MAZE_STAAM Loading...

Antitoxin MazE

Antitoxin component of a type II toxin-antitoxin (TA) system. Labile antitoxin that binds to cognate MazF toxin and counteracts its endoribonuclease activity.

AlphaFold DB (Q2FWI7), UniProt , Accession Q99SI6, Species STAAM (Staphylococcus aureus (strain Mu50 / ATCC 700699)), Gene mazE, Length 56 aa.

						>MAZE_STAAM|Q99SI6|mazE
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.3	Low	86.8	Confident	218 Å²	218	116.1 Å²	116.1	100%	1.074	60%	0.598	S	S	*	*				0	-40.1	0	-65.1	-174	-156.9	0	0	113.1	S3 F4 S5	M1-S3 PolarHBondContact O-N 3.24Å; M1-F4 PolarHBondContact O-N 3.32Å; M1-S5 PolarHBondContact O-N 2.94Å
2	L	81.2	Confident	87.6	Confident	136 Å²	136	115.4 Å²	115.4	71%	0.712	60%	0.595	S	S	*	*	H	α-helix	trans	-57.5	-42.3	179.4	-70.1	166.2	0	0	0	115.1	F4 S5 Q6	L2-F4 VanDerWaalsContact C-N 3.3Å; L2-F4 PolarHBondContact O-N 3.38Å; L2-S5 PolarHBondContact O-N 3.37Å; L2-S5 PolarHBondContact O-OG 3.41Å; L2-Q6 WeakPolarHBondContact O-CG 3.45Å; L2-Q6 PolarHBondContact O-N 2.84Å
3	S	82.4	Confident	88.4	Confident	73 Å²	73	114 Å²	114	51%	0.51	58%	0.584	S	S	.	*	H	α-helix	trans	-62.1	-37.6	178.3	170.5	0	0	0	0	112.3	M1 Q6 N7	M1-S3 PolarHBondContact O-N 3.24Å; S3-Q6 PolarHBondContact O-N 3.03Å; S3-N7 WeakPolarHBondContact O-CB 3.46Å; S3-N7 VanDerWaalsContact O-CG 3.28Å; S3-N7 PolarHBondContact O-N 3.25Å; S3-N7 PolarHBondContact O-ND2 2.96Å
4	F	85.1	Confident	89	Confident	150 Å²	150	111.5 Å²	111.5	66%	0.658	57%	0.569	S	S	*	*	H	α-helix	trans	-65.2	-42.7	176.5	179.4	-100.4	0	0	0	111.7	M1 L2 R8	M1-F4 PolarHBondContact O-N 3.32Å; L2-F4 VanDerWaalsContact C-N 3.3Å; L2-F4 PolarHBondContact O-N 3.38Å; F4-R8 WeakPolarHBondContact O-CB 3.39Å; F4-R8 PolarHBondContact O-N 3.23Å
5	S	86.7	Confident	89.6	Confident	45 Å²	45	108.5 Å²	108.5	32%	0.315	56%	0.562	S	S	.	*	H	α-helix	trans	-66.3	-38.5	176.5	61.2	0	0	0	0	112.2	M1 L2 R8 S9	M1-S5 PolarHBondContact O-N 2.94Å; L2-S5 PolarHBondContact O-N 3.37Å; L2-S5 PolarHBondContact O-OG 3.41Å; S5-R8 PolarHBondContact O-N 3.44Å; S5-S9 PolarHBondContact O-N 3.43Å; S5-S9 PolarHBondContact O-OG 3.38Å
6	Q	88	Confident	90.1	Very high	127 Å²	127	107.5 Å²	107.5	59%	0.593	56%	0.557	S	S	*	*	H	α-helix	trans	-63.3	-47.7	176.4	-74.7	173.2	-28.5	0	0	111.8	L2 S3 R8 S9 H10	L2-Q6 WeakPolarHBondContact O-CG 3.45Å; L2-Q6 PolarHBondContact O-N 2.84Å; S3-Q6 PolarHBondContact O-N 3.03Å; Q6-R8 VanDerWaalsContact C-N 3.3Å; Q6-R8 PolarHBondContact O-N 3.31Å; Q6-S9 PolarHBondContact O-N 2.91Å; Q6-H10 WeakPolarHBondContact O-CB 3.44Å; Q6-H10 PolarHBondContact O-N 3.47Å
