Q99NJ0_HETGA Loading...

Zinc finger protein ZFX

AlphaFold DB (Q9BYX9), UniProt , Accession Q99NJ0, Species HETGA (Heterocephalus glaber, Naked mole rat), Gene ZFX, Length 68 aa.

						>Q99NJ0_HETGA|Q99NJ0|ZFX
LTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAEKAIE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	74.3	Confident	87.8	Confident	219 Å²	219	96.7 Å²	96.7	100%	1.147	53%	0.533	S	S	*	.				0	105.5	0	-75.5	161.2	0	0	0	108.7	V3	L1-V3 PolarHBondContact O-N 3.39Å
2	T	83.1	Confident	88.3	Confident	110 Å²	110	101.8 Å²	101.8	68%	0.675	55%	0.546	S	S	*	.			trans	-67.4	115	176.3	-53.2	0	0	0	0	109.3	Y4	T2-Y4 HydrophobicContact CG2-CE2 4.34Å
3	V	89.6	Confident	88.7	Confident	78 Å²	78	97 Å²	97	47%	0.473	52%	0.517	S	S	.	.			trans	-97.2	141.6	178.7	-68.3	0	0	0	0	110.4	L1 P5	L1-V3 PolarHBondContact O-N 3.39Å; V3-P5 VanDerWaalsContact O-CD 3.3Å; V3-P5 WeakPolarHBondContact O-CD 3.21Å
4	Y	92.1	Very high	89	Confident	83 Å²	83	102.4 Å²	102.4	33%	0.325	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	97.2	177.5	-66.4	-88.5	0	0	0	108.9	T2 F13 S15 R16	T2-Y4 HydrophobicContact CG2-CE2 4.34Å; Y4-F13 PolarHBondContact N-O 2.9Å; Y4-F13 PolarHBondContact O-N 2.83Å; Y4-S15 VanDerWaalsContact CD2-C 3.45Å; Y4-R16 HydrophobicContact CD1-CB 4.02Å; Y4-R16 HydrophobicContact CD1-CG 4.4Å; Y4-R16 HydrophobicContact CE1-CB 3.83Å; Y4-R16 HydrophobicContact CE1-CG 4.34Å; Y4-R16 HydrophobicContact CG-CB 4.45Å
5	P	92.4	Very high	89.3	Confident	70 Å²	70	98.3 Å²	98.3	46%	0.455	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.5	143	-179.3	30.8	-33.9	0	0	0	111.8	V3 K11	V3-P5 VanDerWaalsContact O-CD 3.3Å; V3-P5 WeakPolarHBondContact O-CD 3.21Å; P5-K11 CarbonylContact C-O 3.58Å
6	C	90.3	Very high	89.4	Confident	3 Å²	3	104 Å²	104	2%	0.02	53%	0.529	C	S	.	.			trans	-73.7	122.9	165.5	174.2	0	0	0	0	109.5	I8 C9 G10 K11 F13 L19 H22 M23 H26	C6-I8 PolarHBondContact O-N 3.49Å; C6-I8 PolarHBondContact SG-N 2.84Å; C6-C9 PolarHBondContact SG-N 2.96Å; C6-C9 VanDerWaalsContact SG-N 3.35Å; C6-C9 PolarHBondContact SG-SG 3.11Å; C6-G10 WeakPolarHBondContact O-CA 3.49Å; C6-G10 PolarHBondContact O-N 3.1Å; C6-K11 HydrophobicContact CB-CB 4.4Å; C6-K11 WeakPolarHBondContact CB-O 3.48Å; C6-K11 PolarHBondContact N-O 3.12Å; C6-F13 HydrophobicContact CB-CE2 4.2Å; C6-L19 HydrophobicContact CB-CD1 4.03Å; C6-H22 PolarHBondContact SG-NE2 3.45Å; C6-H22 VanDerWaalsContact SG-NE2 3.44Å; C6-M23 HydrophobicContact CB-CE 3.76Å; C6-M23 WeakPolarHBondContact SG-CE 3.39Å; C6-H26 PolarHBondContact SG-NE2 3.31Å
7	M	87.3	Confident	89.6	Confident	187 Å²	187	100.8 Å²	100.8	92%	0.921	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.4	-6.2	178.3	-59.1	-158.4	-61.7	0	0	113.7
8	I	85.4	Confident	89.8	Confident	68 Å²	68	99.4 Å²	99.4	35%	0.349	52%	0.517	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.3	-53.2	-177.9	-60.5	166.1	0	0	0	110.9	C6 M23 H26 E28	C6-I8 PolarHBondContact O-N 3.49Å; C6-I8 PolarHBondContact SG-N 2.84Å; I8-M23 HydrophobicContact CD1-SD 4.09Å; I8-H26 HydrophobicContact CD1-CB 3.67Å; I8-H26 VanDerWaalsContact CD1-CG 3.48Å; I8-H26 WeakPolarHBondContact CG2-CE1 3.18Å; I8-H26 VanDerWaalsContact CG2-ND1 3.26Å; I8-H26 WeakPolarHBondContact CG2-ND1 2.96Å; I8-E28 HydrophobicContact CD1-CG 3.64Å; I8-E28 WeakPolarHBondContact CD1-OE2 3.5Å; I8-E28 HydrophobicContact CG1-CG 4.23Å; I8-E28 WeakPolarHBondContact CG1-OE2 3.33Å; I8-E28 VanDerWaalsContact CG2-OE1 3.28Å; I8-E28 WeakPolarHBondContact CG2-OE1 3.41Å; I8-E28 WeakPolarHBondContact CG2-OE2 3.34Å
9	C	89.8	Confident	89.9	Confident	65 Å²	65	95.8 Å²	95.8	44%	0.439	50%	0.499	S	S	.	.	T	Hydrogen-bonded Turn	trans	-117	3.1	-175.8	66.9	0	0	0	0	113.9	C6 K11 H22 H26	C6-C9 PolarHBondContact SG-N 2.96Å; C6-C9 VanDerWaalsContact SG-N 3.35Å; C6-C9 PolarHBondContact SG-SG 3.11Å; C9-K11 PolarHBondContact O-N 3.29Å; C9-K11 VanDerWaalsContact O-N 3.11Å; C9-H22 PolarHBondContact SG-NE2 3.44Å; C9-H26 PolarHBondContact SG-NE2 3.28Å
10	G	89.8	Confident	89.9	Confident	46 Å²	46	98.7 Å²	98.7	47%	0.474	51%	0.507	S	S	.	.			trans	73.8	-4.2	178.3	0	0	0	0	0	115.8	C6 K12	C6-G10 WeakPolarHBondContact O-CA 3.49Å; C6-G10 PolarHBondContact O-N 3.1Å; G10-K12 PolarHBondContact O-N 2.84Å
