBondContact O-CD2 3.43Å; D69-Y73 PolarHBondContact O-N 3.3Å; D69-Y73 VanDerWaalsContact O-N 3.1Å; A70-Y73 PolarHBondContact O-N 2.97Å; V71-Y73 VanDerWaalsContact C-N 3.34Å; V71-Y73 PolarHBondContact O-N 3.19Å; Y73-H76 PolarHBondContact O-N 2.8Å; Y73-A77 WeakPolarHBondContact O-CB 3.18Å; Y73-A77 PolarHBondContact O-N 3.38Å; Y73-A77 VanDerWaalsContact O-N 3.12Å; Y73-A90 HydrophobicContact CE2-CB 4.29Å
74T98.4Very high97.7Very high6 Ų684.4 Ų84.44%0.03742%0.424CS..Hα-helixtrans-62.1-45.9178.9-57.60000111.4A70 V71 T72 A77 K78 R79 T81 V82 D86A70-T74 PolarHBondContact O-N 2.9Å; A70-T74 VanDerWaalsContact O-N 3.08Å; A70-T74 PolarHBondContact O-OG1 2.8Å; V71-T74 WeakPolarHBondContact O-CB 3.39Å; V71-T74 PolarHBondContact O-N 3.16Å; V71-T74 VanDerWaalsContact O-N 3.1Å; T72-T74 PolarHBondContact O-N 3.44Å; T74-A77 PolarHBondContact O-N 3.36Å; T74-K78 PolarHBondContact O-N 3.42Å; T74-R79 HydrophobicContact CG2-CB 4Å; T74-R79 PolarHBondContact O-N 3.36Å; T74-T81 WeakPolarHBondContact CG2-O 3.38Å; T74-V82 HydrophobicContact CG2-CG2 4.3Å; T74-D86 PolarHBondContact OG1-OD2 2.96Å
75E98.2Very high97.7Very high133 Ų13383.3 Ų83.362%0.62142%0.42SS*.Hα-helixtrans-68.7-41.7179.2-71.3179163.500112V71 T72 A77 K78V71-E75 HydrophobicContact CG1-CG 4.15Å; V71-E75 WeakPolarHBondContact O-CG 3.44Å; V71-E75 PolarHBondContact O-N 3.05Å; T72-E75 PolarHBondContact O-N 2.87Å; E75-A77 PolarHBondContact O-N 2.97Å; E75-K78 WeakPolarHBondContact O-CA 3.42Å; E75-K78 PolarHBondContact O-N 3.18Å
76H97.4Very high97.7Very high168 Ų16880.6 Ų80.678%0.77841%0.406SS*.Hα-helixtrans-58-37.3175.4-175.971000111.8T72 Y73 K78T72-H76 WeakPolarHBondContact O-CB 3.42Å; T72-H76 PolarHBondContact O-N 2.81Å; Y73-H76 PolarHBondContact O-N 2.8Å; H76-K78 PolarHBondContact O-N 2.9Å
77A97.1Very high97.6Very high48 Ų4882.6 Ų82.640%0.39742%0.418SS..THydrogen-bonded Turntrans-80.27.8175.200000114.3Y73 T74 E75 R79Y73-A77 WeakPolarHBondContact O-CB 3.18Å; Y73-A77 PolarHBondContact O-N 3.38Å; Y73-A77 VanDerWaalsContact O-N 3.12Å; T74-A77 PolarHBondContact O-N 3.36Å; E75-A77 PolarHBondContact O-N 2.97Å; A77-R79 HydrophobicContact CB-CG 4.43Å; A77-R79 VanDerWaalsContact CB-NH2 3.31Å; A77-R79 PolarHBondContact O-N 2.96Å
78K97.8Very high97.6Very high202 Ų20279 Ų7988%0.87840%0.4SS*.THydrogen-bonded Turntrans55.829-178.1-56.3178.8-178.1176.70113.7T74 E75 H76T74-K78 PolarHBondContact O-N 3.42Å; E75-K78 WeakPolarHBondContact O-CA 3.42Å; E75-K78 PolarHBondContact O-N 3.18Å; H76-K78 PolarHBondContact O-N 2.9Å