7	N	90	Very high	90.6	Very high	103 Å²	103	107.8 Å²	107.8	55%	0.551	55%	0.553	S	S	*	*	H	α-helix	trans	-61	-39.6	177	-71.9	-27.1	0	0	0	111.8	S3 H10 S11	S3-N7 WeakPolarHBondContact O-CB 3.46Å; S3-N7 VanDerWaalsContact O-CG 3.28Å; S3-N7 PolarHBondContact O-N 3.25Å; S3-N7 PolarHBondContact O-ND2 2.96Å; N7-H10 PolarHBondContact O-N 3.14Å; N7-S11 WeakPolarHBondContact O-CB 3.36Å; N7-S11 PolarHBondContact O-N 2.92Å
8	R	91.7	Very high	91	Very high	160 Å²	160	106.6 Å²	106.6	60%	0.604	55%	0.545	S	S	*	.	H	α-helix	trans	-63.7	-45.8	175.5	-167.9	-174.2	76.9	-151.6	4.6	111.9	F4 S5 Q6 S11 L12	F4-R8 WeakPolarHBondContact O-CB 3.39Å; F4-R8 PolarHBondContact O-N 3.23Å; S5-R8 PolarHBondContact O-N 3.44Å; Q6-R8 VanDerWaalsContact C-N 3.3Å; Q6-R8 PolarHBondContact O-N 3.31Å; R8-S11 PolarHBondContact O-N 3.17Å; R8-L12 WeakPolarHBondContact O-CB 3.19Å; R8-L12 PolarHBondContact O-N 2.97Å
9	S	92.7	Very high	91.4	Very high	71 Å²	71	102.5 Å²	102.5	50%	0.497	53%	0.532	S	S	.	.	H	α-helix	trans	-62.3	-43.4	177.5	-65.3	0	0	0	0	111.7	S5 Q6 L12 E13	S5-S9 PolarHBondContact O-N 3.43Å; S5-S9 PolarHBondContact O-OG 3.38Å; Q6-S9 PolarHBondContact O-N 2.91Å; S9-L12 PolarHBondContact O-N 3.39Å; S9-E13 WeakPolarHBondContact O-CB 3.45Å; S9-E13 PolarHBondContact O-N 2.97Å
10	H	94.3	Very high	91.7	Very high	123 Å²	123	105.7 Å²	105.7	57%	0.569	54%	0.538	S	S	*	.	H	α-helix	trans	-62.8	-44.6	176.5	-178.1	-82.8	0	0	0	111.9	Q6 N7 L12 E13 Q14	Q6-H10 WeakPolarHBondContact O-CB 3.44Å; Q6-H10 PolarHBondContact O-N 3.47Å; N7-H10 PolarHBondContact O-N 3.14Å; H10-L12 VanDerWaalsContact C-N 3.32Å; H10-L12 PolarHBondContact O-N 3.4Å; H10-E13 PolarHBondContact O-N 2.8Å; H10-Q14 WeakPolarHBondContact O-CB 3.44Å; H10-Q14 PolarHBondContact O-N 3.27Å
11	S	95.3	Very high	92	Very high	71 Å²	71	105.1 Å²	105.1	50%	0.497	54%	0.544	S	S	.	.	H	α-helix	trans	-60.2	-42.8	175.9	-176.1	0	0	0	0	111.8	N7 R8 Q14 S15	N7-S11 WeakPolarHBondContact O-CB 3.36Å; N7-S11 PolarHBondContact O-N 2.92Å; R8-S11 PolarHBondContact O-N 3.17Å; S11-Q14 PolarHBondContact O-N 3.23Å; S11-S15 PolarHBondContact O-N 3.37Å; S11-S15 PolarHBondContact O-OG 2.92Å
12	L	96.7	Very high	93.5	Very high	108 Å²	108	101.9 Å²	101.9	57%	0.565	53%	0.526	S	S	*	.	H	α-helix	trans	-65.5	-44.7	178.3	-178.7	64.5	0	0	0	111.4	R8 S9 H10 Q14 S15 L16	R8-L12 WeakPolarHBondContact O-CB 3.19Å; R8-L12 PolarHBondContact O-N 2.97Å; S9-L12 PolarHBondContact O-N 3.39Å; H10-L12 VanDerWaalsContact C-N 3.32Å; H10-L12 PolarHBondContact O-N 3.4Å; L12-Q14 VanDerWaalsContact C-N 3.3Å; L12-Q14 PolarHBondContact O-N 3.31Å; L12-S15 PolarHBondContact O-N 3.34Å; L12-L16 HydrophobicContact CG-CD1 4.24Å; L12-L16 VanDerWaalsContact O-CG 3.32Å; L12-L16 WeakPolarHBondContact O-CG 3.32Å; L12-L16 PolarHBondContact O-N 3.43Å