11	K	92.2	Very high	89.9	Confident	135 Å²	135	101.5 Å²	101.5	59%	0.587	51%	0.511	S	S	*	.			trans	-57.1	131.8	178.2	-89.8	-170.1	174.5	-175.3	0	111.6	P5 C6 C9 F13	P5-K11 CarbonylContact C-O 3.58Å; C6-K11 HydrophobicContact CB-CB 4.4Å; C6-K11 WeakPolarHBondContact CB-O 3.48Å; C6-K11 PolarHBondContact N-O 3.12Å; C9-K11 PolarHBondContact O-N 3.29Å; C9-K11 VanDerWaalsContact O-N 3.11Å; K11-F13 HydrophobicContact CB-CE2 3.71Å; K11-F13 HydrophobicContact CB-CZ 3.92Å; K11-F13 HydrophobicContact CD-CZ 4.44Å; K11-F13 WeakPolarHBondContact O-CD2 3.46Å; K11-F13 WeakPolarHBondContact O-CE2 3.43Å
12	K	93.9	Very high	90.7	Very high	157 Å²	157	92.5 Å²	92.5	68%	0.683	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.2	133.6	-179.4	-61.4	178.1	-177	176.6	0	110.6	G10	G10-K12 PolarHBondContact O-N 2.84Å
13	F	93.4	Very high	90.9	Very high	40 Å²	40	89 Å²	89	18%	0.175	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	147.9	178.1	-62.2	-88.4	0	0	0	111.1	Y4 C6 K11 S15 F18 L19 H22	Y4-F13 PolarHBondContact N-O 2.9Å; Y4-F13 PolarHBondContact O-N 2.83Å; C6-F13 HydrophobicContact CB-CE2 4.2Å; K11-F13 HydrophobicContact CB-CE2 3.71Å; K11-F13 HydrophobicContact CB-CZ 3.92Å; K11-F13 HydrophobicContact CD-CZ 4.44Å; K11-F13 WeakPolarHBondContact O-CD2 3.46Å; K11-F13 WeakPolarHBondContact O-CE2 3.43Å; F13-S15 VanDerWaalsContact C-N 3.27Å; F13-S15 PolarHBondContact O-N 3.26Å; F13-F18 HydrophobicContact CB-CB 4.14Å; F13-F18 HydrophobicContact CD1-CB 3.85Å; F13-F18 HydrophobicContact CG-CB 4.32Å; F13-L19 HydrophobicContact CB-CB 4.28Å; F13-L19 HydrophobicContact CD2-CB 4.15Å; F13-L19 HydrophobicContact CD2-CD1 3.76Å; F13-L19 HydrophobicContact CE2-CD1 4.07Å; F13-L19 HydrophobicContact CG-CB 4.32Å; F13-H22 HydrophobicContact CE1-CB 3.83Å; F13-H22 HydrophobicContact CE2-CB 4.02Å; F13-H22 AromaticContact CE2-CD2 3.17Å; F13-H22 WeakPolarHBondContact CE2-CD2 3.38Å; F13-H22 AromaticContact CE2-CG 3.66Å; F13-H22 AromaticContact CE2-NE2 3.73Å; F13-H22 HydrophobicContact CZ-CB 3.47Å; F13-H22 VanDerWaalsContact CZ-CB 3.47Å; F13-H22 AromaticContact CZ-CD2 3.2Å; F13-H22 WeakPolarHBondContact CZ-CD2 3.33Å; F13-H22 AromaticContact CZ-CG 3.19Å; F13-H22 AromaticContact CZ-ND1 3.72Å; F13-H22 AromaticContact CZ-NE2 3.71Å
14	K	92.5	Very high	90.6	Very high	173 Å²	173	91.6 Å²	91.6	75%	0.752	44%	0.444	S	S	*	.	S	Bend	trans	-74.5	-13.1	178	65.6	-179.6	178.6	-178.6	0	114.4	F18	K14-F18 HydrophobicContact CD-CE2 4.38Å; K14-F18 VanDerWaalsContact CE-CE2 3.46Å; K14-F18 HydrophobicContact CG-CD2 3.89Å; K14-F18 HydrophobicContact CG-CE2 4.1Å
15	S	93.8	Very high	90.2	Very high	40 Å²	40	93.5 Å²	93.5	28%	0.28	46%	0.46	S	S	.	.	S	Bend	trans	-151.7	156.1	176.9	85.2	0	0	0	0	112.3	Y4 F13 G17 F18 L19	Y4-S15 VanDerWaalsContact CD2-C 3.45Å; F13-S15 VanDerWaalsContact C-N 3.27Å; F13-S15 PolarHBondContact O-N 3.26Å; S15-G17 PolarHBondContact O-N 3.38Å; S15-G17 PolarHBondContact OG-N 3.26Å; S15-F18 PolarHBondContact O-N 3.1Å; S15-F18 WeakPolarHBondContact OG-CD2 3.48Å; S15-F18 PolarHBondContact OG-N 3.46Å; S15-L19 PolarHBondContact O-N 3.3Å; S15-L19 VanDerWaalsContact O-N 3.16Å
16	R	90.2	Very high	89.9	Confident	190 Å²	190	91 Å²	91	72%	0.717	44%	0.443	S	S	*	.	H	α-helix	trans	-60.7	-31.6	174.9	-166.6	173.3	179.7	150.3	-0.3	112.6	Y4 L19 K20	Y4-R16 HydrophobicContact CD1-CB 4.02Å; Y4-R16 HydrophobicContact CD1-CG 4.4Å; Y4-R16 HydrophobicContact CE1-CB 3.83Å; Y4-R16 HydrophobicContact CE1-CG 4.34Å; Y4-R16 HydrophobicContact CG-CB 4.45Å; R16-L19 PolarHBondContact O-N 3.21Å; R16-K20 WeakPolarHBondContact O-CB 3.42Å; R16-K20 PolarHBondContact O-N 3.36Å
17	G	92.6	Very high	89.1	Confident	49 Å²	49	95.4 Å²	95.4	51%	0.505	47%	0.471	S	S	.	.	H	α-helix	trans	-65	-44.7	177	0	0	0	0	0	112.6	S15 K20 R21	S15-G17 PolarHBondContact O-N 3.38Å; S15-G17 PolarHBondContact OG-N 3.26Å; G17-K20 PolarHBondContact O-N 3.34Å; G17-R21 PolarHBondContact O-N 3.21Å
18	F	93.1	Very high	88	Confident	77 Å²	77	89.9 Å²	89.9	34%	0.338	44%	0.443	S	S	.	.	H	α-helix	trans	-65.2	-42.4	175.3	-71.1	-65.5	0	0	0	111.8	F13 K14 S15 K20 R21 H22	F13-F18 HydrophobicContact CB-CB 4.14Å; F13-F18 HydrophobicContact CD1-CB 3.85Å; F13-F18 HydrophobicContact CG-CB 4.32Å; K14-F18 HydrophobicContact CD-CE2 4.38Å; K14-F18 VanDerWaalsContact CE-CE2 3.46Å; K14-F18 HydrophobicContact CG-CD2 3.89Å; K14-F18 HydrophobicContact CG-CE2 4.1Å; S15-F18 PolarHBondContact O-N 3.1Å; S15-F18 WeakPolarHBondContact OG-CD2 3.48Å; S15-F18 PolarHBondContact OG-N 3.46Å; F18-K20 VanDerWaalsContact C-N 3.35Å; F18-K20 PolarHBondContact O-N 2.96Å; F18-R21 PolarHBondContact O-N 3.26Å; F18-H22 WeakPolarHBondContact O-CB 3.41Å; F18-H22 PolarHBondContact O-N 3.36Å