79R98.2Very high97.5Very high89 Ų8978 Ų7834%0.33640%0.397SS..  trans-98.8157.2177.8-72.1179.7-76.7105.1-6.1110.6T74 A77 T81 D86T74-R79 HydrophobicContact CG2-CB 4Å; T74-R79 PolarHBondContact O-N 3.36Å; A77-R79 HydrophobicContact CB-CG 4.43Å; A77-R79 VanDerWaalsContact CB-NH2 3.31Å; A77-R79 PolarHBondContact O-N 2.96Å; R79-T81 PolarHBondContact NH1-O 3.17Å; R79-T81 VanDerWaalsContact NH1-O 3.17Å; R79-D86 IonicContact CZ-OD1 2.8Å; R79-D86 IonicContact CZ-OD2 3.67Å; R79-D86 IonicContact NH1-OD1 2.9Å; R79-D86 IonicContact NH1-OD2 3.58Å; R79-D86 PolarHBondContact NH1-OD2 3.38Å; R79-D86 IonicContact NH2-OD1 3.95Å; R79-D86 PolarHBondContact NH2-OD1 3.47Å; R79-D86 IonicContact NH2-OD2 2.8Å; R79-D86 PolarHBondContact NH2-OD2 3.1Å
80K97.6Very high97.5Very high214 Ų21477 Ų7793%0.9339%0.392SS*.SBendtrans-107.1-0.9170.6-65.8-176.9179.3177.40113
81T97.7Very high97.4Very high103 Ų10377.9 Ų77.963%0.63240%0.396SS*.SBendtrans-120.9118-176.1-56.30000108.4T74 R79T74-T81 WeakPolarHBondContact CG2-O 3.38Å; R79-T81 PolarHBondContact NH1-O 3.17Å; R79-T81 VanDerWaalsContact NH1-O 3.17Å
82V97.9Very high97.3Very high72 Ų7281.9 Ų81.944%0.43641%0.409SS..  trans-67.3128.7172.1-177.80000108.3A70 T74 D86 V87A70-V82 HydrophobicContact CB-CG1 4.4Å; T74-V82 HydrophobicContact CG2-CG2 4.3Å; V82-D86 HydrophobicContact CG1-CB 4.17Å; V82-V87 HydrophobicContact CG1-CG2 4.18Å
83T97Very high97.2Very high55 Ų5585.9 Ų85.934%0.33742%0.415SS..  trans-99.7165177.766.90000110.8M85 D86T83-M85 PolarHBondContact O-N 2.88Å; T83-D86 WeakPolarHBondContact CB-OD2 3.19Å; T83-D86 PolarHBondContact N-OD2 3.43Å; T83-D86 PolarHBondContact O-N 3.08Å; T83-D86 PolarHBondContact OG1-N 3.1Å; T83-D86 PolarHBondContact OG1-OD2 3.39Å
84A96.2Very high97Very high58 Ų5885 Ų8548%0.47941%0.414SS..Hα-helixtrans-58-37.3173.100000111.8D86 V87 V88A84-D86 PolarHBondContact O-N 3.5Å; A84-V87 PolarHBondContact O-N 3.12Å; A84-V88 WeakPolarHBondContact O-CG2 3.18Å; A84-V88 PolarHBondContact O-N 3.28Å
85M96.6Very high96.8Very high62 Ų6288 Ų8831%0.30545%0.446SS..Hα-helixtrans-66.1-35.5-179.9-66.8-52.4-6200112.9T83 V87 V88 Y89T83-M85 PolarHBondContact O-N 2.88Å; M85-V87 PolarHBondContact O-N 3.49Å; M85-V88 PolarHBondContact O-N 3.05Å; M85-Y89 HydrophobicContact CB-CE2 4.12Å; M85-Y89 HydrophobicContact CE-CD1 4.46Å; M85-Y89 HydrophobicContact CE-CE1 3.6Å; M85-Y89 HydrophobicContact CE-CE2 4.22Å; M85-Y89 VanDerWaalsContact CE-CZ 3.46Å; M85-Y89 VanDerWaalsContact CE-OH 3.32Å; M85-Y89 WeakPolarHBondContact CE-OH 3.36Å; M85-Y89 WeakPolarHBondContact O-CB 3.27Å; M85-Y89 WeakPolarHBondContact O-CD2 3.24Å; M85-Y89 PolarHBondContact O-N 3.45Å