13	E	97.5	Very high	94.3	Very high	97 Å²	97	99.3 Å²	99.3	45%	0.453	51%	0.511	S	S	.	.	H	α-helix	trans	-59.5	-42.4	176.4	-172	-172	153.8	0	0	111.5	S9 H10 L16 K17	S9-E13 WeakPolarHBondContact O-CB 3.45Å; S9-E13 PolarHBondContact O-N 2.97Å; H10-E13 PolarHBondContact O-N 2.8Å; E13-L16 PolarHBondContact O-N 2.94Å; E13-K17 WeakPolarHBondContact O-CG 3.43Å; E13-K17 PolarHBondContact O-N 2.93Å; E13-K17 WeakPolarHBondContact OE1-CE 3.39Å; E13-K17 IonicContact OE1-NZ 2.68Å; E13-K17 PolarHBondContact OE1-NZ 2.97Å
14	Q	97.5	Very high	95.1	Very high	79 Å²	79	98.1 Å²	98.1	37%	0.369	51%	0.506	S	S	.	.	H	α-helix	trans	-63.3	-47	176.9	-175.7	58.9	29.3	0	0	111.7	H10 S11 L12 L16 K17 E18	H10-Q14 WeakPolarHBondContact O-CB 3.44Å; H10-Q14 PolarHBondContact O-N 3.27Å; S11-Q14 PolarHBondContact O-N 3.23Å; L12-Q14 VanDerWaalsContact C-N 3.3Å; L12-Q14 PolarHBondContact O-N 3.31Å; Q14-L16 VanDerWaalsContact C-N 3.29Å; Q14-L16 PolarHBondContact O-N 3.01Å; Q14-K17 PolarHBondContact O-N 3.22Å; Q14-E18 WeakPolarHBondContact CG-OE1 3.5Å; Q14-E18 PolarHBondContact NE2-OE1 3.36Å; Q14-E18 WeakPolarHBondContact O-CG 3.44Å; Q14-E18 PolarHBondContact O-N 2.99Å
15	S	97.5	Very high	95.7	Very high	67 Å²	67	97.7 Å²	97.7	47%	0.469	51%	0.511	S	S	.	.	H	α-helix	trans	-62	-36.3	176.2	-61.8	0	0	0	0	112.6	S11 L12 G19	S11-S15 PolarHBondContact O-N 3.37Å; S11-S15 PolarHBondContact O-OG 2.92Å; L12-S15 PolarHBondContact O-N 3.34Å; S15-G19 PolarHBondContact O-N 2.87Å
16	L	97.7	Very high	96.3	Very high	92 Å²	92	99.8 Å²	99.8	48%	0.482	52%	0.518	S	S	.	.	H	α-helix	trans	-65.1	-45.4	174.5	-74.1	170.4	0	0	0	111.6	L12 E13 Q14 E18 G19 Y20	L12-L16 HydrophobicContact CG-CD1 4.24Å; L12-L16 VanDerWaalsContact O-CG 3.32Å; L12-L16 WeakPolarHBondContact O-CG 3.32Å; L12-L16 PolarHBondContact O-N 3.43Å; E13-L16 PolarHBondContact O-N 2.94Å; Q14-L16 VanDerWaalsContact C-N 3.29Å; Q14-L16 PolarHBondContact O-N 3.01Å; L16-E18 VanDerWaalsContact C-N 3.34Å; L16-E18 PolarHBondContact O-N 2.91Å; L16-G19 PolarHBondContact O-N 3.36Å; L16-Y20 WeakPolarHBondContact O-CD2 3.4Å; L16-Y20 PolarHBondContact O-N 3.41Å
17	K	97.9	Very high	96.7	Very high	112 Å²	112	97.4 Å²	97.4	49%	0.487	51%	0.509	S	S	.	.	H	α-helix	trans	-59.2	-45.9	176.9	-74.7	174.3	-176.7	167.2	0	111.6	E13 Q14 Y20 S21	E13-K17 WeakPolarHBondContact O-CG 3.43Å; E13-K17 PolarHBondContact O-N 2.93Å; E13-K17 WeakPolarHBondContact OE1-CE 3.39Å; E13-K17 IonicContact OE1-NZ 2.68Å; E13-K17 PolarHBondContact OE1-NZ 2.97Å; Q14-K17 PolarHBondContact O-N 3.22Å; K17-Y20 PolarHBondContact O-N 2.93Å; K17-S21 WeakPolarHBondContact O-CB 3.45Å; K17-S21 PolarHBondContact O-N 3.06Å