19	L	93.1	Very high	87.2	Confident	30 Å²	30	89.8 Å²	89.8	16%	0.157	44%	0.441	C	S	.	.	H	α-helix	trans	-57.2	-47.5	173.7	176.6	63.9	0	0	0	111.1	C6 F13 S15 R16 R21 H22 M23	C6-L19 HydrophobicContact CB-CD1 4.03Å; F13-L19 HydrophobicContact CB-CB 4.28Å; F13-L19 HydrophobicContact CD2-CB 4.15Å; F13-L19 HydrophobicContact CD2-CD1 3.76Å; F13-L19 HydrophobicContact CE2-CD1 4.07Å; F13-L19 HydrophobicContact CG-CB 4.32Å; S15-L19 PolarHBondContact O-N 3.3Å; S15-L19 VanDerWaalsContact O-N 3.16Å; R16-L19 PolarHBondContact O-N 3.21Å; L19-R21 PolarHBondContact O-N 3.28Å; L19-H22 WeakPolarHBondContact O-CB 3.31Å; L19-H22 PolarHBondContact O-N 3.3Å; L19-H22 VanDerWaalsContact O-N 3.15Å; L19-M23 HydrophobicContact CD1-CE 3.52Å; L19-M23 HydrophobicContact CD1-SD 4.41Å; L19-M23 HydrophobicContact CG-CE 4.47Å; L19-M23 WeakPolarHBondContact O-CG 3.49Å; L19-M23 PolarHBondContact O-N 3.3Å
20	K	88.8	Confident	86	Confident	153 Å²	153	91.1 Å²	91.1	67%	0.665	44%	0.443	S	S	*	.	H	α-helix	trans	-61.3	-39.9	179.5	-172.1	175.7	-176.7	178	0	112.7	R16 G17 F18	R16-K20 WeakPolarHBondContact O-CB 3.42Å; R16-K20 PolarHBondContact O-N 3.36Å; G17-K20 PolarHBondContact O-N 3.34Å; F18-K20 VanDerWaalsContact C-N 3.35Å; F18-K20 PolarHBondContact O-N 2.96Å
21	R	89.8	Confident	84.7	Confident	159 Å²	159	91.4 Å²	91.4	60%	0.6	44%	0.441	S	S	*	.	H	α-helix	trans	-66.5	-42.4	174.4	-176.9	173	66.8	-177.3	4.4	111.2	G17 F18 L19 K24 N25	G17-R21 PolarHBondContact O-N 3.21Å; F18-R21 PolarHBondContact O-N 3.26Å; L19-R21 PolarHBondContact O-N 3.28Å; R21-K24 WeakPolarHBondContact O-CB 3.47Å; R21-K24 PolarHBondContact O-N 3.29Å; R21-N25 PolarHBondContact O-ND2 3.19Å
22	H	91.2	Very high	83.2	Confident	30 Å²	30	93.7 Å²	93.7	14%	0.139	45%	0.451	C	S	.	.	H	α-helix	trans	-61.2	-43.1	176.9	168	64	0	0	0	112.2	C6 C9 F13 F18 L19 K24 N25 H26	C6-H22 PolarHBondContact SG-NE2 3.45Å; C6-H22 VanDerWaalsContact SG-NE2 3.44Å; C9-H22 PolarHBondContact SG-NE2 3.44Å; F13-H22 HydrophobicContact CE1-CB 3.83Å; F13-H22 HydrophobicContact CE2-CB 4.02Å; F13-H22 AromaticContact CE2-CD2 3.17Å; F13-H22 WeakPolarHBondContact CE2-CD2 3.38Å; F13-H22 AromaticContact CE2-CG 3.66Å; F13-H22 AromaticContact CE2-NE2 3.73Å; F13-H22 HydrophobicContact CZ-CB 3.47Å; F13-H22 VanDerWaalsContact CZ-CB 3.47Å; F13-H22 AromaticContact CZ-CD2 3.2Å; F13-H22 WeakPolarHBondContact CZ-CD2 3.33Å; F13-H22 AromaticContact CZ-CG 3.19Å; F13-H22 AromaticContact CZ-ND1 3.72Å; F13-H22 AromaticContact CZ-NE2 3.71Å; F18-H22 WeakPolarHBondContact O-CB 3.41Å; F18-H22 PolarHBondContact O-N 3.36Å; L19-H22 WeakPolarHBondContact O-CB 3.31Å; L19-H22 PolarHBondContact O-N 3.3Å; L19-H22 VanDerWaalsContact O-N 3.15Å; H22-K24 PolarHBondContact O-N 2.78Å; H22-N25 WeakPolarHBondContact O-CB 3.39Å; H22-N25 PolarHBondContact O-N 3Å; H22-N25 PolarHBondContact O-ND2 3.41Å; H22-H26 AromaticContact CD2-NE2 3.86Å; H22-H26 AromaticContact CE1-CD2 3.87Å; H22-H26 AromaticContact CE1-NE2 3.22Å; H22-H26 PolarHBondContact CE1-NE2 3.36Å; H22-H26 AromaticContact NE2-CD2 3.71Å; H22-H26 AromaticContact NE2-NE2 3.01Å; H22-H26 PolarHBondContact NE2-NE2 3.28Å
23	M	86.9	Confident	81.8	Confident	37 Å²	37	91.1 Å²	91.1	18%	0.182	44%	0.44	C	S	.	.	H	α-helix	trans	-53.2	-31.8	177.1	-69.8	-55.6	91.8	0	0	113	C6 I8 L19 N25 H26 H29	C6-M23 HydrophobicContact CB-CE 3.76Å; C6-M23 WeakPolarHBondContact SG-CE 3.39Å; I8-M23 HydrophobicContact CD1-SD 4.09Å; L19-M23 HydrophobicContact CD1-CE 3.52Å; L19-M23 HydrophobicContact CD1-SD 4.41Å; L19-M23 HydrophobicContact CG-CE 4.47Å; L19-M23 WeakPolarHBondContact O-CG 3.49Å; L19-M23 PolarHBondContact O-N 3.3Å; M23-N25 PolarHBondContact O-N 3.34Å; M23-H26 PolarHBondContact O-N 3.09Å; M23-H26 VanDerWaalsContact O-N 3.16Å; M23-H29 WeakPolarHBondContact O-CB 3.44Å; M23-H29 VanDerWaalsContact O-CG 3.23Å
24	K	84.4	Confident	80.7	Confident	131 Å²	131	95.1 Å²	95.1	57%	0.57	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.1	-23.2	178.1	-62.6	-178.8	-180	-178	0	113.9	R21 H22 H26	R21-K24 WeakPolarHBondContact O-CB 3.47Å; R21-K24 PolarHBondContact O-N 3.29Å; H22-K24 PolarHBondContact O-N 2.78Å; K24-H26 VanDerWaalsContact C-N 3.34Å