86D97.2Very high96.7Very high5 Ų588.5 Ų88.53%0.02744%0.442CS..Hα-helixtrans-60.6-37.8175.7-58-50.5000111A70 T74 R79 V82 T83 A84 A90A70-D86 HydrophobicContact CB-CB 4.4Å; T74-D86 PolarHBondContact OG1-OD2 2.96Å; R79-D86 IonicContact CZ-OD1 2.8Å; R79-D86 IonicContact CZ-OD2 3.67Å; R79-D86 IonicContact NH1-OD1 2.9Å; R79-D86 IonicContact NH1-OD2 3.58Å; R79-D86 PolarHBondContact NH1-OD2 3.38Å; R79-D86 IonicContact NH2-OD1 3.95Å; R79-D86 PolarHBondContact NH2-OD1 3.47Å; R79-D86 IonicContact NH2-OD2 2.8Å; R79-D86 PolarHBondContact NH2-OD2 3.1Å; V82-D86 HydrophobicContact CG1-CB 4.17Å; T83-D86 WeakPolarHBondContact CB-OD2 3.19Å; T83-D86 PolarHBondContact N-OD2 3.43Å; T83-D86 PolarHBondContact O-N 3.08Å; T83-D86 PolarHBondContact OG1-N 3.1Å; T83-D86 PolarHBondContact OG1-OD2 3.39Å; A84-D86 PolarHBondContact O-N 3.5Å; D86-A90 WeakPolarHBondContact O-CB 2.94Å; D86-A90 PolarHBondContact O-N 3.06Å
87V97.4Very high96.5Very high53 Ų5384.2 Ų84.232%0.32143%0.428SS..Hα-helixtrans-72.6-43.3176.4-178.10000111.5V66 A70 V82 A84 M85 Y89 A90 L91V66-V87 HydrophobicContact CG1-CG1 4.39Å; A70-V87 HydrophobicContact CB-CG2 4.31Å; V82-V87 HydrophobicContact CG1-CG2 4.18Å; A84-V87 PolarHBondContact O-N 3.12Å; M85-V87 PolarHBondContact O-N 3.49Å; V87-Y89 VanDerWaalsContact C-N 3.3Å; V87-Y89 PolarHBondContact O-N 3.4Å; V87-A90 PolarHBondContact O-N 3.19Å; V87-L91 HydrophobicContact CG1-CD1 4.02Å; V87-L91 HydrophobicContact CG1-CG 4.37Å; V87-L91 WeakPolarHBondContact O-CB 3.49Å; V87-L91 WeakPolarHBondContact O-CG 3.49Å; V87-L91 PolarHBondContact O-N 2.87Å
88V97.1Very high96.4Very high20 Ų2085.5 Ų85.512%0.12143%0.427CS..Hα-helixtrans-59.2-43176.7171.60000110.7A84 M85 L91 K92 F101A84-V88 WeakPolarHBondContact O-CG2 3.18Å; A84-V88 PolarHBondContact O-N 3.28Å; M85-V88 PolarHBondContact O-N 3.05Å; V88-L91 PolarHBondContact O-N 3.08Å; V88-K92 WeakPolarHBondContact O-CB 3.34Å; V88-K92 PolarHBondContact O-N 3.04Å; V88-F101 HydrophobicContact CG2-CB 3.78Å
89Y95.9Very high96.2Very high116 Ų11685 Ų8546%0.45542%0.421SS..Hα-helixtrans-68.1-41.5177.1-63.1-30000112.7M85 V87 L91 K92 R93M85-Y89 HydrophobicContact CB-CE2 4.12Å; M85-Y89 HydrophobicContact CE-CD1 4.46Å; M85-Y89 HydrophobicContact CE-CE1 3.6Å; M85-Y89 HydrophobicContact CE-CE2 4.22Å; M85-Y89 VanDerWaalsContact CE-CZ 3.46Å; M85-Y89 VanDerWaalsContact CE-OH 3.32Å; M85-Y89 WeakPolarHBondContact CE-OH 3.36Å; M85-Y89 WeakPolarHBondContact O-CB 3.27Å; M85-Y89 WeakPolarHBondContact O-CD2 3.24Å; M85-Y89 PolarHBondContact O-N 3.45Å; V87-Y89 VanDerWaalsContact C-N 3.3Å; V87-Y89 PolarHBondContact O-N 3.4Å; Y89-L91 VanDerWaalsContact C-N 3.34Å; Y89-L91 PolarHBondContact O-N 3.31Å; Y89-K92 PolarHBondContact O-N 2.88Å; Y89-R93 PolarHBondContact O-N 3.41Å
90A97.3Very high95.9Very high0 Ų084.4 Ų84.40%044%0.443CS..Hα-helixtrans-59-45.1174.700000112V66 D69 A70 Y73 D86 V87 R93 Q94V66-A90 HydrophobicContact CG1-CB 4.32Å; D69-A90 HydrophobicContact CB-CB 3.72Å; A70-A90 HydrophobicContact CB-CB 4.16Å; Y73-A90 HydrophobicContact CE2-CB 4.29Å; D86-A90 WeakPolarHBondContact O-CB 2.94Å; D86-A90 PolarHBondContact O-N 3.06Å; V87-A90 PolarHBondContact O-N 3.19Å; A90-R93 PolarHBondContact O-N 2.75Å; A90-Q94 WeakPolarHBondContact O-CG 3.4Å; A90-Q94 PolarHBondContact O-N 2.9Å