18	E	98.4	Very high	97.1	Very high	87 Å²	87	97.4 Å²	97.4	41%	0.407	51%	0.508	S	S	.	.	H	α-helix	trans	-62.4	-44.4	176.8	-72.2	169.5	-168.8	0	0	111.4	Q14 L16 S21 Q22	Q14-E18 WeakPolarHBondContact CG-OE1 3.5Å; Q14-E18 PolarHBondContact NE2-OE1 3.36Å; Q14-E18 WeakPolarHBondContact O-CG 3.44Å; Q14-E18 PolarHBondContact O-N 2.99Å; L16-E18 VanDerWaalsContact C-N 3.34Å; L16-E18 PolarHBondContact O-N 2.91Å; E18-S21 PolarHBondContact O-N 3.07Å; E18-Q22 WeakPolarHBondContact O-CB 3.3Å; E18-Q22 WeakPolarHBondContact O-CG 3.34Å; E18-Q22 PolarHBondContact O-N 3.29Å
19	G	98.4	Very high	97.4	Very high	29 Å²	29	92.4 Å²	92.4	30%	0.299	50%	0.498	S	S	.	.	H	α-helix	trans	-61.9	-44.6	177.2	0	0	0	0	0	113.3	S15 L16 S21 Q22 M23	S15-G19 PolarHBondContact O-N 2.87Å; L16-G19 PolarHBondContact O-N 3.36Å; G19-S21 PolarHBondContact O-N 3.4Å; G19-Q22 PolarHBondContact O-N 2.99Å; G19-M23 WeakPolarHBondContact O-CB 3.44Å; G19-M23 VanDerWaalsContact O-CG 3.3Å; G19-M23 WeakPolarHBondContact O-CG 3.2Å; G19-M23 PolarHBondContact O-N 3.47Å
20	Y	98.4	Very high	97.6	Very high	165 Å²	165	93.2 Å²	93.2	65%	0.647	50%	0.496	S	S	*	.	H	α-helix	trans	-62.5	-42.7	174.8	-80.5	-61.9	0	0	0	111.9	L16 K17 M23 A24	L16-Y20 WeakPolarHBondContact O-CD2 3.4Å; L16-Y20 PolarHBondContact O-N 3.41Å; K17-Y20 PolarHBondContact O-N 2.93Å; Y20-M23 PolarHBondContact O-N 2.91Å; Y20-A24 PolarHBondContact O-N 3.27Å
21	S	98.4	Very high	97.7	Very high	94 Å²	94	89.9 Å²	89.9	66%	0.657	49%	0.49	S	S	*	.	H	α-helix	trans	-63.6	-41.6	177.1	-175	0	0	0	0	112.1	K17 E18 G19 M23	K17-S21 WeakPolarHBondContact O-CB 3.45Å; K17-S21 PolarHBondContact O-N 3.06Å; E18-S21 PolarHBondContact O-N 3.07Å; G19-S21 PolarHBondContact O-N 3.4Å; S21-M23 PolarHBondContact O-N 3.5Å
22	Q	98.5	Very high	97.6	Very high	150 Å²	150	91.4 Å²	91.4	70%	0.701	49%	0.493	S	S	*	.	H	α-helix	trans	-67.7	-25.5	178.6	-72.5	168	27.9	0	0	112.4	E18 G19	E18-Q22 WeakPolarHBondContact O-CB 3.3Å; E18-Q22 WeakPolarHBondContact O-CG 3.34Å; E18-Q22 PolarHBondContact O-N 3.29Å; G19-Q22 PolarHBondContact O-N 2.99Å