25	N	84.4	Confident	80.2	Confident	123 Å²	123	91.4 Å²	91.4	66%	0.658	44%	0.439	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.7	-8.5	179.1	-61.7	-82.1	0	0	0	112.4	R21 H22 M23	R21-N25 PolarHBondContact O-ND2 3.19Å; H22-N25 WeakPolarHBondContact O-CB 3.39Å; H22-N25 PolarHBondContact O-N 3Å; H22-N25 PolarHBondContact O-ND2 3.41Å; M23-N25 PolarHBondContact O-N 3.34Å
26	H	84.9	Confident	79.7	Confident	18 Å²	18	98 Å²	98	8%	0.083	46%	0.458	C	S	.	.			trans	-76.3	128.5	177.8	-86.5	-70.7	0	0	0	111	C6 I8 C9 H22 M23 K24 E28 H29 L30	C6-H26 PolarHBondContact SG-NE2 3.31Å; I8-H26 HydrophobicContact CD1-CB 3.67Å; I8-H26 VanDerWaalsContact CD1-CG 3.48Å; I8-H26 WeakPolarHBondContact CG2-CE1 3.18Å; I8-H26 VanDerWaalsContact CG2-ND1 3.26Å; I8-H26 WeakPolarHBondContact CG2-ND1 2.96Å; C9-H26 PolarHBondContact SG-NE2 3.28Å; H22-H26 AromaticContact CD2-NE2 3.86Å; H22-H26 AromaticContact CE1-CD2 3.87Å; H22-H26 AromaticContact CE1-NE2 3.22Å; H22-H26 PolarHBondContact CE1-NE2 3.36Å; H22-H26 AromaticContact NE2-CD2 3.71Å; H22-H26 AromaticContact NE2-NE2 3.01Å; H22-H26 PolarHBondContact NE2-NE2 3.28Å; M23-H26 PolarHBondContact O-N 3.09Å; M23-H26 VanDerWaalsContact O-N 3.16Å; K24-H26 VanDerWaalsContact C-N 3.34Å; H26-E28 HydrophobicContact CB-CG 4.49Å; H26-E28 IonicContact CG-OE1 3.81Å; H26-E28 IonicContact ND1-OE1 3.49Å; H26-E28 PolarHBondContact ND1-OE1 3.3Å; H26-E28 PolarHBondContact O-N 3.03Å; H26-H29 HydrophobicContact CB-CB 4.13Å; H26-H29 WeakPolarHBondContact O-CB 3.25Å; H26-H29 PolarHBondContact O-N 2.71Å; H26-L30 PolarHBondContact O-N 2.9Å; H26-L30 VanDerWaalsContact O-N 3.11Å
27	P	72.7	Confident	79.5	Confident	95 Å²	95	89 Å²	89	62%	0.617	43%	0.425	S	S	*	.	H	α-helix	trans	-61.9	-31.5	179	24.2	-32.1	0	0	0	112.1	H29 L30 A31	P27-H29 VanDerWaalsContact C-N 3.32Å; P27-H29 PolarHBondContact O-N 3.34Å; P27-L30 WeakPolarHBondContact O-CB 3.29Å; P27-L30 PolarHBondContact O-N 2.9Å; P27-A31 PolarHBondContact O-N 3.12Å
28	E	66	Low	79.1	Confident	72 Å²	72	92.5 Å²	92.5	34%	0.336	44%	0.436	S	S	.	.	H	α-helix	trans	-72.5	-25.4	174	70.7	-112	77.1	0	0	113.3	I8 H26 L30 A31 K32	I8-E28 HydrophobicContact CD1-CG 3.64Å; I8-E28 WeakPolarHBondContact CD1-OE2 3.5Å; I8-E28 HydrophobicContact CG1-CG 4.23Å; I8-E28 WeakPolarHBondContact CG1-OE2 3.33Å; I8-E28 VanDerWaalsContact CG2-OE1 3.28Å; I8-E28 WeakPolarHBondContact CG2-OE1 3.41Å; I8-E28 WeakPolarHBondContact CG2-OE2 3.34Å; H26-E28 HydrophobicContact CB-CG 4.49Å; H26-E28 IonicContact CG-OE1 3.81Å; H26-E28 IonicContact ND1-OE1 3.49Å; H26-E28 PolarHBondContact ND1-OE1 3.3Å; H26-E28 PolarHBondContact O-N 3.03Å; E28-L30 VanDerWaalsContact C-N 3.33Å; E28-A31 PolarHBondContact O-N 3.18Å; E28-K32 WeakPolarHBondContact O-CB 3.15Å; E28-K32 VanDerWaalsContact O-CG 3.31Å; E28-K32 WeakPolarHBondContact O-CG 3.28Å; E28-K32 PolarHBondContact O-N 2.9Å
29	H	67.8	Low	78.6	Confident	66 Å²	66	94 Å²	94	31%	0.306	45%	0.448	S	S	.	.	H	α-helix	trans	-73.2	-34.8	173.4	-178.9	-79.5	0	0	0	109.5	M23 H26 P27 A31 K33	M23-H29 WeakPolarHBondContact O-CB 3.44Å; M23-H29 VanDerWaalsContact O-CG 3.23Å; H26-H29 HydrophobicContact CB-CB 4.13Å; H26-H29 WeakPolarHBondContact O-CB 3.25Å; H26-H29 PolarHBondContact O-N 2.71Å; P27-H29 VanDerWaalsContact C-N 3.32Å; P27-H29 PolarHBondContact O-N 3.34Å; H29-A31 VanDerWaalsContact C-N 3.35Å; H29-K33 WeakPolarHBondContact O-CB 3.35Å; H29-K33 PolarHBondContact O-N 3.18Å
30	L	63.7	Low	78.4	Confident	92 Å²	92	94.8 Å²	94.8	48%	0.482	46%	0.455	S	S	.	.	H	α-helix	trans	-61.5	-43.8	167.5	-76.7	142.5	0	0	0	110.8	H26 P27 E28 K33 K34	H26-L30 PolarHBondContact O-N 2.9Å; H26-L30 VanDerWaalsContact O-N 3.11Å; P27-L30 WeakPolarHBondContact O-CB 3.29Å; P27-L30 PolarHBondContact O-N 2.9Å; E28-L30 VanDerWaalsContact C-N 3.33Å; L30-K33 PolarHBondContact O-N 3.13Å; L30-K34 WeakPolarHBondContact O-CG 3.27Å; L30-K34 PolarHBondContact O-N 3.26Å
31	A	62.4	Low	78.2	Confident	53 Å²	53	94.5 Å²	94.5	44%	0.438	46%	0.461	S	S	.	.	H	α-helix	trans	-65.3	-41.9	176.9	0	0	0	0	0	113.2	P27 E28 H29 K33 K34	P27-A31 PolarHBondContact O-N 3.12Å; E28-A31 PolarHBondContact O-N 3.18Å; H29-A31 VanDerWaalsContact C-N 3.35Å; A31-K33 PolarHBondContact O-N 3.14Å; A31-K34 VanDerWaalsContact O-CB 3.29Å; A31-K34 WeakPolarHBondContact O-CB 3.34Å; A31-K34 PolarHBondContact O-N 3.45Å