91L97.1Very high95.6Very high22 Ų2280 Ų8012%0.11542%0.424CS..Hα-helixtrans-65.9-41.9177.2-72.6173.5000112.1F62 V66 V87 V88 Y89 R93 Q94 G95 R96 L98F62-L91 HydrophobicContact CZ-CD2 4.05Å; V66-L91 HydrophobicContact CG1-CD2 4.07Å; V66-L91 HydrophobicContact CG1-CG 4.26Å; V66-L91 HydrophobicContact CG2-CD2 3.82Å; V87-L91 HydrophobicContact CG1-CD1 4.02Å; V87-L91 HydrophobicContact CG1-CG 4.37Å; V87-L91 WeakPolarHBondContact O-CB 3.49Å; V87-L91 WeakPolarHBondContact O-CG 3.49Å; V87-L91 PolarHBondContact O-N 2.87Å; V88-L91 PolarHBondContact O-N 3.08Å; Y89-L91 VanDerWaalsContact C-N 3.34Å; Y89-L91 PolarHBondContact O-N 3.31Å; L91-R93 VanDerWaalsContact C-N 3.33Å; L91-R93 PolarHBondContact O-N 2.77Å; L91-Q94 CarbonylContact O-C 3.59Å; L91-Q94 PolarHBondContact O-N 3.16Å; L91-Q94 VanDerWaalsContact O-N 3.15Å; L91-G95 PolarHBondContact O-N 3.04Å; L91-R96 CarbonylContact C-O 3.44Å; L91-R96 WeakPolarHBondContact CB-O 3.43Å; L91-R96 HydrophobicContact CD2-CB 4.45Å; L91-R96 CarbonylContact O-C 3.57Å; L91-R96 WeakPolarHBondContact O-CA 3.41Å; L91-R96 PolarHBondContact O-N 2.89Å; L91-L98 HydrophobicContact CD1-CB 4.19Å; L91-L98 HydrophobicContact CD1-CD2 3.91Å
92K95.7Very high94.6Very high135 Ų13577.8 Ų77.859%0.58742%0.422SS*.Hα-helixtrans-60.3-41.9175.6-172.8177-179.3179.50111.8V88 Y89 Q94 G95V88-K92 WeakPolarHBondContact O-CB 3.34Å; V88-K92 PolarHBondContact O-N 3.04Å; Y89-K92 PolarHBondContact O-N 2.88Å; K92-Q94 PolarHBondContact O-N 3.23Å; K92-G95 PolarHBondContact O-N 2.77Å
93R95.4Very high92.7Very high164 Ų16481.8 Ų81.862%0.61948%0.477SS*.Hα-helixtrans-59.8-33.2175.9-178.1178.9176.6-1084.1112.7D69 Y89 A90 L91 G95D69-R93 IonicContact OD1-NH1 2.73Å; D69-R93 PolarHBondContact OD1-NH1 2.79Å; D69-R93 IonicContact OD2-CZ 3.44Å; D69-R93 IonicContact OD2-NH1 3.55Å; D69-R93 PolarHBondContact OD2-NH1 2.78Å; Y89-R93 PolarHBondContact O-N 3.41Å; A90-R93 PolarHBondContact O-N 2.75Å; L91-R93 VanDerWaalsContact C-N 3.33Å; L91-R93 PolarHBondContact O-N 2.77Å; R93-G95 VanDerWaalsContact C-N 3.27Å; R93-G95 PolarHBondContact O-N 3.2Å
94Q93.3Very high92.5Very high60 Ų6083.1 Ų83.128%0.2848%0.484SS..THydrogen-bonded Turntrans-87.410.6177.3-62.9178.112.700113.4N65 D69 A90 L91 K92 R96N65-Q94 PolarHBondContact O-NE2 2.91Å; D69-Q94 PolarHBondContact OD2-NE2 2.73Å; D69-Q94 VanDerWaalsContact OD2-NE2 3.16Å; A90-Q94 WeakPolarHBondContact O-CG 3.4Å; A90-Q94 PolarHBondContact O-N 2.9Å; L91-Q94 CarbonylContact O-C 3.59Å; L91-Q94 PolarHBondContact O-N 3.16Å; L91-Q94 VanDerWaalsContact O-N 3.15Å; K92-Q94 PolarHBondContact O-N 3.23Å; Q94-R96 VanDerWaalsContact C-N 3.33Å; Q94-R96 PolarHBondContact O-N 3.3Å