23	M	98.3	Very high	97.5	Very high	82 Å²	82	92.1 Å²	92.1	40%	0.404	49%	0.493	S	S	.	.	T	Hydrogen-bonded Turn	trans	-103.6	4.2	-177.2	-60.9	-85.3	51.1	0	0	114.6	G19 Y20 S21 D25 L26 N27	G19-M23 WeakPolarHBondContact O-CB 3.44Å; G19-M23 VanDerWaalsContact O-CG 3.3Å; G19-M23 WeakPolarHBondContact O-CG 3.2Å; G19-M23 PolarHBondContact O-N 3.47Å; Y20-M23 PolarHBondContact O-N 2.91Å; S21-M23 PolarHBondContact O-N 3.5Å; M23-D25 PolarHBondContact O-N 2.68Å; M23-L26 HydrophobicContact CE-CB 3.85Å; M23-L26 HydrophobicContact CE-CD2 3.57Å; M23-L26 HydrophobicContact CE-CG 4.36Å; M23-L26 PolarHBondContact O-N 2.97Å; M23-L26 HydrophobicContact SD-CD2 4.23Å; M23-N27 WeakPolarHBondContact O-CB 3.16Å; M23-N27 VanDerWaalsContact O-CG 3.28Å; M23-N27 PolarHBondContact O-N 3.47Å; M23-N27 PolarHBondContact O-ND2 3Å
24	A	98.2	Very high	97.2	Very high	49 Å²	49	89 Å²	89	41%	0.405	48%	0.484	S	S	.	.	H	α-helix	trans	-55	-50.2	-174.9	0	0	0	0	0	112.5	Y20 N27 L28	Y20-A24 PolarHBondContact O-N 3.27Å; A24-N27 PolarHBondContact O-N 3.47Å; A24-L28 VanDerWaalsContact O-CB 3.25Å; A24-L28 WeakPolarHBondContact O-CB 3.48Å; A24-L28 PolarHBondContact O-N 3.18Å
25	D	98.2	Very high	96.8	Very high	141 Å²	141	90.8 Å²	90.8	75%	0.754	49%	0.491	S	S	*	.	H	α-helix	trans	-64.9	-43.8	-176.8	-65.8	-18.9	0	0	0	112.3	M23 L28 S29	M23-D25 PolarHBondContact O-N 2.68Å; D25-L28 PolarHBondContact O-N 2.83Å; D25-S29 PolarHBondContact O-N 3.35Å
26	L	98.3	Very high	96.3	Very high	88 Å²	88	91.3 Å²	91.3	46%	0.461	49%	0.493	S	S	.	.	H	α-helix	trans	-64.3	-49.8	178.3	177	63	0	0	0	111.2	M23 L28 S29 L30	M23-L26 HydrophobicContact CE-CB 3.85Å; M23-L26 HydrophobicContact CE-CD2 3.57Å; M23-L26 HydrophobicContact CE-CG 4.36Å; M23-L26 PolarHBondContact O-N 2.97Å; M23-L26 HydrophobicContact SD-CD2 4.23Å; L26-L28 VanDerWaalsContact C-N 3.25Å; L26-L28 PolarHBondContact O-N 3.36Å; L26-S29 WeakPolarHBondContact O-CB 3.36Å; L26-S29 PolarHBondContact O-N 3.02Å; L26-L30 HydrophobicContact CD1-CD1 4.22Å; L26-L30 HydrophobicContact CD1-CG 4.32Å; L26-L30 HydrophobicContact CG-CD1 4.13Å; L26-L30 WeakPolarHBondContact O-CG 3.46Å; L26-L30 PolarHBondContact O-N 2.89Å
27	N	97.6	Very high	95.7	Very high	77 Å²	77	94.2 Å²	94.2	41%	0.412	51%	0.507	S	S	.	.	H	α-helix	trans	-63.1	-36.4	-178.7	-71.7	-17.9	0	0	0	111.2	M23 A24 A31	M23-N27 WeakPolarHBondContact O-CB 3.16Å; M23-N27 VanDerWaalsContact O-CG 3.28Å; M23-N27 PolarHBondContact O-N 3.47Å; M23-N27 PolarHBondContact O-ND2 3Å; A24-N27 PolarHBondContact O-N 3.47Å; N27-A31 WeakPolarHBondContact O-CB 3.4Å; N27-A31 PolarHBondContact O-N 3.36Å