32	K	62	Low	77.9	Confident	182 Å²	182	91.4 Å²	91.4	79%	0.791	45%	0.45	S	S	*	.	H	α-helix	trans	-69.6	-20.5	175.2	-73.6	178.5	-179.3	-179.2	0	113.3	E28 K34	E28-K32 WeakPolarHBondContact O-CB 3.15Å; E28-K32 VanDerWaalsContact O-CG 3.31Å; E28-K32 WeakPolarHBondContact O-CG 3.28Å; E28-K32 PolarHBondContact O-N 2.9Å; K32-K34 VanDerWaalsContact C-N 3.33Å
33	K	63.5	Low	77.6	Confident	104 Å²	104	93 Å²	93	45%	0.452	46%	0.462	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90.7	0.3	176	-153.8	178.9	-175.7	-167.2	0	112.6	H29 L30 A31 Y35 N45	H29-K33 WeakPolarHBondContact O-CB 3.35Å; H29-K33 PolarHBondContact O-N 3.18Å; L30-K33 PolarHBondContact O-N 3.13Å; A31-K33 PolarHBondContact O-N 3.14Å; K33-Y35 WeakPolarHBondContact O-CD2 3.18Å; K33-Y35 PolarHBondContact O-N 3.31Å; K33-N45 WeakPolarHBondContact O-CA 3.4Å
34	K	70.9	Confident	77.5	Confident	124 Å²	124	92 Å²	92	54%	0.539	46%	0.458	S	S	.	.			trans	-76.8	109.2	170.4	-70.7	-178.5	-171.5	-173.7	0	108.9	L30 A31 K32 T43 T44	L30-K34 WeakPolarHBondContact O-CG 3.27Å; L30-K34 PolarHBondContact O-N 3.26Å; A31-K34 VanDerWaalsContact O-CB 3.29Å; A31-K34 WeakPolarHBondContact O-CB 3.34Å; A31-K34 PolarHBondContact O-N 3.45Å; K32-K34 VanDerWaalsContact C-N 3.33Å; K34-T43 HydrophobicContact CB-CG2 3.49Å; K34-T43 VanDerWaalsContact CB-CG2 3.49Å; K34-T43 HydrophobicContact CD-CG2 3.79Å; K34-T43 HydrophobicContact CG-CG2 3.89Å; K34-T44 CarbonylContact C-O 3.46Å; K34-T44 WeakPolarHBondContact CA-O 3.33Å
35	Y	81.7	Confident	77.3	Confident	94 Å²	94	89.9 Å²	89.9	37%	0.369	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.6	114.9	164.3	-63.2	-85.6	0	0	0	108	K33 T43 T44 K47 L50	K33-Y35 WeakPolarHBondContact O-CD2 3.18Å; K33-Y35 PolarHBondContact O-N 3.31Å; Y35-T43 WeakPolarHBondContact O-CA 3.26Å; Y35-T44 PolarHBondContact N-O 3.48Å; Y35-T44 PolarHBondContact O-N 3.34Å; Y35-K47 HydrophobicContact CD2-CB 4.48Å; Y35-K47 HydrophobicContact CE1-CB 3.99Å; Y35-K47 HydrophobicContact CE1-CG 4.09Å; Y35-K47 HydrophobicContact CE2-CB 3.98Å; Y35-L50 HydrophobicContact CD1-CD2 4.42Å; Y35-L50 HydrophobicContact CG-CD2 4.45Å
36	R	83.6	Confident	77.2	Confident	179 Å²	179	90.2 Å²	90.2	68%	0.675	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.4	138.5	178.1	-163.8	178.7	104.3	167.6	4.6	109.7
37	C	86.2	Confident	77.2	Confident	2 Å²	2	96.5 Å²	96.5	1%	0.014	48%	0.475	C	S	.	.			trans	-68.7	147.6	168.3	-168.8	0	0	0	0	110.4	D39 C40 Y42 L50 H53	C37-D39 PolarHBondContact SG-N 2.89Å; C37-D39 VanDerWaalsContact SG-N 3.45Å; C37-C40 WeakPolarHBondContact CB-O 3.06Å; C37-Y42 WeakPolarHBondContact CB-O 3.19Å; C37-Y42 PolarHBondContact N-O 3.38Å; C37-L50 HydrophobicContact CB-CD1 4.02Å; C37-H53 VanDerWaalsContact SG-CD2 3.51Å; C37-H53 PolarHBondContact SG-NE2 3Å
38	T	84.2	Confident	77.9	Confident	121 Å²	121	98 Å²	98	74%	0.742	48%	0.477	S	S	*	.	S	Bend	trans	-86.1	-27.9	175.7	39.3	0	0	0	0	112.1
39	D	83.4	Confident	79	Confident	109 Å²	109	96.5 Å²	96.5	58%	0.583	47%	0.474	S	S	*	.	S	Bend	trans	-97.6	-11.3	-171.2	-54.4	-94.9	0	0	0	112.6	C37	C37-D39 PolarHBondContact SG-N 2.89Å; C37-D39 VanDerWaalsContact SG-N 3.45Å
40	C	86.9	Confident	80	Confident	47 Å²	47	94.5 Å²	94.5	32%	0.318	47%	0.466	S	S	.	.	S	Bend	trans	-158.7	177.2	173.1	71.3	0	0	0	0	112.5	C37 Y42 H53 H57	C37-C40 WeakPolarHBondContact CB-O 3.06Å; C40-Y42 PolarHBondContact O-N 3.26Å; C40-Y42 VanDerWaalsContact O-N 3.1Å; C40-Y42 WeakPolarHBondContact SG-CB 3.4Å; C40-H53 VanDerWaalsContact SG-CE1 3.5Å; C40-H53 PolarHBondContact SG-NE2 3.29Å; C40-H57 PolarHBondContact SG-NE2 3.2Å; C40-H57 VanDerWaalsContact SG-NE2 3.36Å
41	D	84.6	Confident	81.2	Confident	147 Å²	147	95.3 Å²	95.3	79%	0.786	47%	0.467	S	S	*	.	S	Bend	trans	-73.8	7.2	179.2	-68.1	-79	0	0	0	115.1	T43	D41-T43 PolarHBondContact O-N 3.45Å; D41-T43 PolarHBondContact O-OG1 3.21Å
42	Y	84.2	Confident	82.5	Confident	93 Å²	93	97.2 Å²	97.2	37%	0.365	47%	0.47	S	S	.	.			trans	-63.5	130.2	178.5	-177.3	-98	0	0	0	111.6	C37 C40 T44 H53	C37-Y42 WeakPolarHBondContact CB-O 3.19Å; C37-Y42 PolarHBondContact N-O 3.38Å; C40-Y42 PolarHBondContact O-N 3.26Å; C40-Y42 VanDerWaalsContact O-N 3.1Å; C40-Y42 WeakPolarHBondContact SG-CB 3.4Å; Y42-T44 HydrophobicContact CE1-CG2 3.74Å; Y42-H53 VanDerWaalsContact CB-CE1 3.42Å; Y42-H53 WeakPolarHBondContact CB-CE1 3.41Å; Y42-H53 WeakPolarHBondContact CB-NE2 3.41Å; Y42-H53 HydrophobicContact CD1-CB 4.01Å; Y42-H53 AromaticContact CD1-CD2 3.51Å; Y42-H53 AromaticContact CD1-CE1 3.88Å; Y42-H53 AromaticContact CD1-CG 3.45Å; Y42-H53 VanDerWaalsContact CD1-CG 3.45Å; Y42-H53 AromaticContact CD1-ND1 3.7Å; Y42-H53 AromaticContact CD1-NE2 3.75Å; Y42-H53 HydrophobicContact CE1-CB 3.84Å; Y42-H53 AromaticContact CE1-CG 3.79Å; Y42-H53 AromaticContact CG-CD2 3.98Å; Y42-H53 AromaticContact CG-CE1 3.57Å; Y42-H53 AromaticContact CG-CG 3.92Å; Y42-H53 AromaticContact CG-ND1 3.67Å; Y42-H53 AromaticContact CG-NE2 3.74Å