95G95.3Very high92.3Very high68 Ų6884.4 Ų84.470%0.70148%0.484SS*.THydrogen-bonded Turntrans74.418.8-179.300000114.4L91 K92 R93L91-G95 PolarHBondContact O-N 3.04Å; K92-G95 PolarHBondContact O-N 2.77Å; R93-G95 VanDerWaalsContact C-N 3.27Å; R93-G95 PolarHBondContact O-N 3.2Å
96R95.4Very high92.1Very high145 Ų14585.7 Ų85.755%0.54749%0.494SS..  trans-116.964.6-177.5-61.6-175.8-177.8-151.20.2111.4L91 Q94 L98L91-R96 CarbonylContact C-O 3.44Å; L91-R96 WeakPolarHBondContact CB-O 3.43Å; L91-R96 HydrophobicContact CD2-CB 4.45Å; L91-R96 CarbonylContact O-C 3.57Å; L91-R96 WeakPolarHBondContact O-CA 3.41Å; L91-R96 PolarHBondContact O-N 2.89Å; Q94-R96 VanDerWaalsContact C-N 3.33Å; Q94-R96 PolarHBondContact O-N 3.3Å; R96-L98 PolarHBondContact O-N 3.4Å
97T93.6Very high91.8Very high78 Ų7890.4 Ų90.448%0.47952%0.522SS..  trans-59.1129.7-178.5-57.30000111.9Y99T97-Y99 HydrophobicContact CG2-CE1 4.24Å; T97-Y99 HydrophobicContact CG2-CE2 4.34Å
98L94.7Very high91.4Very high74 Ų7492.8 Ų92.839%0.38753%0.534SS..  trans-114.9128.2179.7-175.666.4000110.3L91 R96 F101L91-L98 HydrophobicContact CD1-CB 4.19Å; L91-L98 HydrophobicContact CD1-CD2 3.91Å; R96-L98 PolarHBondContact O-N 3.4Å; L98-F101 HydrophobicContact CD1-CD2 4.44Å; L98-F101 HydrophobicContact CD1-CE2 4.25Å; L98-F101 HydrophobicContact CD2-CD2 3.61Å; L98-F101 HydrophobicContact CD2-CE2 3.78Å; L98-F101 HydrophobicContact CD2-CG 4.31Å; L98-F101 HydrophobicContact CG-CD2 3.73Å; L98-F101 HydrophobicContact CG-CE2 3.99Å
99Y93.6Very high91.1Very high192 Ų19297.6 Ų97.675%0.75356%0.562SS**  trans-100.1156.5178.6-59.8-78000111.7T97 F101T97-Y99 HydrophobicContact CG2-CE1 4.24Å; T97-Y99 HydrophobicContact CG2-CE2 4.34Å; Y99-F101 WeakPolarHBondContact O-CD2 3.45Å
100G92.9Very high90.7Very high77 Ų7796.3 Ų96.379%0.79457%0.569SS**SBendtrans88.511.4174.700000115.6
101F89.9Confident90.2Very high122 Ų122103.7 Ų103.754%0.53561%0.613SS.*  trans-127.411-178.6-66.5-90.7000113.5V88 L98 Y99V88-F101 HydrophobicContact CG2-CB 3.78Å; L98-F101 HydrophobicContact CD1-CD2 4.44Å; L98-F101 HydrophobicContact CD1-CE2 4.25Å; L98-F101 HydrophobicContact CD2-CD2 3.61Å; L98-F101 HydrophobicContact CD2-CE2 3.78Å; L98-F101 HydrophobicContact CD2-CG 4.31Å; L98-F101 HydrophobicContact CG-CD2 3.73Å; L98-F101 HydrophobicContact CG-CE2 3.99Å; Y99-F101 WeakPolarHBondContact O-CD2 3.45Å
102G77.4Confident89.6Confident56 Ų56110.5 Ų110.558%0.57766%0.655SS**  trans-111.9126.1171.200000109.3
103G58.7Low89.1Confident155 Ų155108.3 Ų108.3100%1.59866%0.661SS**  trans-90.3016900000111.3

Retrieved 103 of 103 residues in 75.2 ms (Link to these results)