28	L	97.6	Very high	95.2	Very high	103 Å²	103	95.8 Å²	95.8	54%	0.539	52%	0.516	S	S	.	.	H	α-helix	trans	-67.4	-41.6	174.8	-176.5	60.2	0	0	0	112.1	A24 D25 L26 A31 N32	A24-L28 VanDerWaalsContact O-CB 3.25Å; A24-L28 WeakPolarHBondContact O-CB 3.48Å; A24-L28 PolarHBondContact O-N 3.18Å; D25-L28 PolarHBondContact O-N 2.83Å; L26-L28 VanDerWaalsContact C-N 3.25Å; L26-L28 PolarHBondContact O-N 3.36Å; L28-A31 PolarHBondContact O-N 2.94Å; L28-N32 PolarHBondContact O-N 3.45Å; L28-N32 PolarHBondContact O-ND2 3.41Å; L28-N32 VanDerWaalsContact O-ND2 3.14Å
29	S	97.9	Very high	94.5	Very high	55 Å²	55	92.8 Å²	92.8	39%	0.385	51%	0.505	S	S	.	.	H	α-helix	trans	-58.3	-50.6	174.7	-165	0	0	0	0	111.1	D25 L26 A31 N32 E33	D25-S29 PolarHBondContact O-N 3.35Å; L26-S29 WeakPolarHBondContact O-CB 3.36Å; L26-S29 PolarHBondContact O-N 3.02Å; S29-A31 VanDerWaalsContact C-N 3.35Å; S29-A31 PolarHBondContact O-N 3.47Å; S29-N32 PolarHBondContact O-N 3.18Å; S29-E33 WeakPolarHBondContact O-CG 3.48Å; S29-E33 PolarHBondContact O-N 3.14Å; S29-E33 PolarHBondContact OG-OE1 2.99Å
30	L	97.1	Very high	93.3	Very high	88 Å²	88	99.7 Å²	99.7	46%	0.461	53%	0.529	S	S	.	.	H	α-helix	trans	-61.8	-41.5	-179.5	-67.6	173.2	0	0	0	112.2	L26 N32 E33 A34	L26-L30 HydrophobicContact CD1-CD1 4.22Å; L26-L30 HydrophobicContact CD1-CG 4.32Å; L26-L30 HydrophobicContact CG-CD1 4.13Å; L26-L30 WeakPolarHBondContact O-CG 3.46Å; L26-L30 PolarHBondContact O-N 2.89Å; L30-N32 VanDerWaalsContact C-N 3.35Å; L30-N32 PolarHBondContact O-N 3.49Å; L30-E33 PolarHBondContact O-N 3.43Å; L30-A34 WeakPolarHBondContact O-CB 3.25Å; L30-A34 PolarHBondContact O-N 3.32Å
31	A	95.9	Very high	92.1	Very high	54 Å²	54	94.7 Å²	94.7	45%	0.446	52%	0.522	S	S	.	.	H	α-helix	trans	-62.2	-41.9	176.1	0	0	0	0	0	111.9	N27 L28 S29 A34 F35	N27-A31 WeakPolarHBondContact O-CB 3.4Å; N27-A31 PolarHBondContact O-N 3.36Å; L28-A31 PolarHBondContact O-N 2.94Å; S29-A31 VanDerWaalsContact C-N 3.35Å; S29-A31 PolarHBondContact O-N 3.47Å; A31-A34 PolarHBondContact O-N 2.94Å; A31-F35 PolarHBondContact O-N 3.06Å
32	N	93.9	Very high	90.5	Very high	102 Å²	102	92.9 Å²	92.9	55%	0.545	51%	0.509	S	S	.	.	H	α-helix	trans	-68.6	-36.2	176.4	-72	-35.1	0	0	0	112.6	L28 S29 L30 F35	L28-N32 PolarHBondContact O-N 3.45Å; L28-N32 PolarHBondContact O-ND2 3.41Å; L28-N32 VanDerWaalsContact O-ND2 3.14Å; S29-N32 PolarHBondContact O-N 3.18Å; L30-N32 VanDerWaalsContact C-N 3.35Å; L30-N32 PolarHBondContact O-N 3.49Å; N32-F35 WeakPolarHBondContact O-CB 3.33Å; N32-F35 PolarHBondContact O-N 3.03Å
33	E	94.7	Very high	88.7	Confident	124 Å²	124	91.9 Å²	91.9	58%	0.579	51%	0.508	S	S	*	.	H	α-helix	trans	-66.5	-38.2	176.5	-74.3	166.6	-143.5	0	0	112.2	S29 L30 P36	S29-E33 WeakPolarHBondContact O-CG 3.48Å; S29-E33 PolarHBondContact O-N 3.14Å; S29-E33 PolarHBondContact OG-OE1 2.99Å; L30-E33 PolarHBondContact O-N 3.43Å; E33-P36 WeakPolarHBondContact O-CD 3.47Å