43	T	84.7	Confident	83.9	Confident	63 Å²	63	90.2 Å²	90.2	39%	0.387	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	131.5	-177.5	-58	0	0	0	0	110.5	K34 Y35 D41	K34-T43 HydrophobicContact CB-CG2 3.49Å; K34-T43 VanDerWaalsContact CB-CG2 3.49Å; K34-T43 HydrophobicContact CD-CG2 3.79Å; K34-T43 HydrophobicContact CG-CG2 3.89Å; Y35-T43 WeakPolarHBondContact O-CA 3.26Å; D41-T43 PolarHBondContact O-N 3.45Å; D41-T43 PolarHBondContact O-OG1 3.21Å
44	T	84.4	Confident	85.1	Confident	17 Å²	17	87.6 Å²	87.6	10%	0.104	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.1	151.8	-177.5	-177.3	0	0	0	0	112.7	K34 Y35 Y42 K46 S49 L50	K34-T44 CarbonylContact C-O 3.46Å; K34-T44 WeakPolarHBondContact CA-O 3.33Å; Y35-T44 PolarHBondContact N-O 3.48Å; Y35-T44 PolarHBondContact O-N 3.34Å; Y42-T44 HydrophobicContact CE1-CG2 3.74Å; T44-K46 VanDerWaalsContact C-N 3.32Å; T44-K46 WeakPolarHBondContact CG2-O 3.42Å; T44-K46 PolarHBondContact OG1-N 3.48Å; T44-S49 WeakPolarHBondContact OG1-CB 3.36Å; T44-L50 HydrophobicContact CG2-CB 3.79Å
45	N	81.3	Confident	85.9	Confident	86 Å²	86	86.2 Å²	86.2	46%	0.46	43%	0.426	S	S	.	.	S	Bend	trans	-87.6	2.6	178.4	63.4	56	0	0	0	114.4	K33	K33-N45 WeakPolarHBondContact O-CA 3.4Å
46	K	82.9	Confident	86.1	Confident	130 Å²	130	84.9 Å²	84.9	57%	0.565	43%	0.43	S	S	*	.			trans	-122.4	129.6	-178.5	-60.2	-179.1	-175.1	173.6	0	111.3	T44 I48 S49 L50	T44-K46 VanDerWaalsContact C-N 3.32Å; T44-K46 WeakPolarHBondContact CG2-O 3.42Å; T44-K46 PolarHBondContact OG1-N 3.48Å; K46-I48 VanDerWaalsContact C-N 3.33Å; K46-I48 PolarHBondContact O-N 3.34Å; K46-S49 PolarHBondContact O-N 3.11Å; K46-L50 PolarHBondContact O-N 3.22Å
47	K	83.5	Confident	86.2	Confident	151 Å²	151	78.3 Å²	78.3	66%	0.657	41%	0.407	S	S	*	.	H	α-helix	trans	-59	-42.6	176.8	-170.1	178.9	178.3	-177	0	112.4	Y35 S49 L50 H51	Y35-K47 HydrophobicContact CD2-CB 4.48Å; Y35-K47 HydrophobicContact CE1-CB 3.99Å; Y35-K47 HydrophobicContact CE1-CG 4.09Å; Y35-K47 HydrophobicContact CE2-CB 3.98Å; K47-S49 VanDerWaalsContact C-N 3.32Å; K47-S49 PolarHBondContact O-N 3.35Å; K47-L50 PolarHBondContact O-N 3.49Å; K47-H51 PolarHBondContact O-N 3.44Å
48	I	87.4	Confident	85.8	Confident	127 Å²	127	85.3 Å²	85.3	65%	0.651	44%	0.437	S	S	*	.	H	α-helix	trans	-61.8	-41.8	179.6	-63.2	164.6	0	0	0	110.8	K46 L50 H51 N52	K46-I48 VanDerWaalsContact C-N 3.33Å; K46-I48 PolarHBondContact O-N 3.34Å; I48-L50 VanDerWaalsContact C-N 3.33Å; I48-L50 PolarHBondContact O-N 3.34Å; I48-H51 PolarHBondContact O-N 3.01Å; I48-N52 PolarHBondContact O-N 3.27Å; I48-N52 PolarHBondContact O-OD1 3.01Å
49	S	89.3	Confident	85.1	Confident	39 Å²	39	86.5 Å²	86.5	27%	0.273	44%	0.438	S	S	.	.	H	α-helix	trans	-65	-36.9	177.3	-59	0	0	0	0	112.3	T44 K46 K47 H53	T44-S49 WeakPolarHBondContact OG1-CB 3.36Å; K46-S49 PolarHBondContact O-N 3.11Å; K47-S49 VanDerWaalsContact C-N 3.32Å; K47-S49 PolarHBondContact O-N 3.35Å; S49-H53 VanDerWaalsContact O-CB 3.25Å; S49-H53 WeakPolarHBondContact O-CB 3.33Å; S49-H53 PolarHBondContact O-N 3.23Å; S49-H53 VanDerWaalsContact O-N 3.12Å
50	L	89.8	Confident	83.9	Confident	24 Å²	24	85 Å²	85	13%	0.126	43%	0.433	C	S	.	.	H	α-helix	trans	-66.3	-42.2	173.3	178.2	65.3	0	0	0	110.5	Y35 C37 T44 K46 K47 I48 H53 L54	Y35-L50 HydrophobicContact CD1-CD2 4.42Å; Y35-L50 HydrophobicContact CG-CD2 4.45Å; C37-L50 HydrophobicContact CB-CD1 4.02Å; T44-L50 HydrophobicContact CG2-CB 3.79Å; K46-L50 PolarHBondContact O-N 3.22Å; K47-L50 PolarHBondContact O-N 3.49Å; I48-L50 VanDerWaalsContact C-N 3.33Å; I48-L50 PolarHBondContact O-N 3.34Å; L50-H53 WeakPolarHBondContact O-CB 3.17Å; L50-H53 PolarHBondContact O-N 3.47Å; L50-L54 HydrophobicContact CD1-CD1 4.37Å; L50-L54 HydrophobicContact CD1-CG 4.21Å; L50-L54 HydrophobicContact CD2-CD1 4.4Å; L50-L54 HydrophobicContact CG-CD1 4.01Å; L50-L54 HydrophobicContact CG-CG 4.3Å; L50-L54 WeakPolarHBondContact O-CG 3.39Å; L50-L54 PolarHBondContact O-N 2.79Å