34	A	91.8	Very high	86.9	Confident	31 Å²	31	91.8 Å²	91.8	26%	0.256	52%	0.515	S	S	.	.	H	α-helix	trans	-77.9	-23.1	178	0	0	0	0	0	113.2	L30 A31 P36 I37 E38	L30-A34 WeakPolarHBondContact O-CB 3.25Å; L30-A34 PolarHBondContact O-N 3.32Å; A31-A34 PolarHBondContact O-N 2.94Å; A34-P36 VanDerWaalsContact C-CD 3.48Å; A34-I37 WeakPolarHBondContact O-CB 3.44Å; A34-I37 PolarHBondContact O-N 3.09Å; A34-E38 HydrophobicContact CB-CG 4.43Å; A34-E38 PolarHBondContact O-N 3.5Å; A34-E38 VanDerWaalsContact O-N 3.09Å
35	F	89.2	Confident	84.9	Confident	116 Å²	116	94.2 Å²	94.2	51%	0.509	52%	0.521	S	S	.	.	H	α-helix	trans	-48.7	-47.4	-173.8	175.3	-97.4	0	0	0	114.5	A31 N32 I37 E38 C39	A31-F35 PolarHBondContact O-N 3.06Å; N32-F35 WeakPolarHBondContact O-CB 3.33Å; N32-F35 PolarHBondContact O-N 3.03Å; F35-I37 PolarHBondContact O-N 3.29Å; F35-E38 PolarHBondContact O-N 3.2Å; F35-C39 HydrophobicContact CE1-CB 4.26Å; F35-C39 HydrophobicContact CE2-CB 4.22Å; F35-C39 HydrophobicContact CZ-CB 4.07Å; F35-C39 WeakPolarHBondContact O-CB 3.06Å; F35-C39 PolarHBondContact O-N 2.89Å
36	P	85.9	Confident	82.9	Confident	79 Å²	79	93.8 Å²	93.8	51%	0.513	51%	0.514	S	S	.	.	H	α-helix	trans	-63.3	-26.3	-179.3	-22.1	34.8	0	0	0	113.8	E33 A34	E33-P36 WeakPolarHBondContact O-CD 3.47Å; A34-P36 VanDerWaalsContact C-CD 3.48Å
37	I	85.9	Confident	81.1	Confident	153 Å²	153	94.2 Å²	94.2	79%	0.785	52%	0.52	S	S	*	.	H	α-helix	trans	-84.8	-36	-179.1	-58.3	169.2	0	0	0	110.6	A34 F35	A34-I37 WeakPolarHBondContact O-CB 3.44Å; A34-I37 PolarHBondContact O-N 3.09Å; F35-I37 PolarHBondContact O-N 3.29Å
38	E	86.2	Confident	79.3	Confident	145 Å²	145	98.2 Å²	98.2	68%	0.678	53%	0.531	S	S	*	.	H	α-helix	trans	-81	-25.8	179.8	-65.2	-179.1	169.5	0	0	112.7	A34 F35 E40	A34-E38 HydrophobicContact CB-CG 4.43Å; A34-E38 PolarHBondContact O-N 3.5Å; A34-E38 VanDerWaalsContact O-N 3.09Å; F35-E38 PolarHBondContact O-N 3.2Å; E38-E40 PolarHBondContact O-N 3.02Å
39	C	84.6	Confident	77.5	Confident	24 Å²	24	97.9 Å²	97.9	16%	0.162	53%	0.529	C	S	.	.			trans	-74.5	91.2	-177.2	177.8	0	0	0	0	111.5	F35 A41 C42	F35-C39 HydrophobicContact CE1-CB 4.26Å; F35-C39 HydrophobicContact CE2-CB 4.22Å; F35-C39 HydrophobicContact CZ-CB 4.07Å; F35-C39 WeakPolarHBondContact O-CB 3.06Å; F35-C39 PolarHBondContact O-N 2.89Å; C39-A41 PolarHBondContact O-N 3.11Å; C39-A41 VanDerWaalsContact O-N 3.11Å; C39-C42 HydrophobicContact CB-CB 3.74Å; C39-C42 WeakPolarHBondContact CB-SG 3.13Å; C39-C42 WeakPolarHBondContact O-CB 3.43Å; C39-C42 PolarHBondContact O-N 3Å; C39-C42 WeakPolarHBondContact SG-CB 2.99Å; C39-C42 PolarHBondContact SG-N 3.41Å; C39-C42 CovalentContact SG-SG 2.06Å; C39-C42 PolarHBondContact SG-SG 3.16Å