51	H	89.3	Confident	82.4	Confident	109 Å²	109	86.1 Å²	86.1	51%	0.505	44%	0.441	S	S	.	.	H	α-helix	trans	-60.8	-51.7	-179.3	-170.1	59.9	0	0	0	112	K47 I48 H53 L54 E55	K47-H51 PolarHBondContact O-N 3.44Å; I48-H51 PolarHBondContact O-N 3.01Å; H51-H53 PolarHBondContact O-N 3.47Å; H51-L54 WeakPolarHBondContact O-CB 3.2Å; H51-L54 PolarHBondContact O-N 3.11Å; H51-L54 VanDerWaalsContact O-N 3.09Å; H51-E55 PolarHBondContact O-N 3.36Å
52	N	89.7	Confident	80.9	Confident	94 Å²	94	87.6 Å²	87.6	50%	0.503	44%	0.441	S	S	.	.	H	α-helix	trans	-60.9	-36	177.3	-63.8	8	0	0	0	111.6	I48 E55 S56	I48-N52 PolarHBondContact O-N 3.27Å; I48-N52 PolarHBondContact O-OD1 3.01Å; N52-E55 PolarHBondContact O-N 3.15Å; N52-S56 PolarHBondContact O-N 2.88Å; N52-S56 VanDerWaalsContact O-N 3.14Å
53	H	90.1	Very high	79.2	Confident	35 Å²	35	86.6 Å²	86.6	16%	0.162	45%	0.451	C	S	.	.	H	α-helix	trans	-64.1	-43.5	174.5	170.1	78	0	0	0	112.2	C37 C40 Y42 S49 L50 H51 E55 S56 H57	C37-H53 VanDerWaalsContact SG-CD2 3.51Å; C37-H53 PolarHBondContact SG-NE2 3Å; C40-H53 VanDerWaalsContact SG-CE1 3.5Å; C40-H53 PolarHBondContact SG-NE2 3.29Å; Y42-H53 VanDerWaalsContact CB-CE1 3.42Å; Y42-H53 WeakPolarHBondContact CB-CE1 3.41Å; Y42-H53 WeakPolarHBondContact CB-NE2 3.41Å; Y42-H53 HydrophobicContact CD1-CB 4.01Å; Y42-H53 AromaticContact CD1-CD2 3.51Å; Y42-H53 AromaticContact CD1-CE1 3.88Å; Y42-H53 AromaticContact CD1-CG 3.45Å; Y42-H53 VanDerWaalsContact CD1-CG 3.45Å; Y42-H53 AromaticContact CD1-ND1 3.7Å; Y42-H53 AromaticContact CD1-NE2 3.75Å; Y42-H53 HydrophobicContact CE1-CB 3.84Å; Y42-H53 AromaticContact CE1-CG 3.79Å; Y42-H53 AromaticContact CG-CD2 3.98Å; Y42-H53 AromaticContact CG-CE1 3.57Å; Y42-H53 AromaticContact CG-CG 3.92Å; Y42-H53 AromaticContact CG-ND1 3.67Å; Y42-H53 AromaticContact CG-NE2 3.74Å; S49-H53 VanDerWaalsContact O-CB 3.25Å; S49-H53 WeakPolarHBondContact O-CB 3.33Å; S49-H53 PolarHBondContact O-N 3.23Å; S49-H53 VanDerWaalsContact O-N 3.12Å; L50-H53 WeakPolarHBondContact O-CB 3.17Å; L50-H53 PolarHBondContact O-N 3.47Å; H51-H53 PolarHBondContact O-N 3.47Å; H53-E55 VanDerWaalsContact C-N 3.28Å; H53-E55 PolarHBondContact O-N 3.4Å; H53-S56 VanDerWaalsContact O-CB 3.27Å; H53-S56 WeakPolarHBondContact O-CB 3.46Å; H53-S56 PolarHBondContact O-N 3.07Å; H53-S56 VanDerWaalsContact O-N 3.13Å; H53-H57 AromaticContact CD2-CD2 3.81Å; H53-H57 AromaticContact CD2-NE2 3.8Å; H53-H57 AromaticContact CE1-CD2 3.88Å; H53-H57 AromaticContact CE1-NE2 3.26Å; H53-H57 PolarHBondContact CE1-NE2 2.89Å; H53-H57 VanDerWaalsContact CE1-NE2 3.26Å; H53-H57 AromaticContact NE2-CD2 3.38Å; H53-H57 PolarHBondContact NE2-CD2 2.92Å; H53-H57 AromaticContact NE2-NE2 2.9Å; H53-H57 PolarHBondContact NE2-NE2 3.42Å; H53-H57 PolarHBondContact O-N 3.27Å
54	L	88.4	Confident	77.4	Confident	49 Å²	49	91.4 Å²	91.4	26%	0.257	47%	0.47	S	S	.	.	H	α-helix	trans	-64.3	-32.4	175.1	-68.5	170.2	0	0	0	112.1	L50 H51 S56 H57 K58	L50-L54 HydrophobicContact CD1-CD1 4.37Å; L50-L54 HydrophobicContact CD1-CG 4.21Å; L50-L54 HydrophobicContact CD2-CD1 4.4Å; L50-L54 HydrophobicContact CG-CD1 4.01Å; L50-L54 HydrophobicContact CG-CG 4.3Å; L50-L54 WeakPolarHBondContact O-CG 3.39Å; L50-L54 PolarHBondContact O-N 2.79Å; H51-L54 WeakPolarHBondContact O-CB 3.2Å; H51-L54 PolarHBondContact O-N 3.11Å; H51-L54 VanDerWaalsContact O-N 3.09Å; L54-S56 VanDerWaalsContact C-N 3.33Å; L54-H57 WeakPolarHBondContact O-CB 3.43Å; L54-H57 PolarHBondContact O-N 2.94Å; L54-K58 PolarHBondContact O-N 3.46Å
55	E	89.1	Confident	75.5	Confident	95 Å²	95	99.8 Å²	99.8	44%	0.444	51%	0.505	S	S	.	.	H	α-helix	trans	-65.4	-37	172.1	-66.5	-163.6	106.2	0	0	112.4	H51 N52 H53 H57 K58 L59	H51-E55 PolarHBondContact O-N 3.36Å; N52-E55 PolarHBondContact O-N 3.15Å; H53-E55 VanDerWaalsContact C-N 3.28Å; H53-E55 PolarHBondContact O-N 3.4Å; E55-H57 VanDerWaalsContact C-N 3.27Å; E55-H57 PolarHBondContact O-N 3.26Å; E55-K58 WeakPolarHBondContact O-CB 3.3Å; E55-K58 PolarHBondContact O-N 3.16Å; E55-K58 VanDerWaalsContact O-N 3.11Å; E55-L59 PolarHBondContact O-N 3.34Å
56	S	85.4	Confident	73.9	Confident	65 Å²	65	99.5 Å²	99.5	46%	0.455	51%	0.514	S	S	.	.	H	α-helix	trans	-59.4	-38.5	172.6	-170.4	0	0	0	0	112.1	N52 H53 L54 K58 L59 T60	N52-S56 PolarHBondContact O-N 2.88Å; N52-S56 VanDerWaalsContact O-N 3.14Å; H53-S56 VanDerWaalsContact O-CB 3.27Å; H53-S56 WeakPolarHBondContact O-CB 3.46Å; H53-S56 PolarHBondContact O-N 3.07Å; H53-S56 VanDerWaalsContact O-N 3.13Å; L54-S56 VanDerWaalsContact C-N 3.33Å; S56-K58 VanDerWaalsContact C-N 3.3Å; S56-K58 PolarHBondContact O-N 3.29Å; S56-L59 PolarHBondContact O-N 3.33Å; S56-T60 PolarHBondContact O-N 3.41Å; S56-T60 PolarHBondContact O-OG1 3.33Å
57	H	84.6	Confident	72.5	Confident	42 Å²	42	100.5 Å²	100.5	19%	0.194	52%	0.524	C	S	.	.	H	α-helix	trans	-65	-31.7	175.8	-77.5	-57	0	0	0	113.3	C40 H53 L54 E55 L59 T60 S61	C40-H57 PolarHBondContact SG-NE2 3.2Å; C40-H57 VanDerWaalsContact SG-NE2 3.36Å; H53-H57 AromaticContact CD2-CD2 3.81Å; H53-H57 AromaticContact CD2-NE2 3.8Å; H53-H57 AromaticContact CE1-CD2 3.88Å; H53-H57 AromaticContact CE1-NE2 3.26Å; H53-H57 PolarHBondContact CE1-NE2 2.89Å; H53-H57 VanDerWaalsContact CE1-NE2 3.26Å; H53-H57 AromaticContact NE2-CD2 3.38Å; H53-H57 PolarHBondContact NE2-CD2 2.92Å; H53-H57 AromaticContact NE2-NE2 2.9Å; H53-H57 PolarHBondContact NE2-NE2 3.42Å; H53-H57 PolarHBondContact O-N 3.27Å; L54-H57 WeakPolarHBondContact O-CB 3.43Å; L54-H57 PolarHBondContact O-N 2.94Å; E55-H57 VanDerWaalsContact C-N 3.27Å; E55-H57 PolarHBondContact O-N 3.26Å; H57-L59 VanDerWaalsContact C-N 3.32Å; H57-T60 WeakPolarHBondContact CA-OG1 3.45Å; H57-T60 PolarHBondContact O-N 3.16Å; H57-T60 PolarHBondContact O-OG1 3.48Å; H57-T60 VanDerWaalsContact O-OG1 3.1Å; H57-S61 WeakPolarHBondContact O-CB 3.05Å; H57-S61 PolarHBondContact O-N 3.46Å; H57-S61 PolarHBondContact O-OG 2.92Å
58	K	79.1	Confident	70.5	Confident	149 Å²	149	105.6 Å²	105.6	65%	0.648	55%	0.55	S	S	*	*	H	α-helix	trans	-69.6	-32.7	176.4	-65.9	179.1	-178	-176.3	0	112.2	L54 E55 S56	L54-K58 PolarHBondContact O-N 3.46Å; E55-K58 WeakPolarHBondContact O-CB 3.3Å; E55-K58 PolarHBondContact O-N 3.16Å; E55-K58 VanDerWaalsContact O-N 3.11Å; S56-K58 VanDerWaalsContact C-N 3.3Å; S56-K58 PolarHBondContact O-N 3.29Å
59	L	69.1	Low	69.7	Low	145 Å²	145	104.6 Å²	104.6	76%	0.759	55%	0.545	S	S	*	.	H	α-helix	trans	-73.2	-34.9	177.3	-62.3	173.8	0	0	0	111.5	E55 S56 H57	E55-L59 PolarHBondContact O-N 3.34Å; S56-L59 PolarHBondContact O-N 3.33Å; H57-L59 VanDerWaalsContact C-N 3.32Å
60	T	59	Low	68.6	Low	78 Å²	78	108 Å²	108	48%	0.479	56%	0.56	S	S	.	*	H	α-helix	trans	-83.1	-33.8	177.4	54.9	0	0	0	0	113.4	S56 H57 K62 A63	S56-T60 PolarHBondContact O-N 3.41Å; S56-T60 PolarHBondContact O-OG1 3.33Å; H57-T60 WeakPolarHBondContact CA-OG1 3.45Å; H57-T60 PolarHBondContact O-N 3.16Å; H57-T60 PolarHBondContact O-OG1 3.48Å; H57-T60 VanDerWaalsContact O-OG1 3.1Å; T60-K62 PolarHBondContact O-N 3.31Å; T60-K62 VanDerWaalsContact O-N 3.12Å; T60-A63 WeakPolarHBondContact O-CB 3.42Å; T60-A63 PolarHBondContact O-N 2.91Å
61	S	55.3	Low	67.5	Low	70 Å²	70	112.7 Å²	112.7	49%	0.49	58%	0.584	S	S	.	*	H	α-helix	trans	-63.3	-18.6	178.8	-69.9	0	0	0	0	113.9	H57 A63	H57-S61 WeakPolarHBondContact O-CB 3.05Å; H57-S61 PolarHBondContact O-N 3.46Å; H57-S61 PolarHBondContact O-OG 2.92Å; S61-A63 VanDerWaalsContact C-N 3.26Å; S61-A63 PolarHBondContact O-N 3.06Å
62	K	51.5	Low	66.2	Low	179 Å²	179	112.9 Å²	112.9	78%	0.778	59%	0.589	S	S	*	*	H	α-helix	trans	-74.4	-17.3	173.9	-157.1	174.4	-178.6	179.6	0	112.6	T60	T60-K62 PolarHBondContact O-N 3.31Å; T60-K62 VanDerWaalsContact O-N 3.12Å
63	A	48.6	Very low	64.7	Low	71 Å²	71	114.1 Å²	114.1	59%	0.587	59%	0.594	S	S	*	*	H	α-helix	trans	-86.3	-30.2	178.3	0	0	0	0	0	113.1	T60 S61	T60-A63 WeakPolarHBondContact O-CB 3.42Å; T60-A63 PolarHBondContact O-N 2.91Å; S61-A63 VanDerWaalsContact C-N 3.26Å; S61-A63 PolarHBondContact O-N 3.06Å
64	E	46.7	Very low	63	Low	165 Å²	165	119.3 Å²	119.3	77%	0.771	62%	0.623	S	S	*	*	H	α-helix	trans	-86.5	-17.9	178.6	-74.4	-135.1	100.1	0	0	114.2	A66	E64-A66 PolarHBondContact O-N 3.19Å
65	K	46.2	Very low	61.2	Low	193 Å²	193	124.4 Å²	124.4	84%	0.839	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.2	6.4	172.1	-96.5	-160.9	176.9	-153	0	114.8
66	A	47.6	Very low	59.1	Low	80 Å²	80	126.6 Å²	126.6	66%	0.661	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.6	11.5	176.4	0	0	0	0	0	112.9	E64	E64-A66 PolarHBondContact O-N 3.19Å
67	I	52	Low	56.9	Low	150 Å²	150	131.8 Å²	131.8	77%	0.769	68%	0.682	S	S	*	*			trans	-121.6	59.8	170.8	-44.8	179.6	0	0	0	108.5
68	E	42.9	Very low	54.4	Low	259 Å²	259	139.9 Å²	139.9	100%	1.21	73%	0.726	S	S	*	*			trans	-144.4	0	149	-171.5	171.1	76.4	0	0	108.4

Retrieved 68 of 68 residues in 151.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).