40	E	73.2	Confident	75.7	Confident	174 Å²	174	98.5 Å²	98.5	81%	0.813	53%	0.533	S	S	*	.	H	α-helix	trans	-55.2	-29.6	173	-64.3	179.6	-169.8	0	0	112.6	E38 C42 C44	E38-E40 PolarHBondContact O-N 3.02Å; E40-C42 VanDerWaalsContact C-N 3.35Å; E40-C44 WeakPolarHBondContact O-CB 3.45Å; E40-C44 PolarHBondContact O-SG 3.46Å
41	A	72	Confident	74	Confident	60 Å²	60	97.3 Å²	97.3	50%	0.496	53%	0.532	S	S	.	.	H	α-helix	trans	-75.4	-21.3	179.6	0	0	0	0	0	114	C39 D43 C44 N45	C39-A41 PolarHBondContact O-N 3.11Å; C39-A41 VanDerWaalsContact O-N 3.11Å; A41-D43 VanDerWaalsContact C-N 3.33Å; A41-D43 PolarHBondContact O-N 3.49Å; A41-C44 PolarHBondContact O-N 3.15Å; A41-N45 PolarHBondContact O-N 2.06Å; A41-N45 VanDerWaalsContact O-N 3.15Å
42	C	65.6	Low	72.1	Confident	56 Å²	56	99.7 Å²	99.7	38%	0.378	54%	0.538	S	S	.	.	H	α-helix	trans	-72.7	-28.8	-173.6	-67.8	0	0	0	0	111.7	C39 E40	C39-C42 HydrophobicContact CB-CB 3.74Å; C39-C42 WeakPolarHBondContact CB-SG 3.13Å; C39-C42 WeakPolarHBondContact O-CB 3.43Å; C39-C42 PolarHBondContact O-N 3Å; C39-C42 WeakPolarHBondContact SG-CB 2.99Å; C39-C42 PolarHBondContact SG-N 3.41Å; C39-C42 CovalentContact SG-SG 2.06Å; C39-C42 PolarHBondContact SG-SG 3.16Å; E40-C42 VanDerWaalsContact C-N 3.35Å
43	D	61.6	Low	70.5	Confident	129 Å²	129	98.9 Å²	98.9	69%	0.69	54%	0.54	S	S	*	.	H	α-helix	trans	-94.5	-22.4	171.7	-73.9	-24	0	0	0	113.5	A41 T47	A41-D43 VanDerWaalsContact C-N 3.33Å; A41-D43 PolarHBondContact O-N 3.49Å; D43-T47 PolarHBondContact O-OG1 3.19Å
44	C	59.2	Low	68.8	Low	80 Å²	80	98.2 Å²	98.2	54%	0.541	54%	0.544	S	S	.	.	H	α-helix	trans	-85.2	-32.4	-174.4	-69.4	0	0	0	0	114.1	E40 A41 Y48	E40-C44 WeakPolarHBondContact O-CB 3.45Å; E40-C44 PolarHBondContact O-SG 3.46Å; A41-C44 PolarHBondContact O-N 3.15Å; C44-Y48 PolarHBondContact O-N 3.12Å; C44-Y48 VanDerWaalsContact O-N 3.16Å
45	N	57.4	Low	67.2	Low	99 Å²	99	103.1 Å²	103.1	53%	0.529	57%	0.566	S	S	.	*	H	α-helix	trans	-71.3	-38.4	-176	-113.5	18.7	0	0	0	112.5	A41 T47 Y48 L49	A41-N45 PolarHBondContact O-N 2.06Å; A41-N45 VanDerWaalsContact O-N 3.15Å; N45-T47 VanDerWaalsContact C-N 3.33Å; N45-T47 PolarHBondContact O-N 2.88Å; N45-Y48 PolarHBondContact O-N 3.16Å; N45-L49 VanDerWaalsContact O-CB 3.31Å; N45-L49 WeakPolarHBondContact O-CB 3.31Å; N45-L49 WeakPolarHBondContact O-CG 3.26Å; N45-L49 PolarHBondContact O-N 3.41Å
46	E	56.3	Low	65.1	Low	132 Å²	132	109.3 Å²	109.3	62%	0.617	60%	0.597	S	S	*	*	H	α-helix	trans	-66	-37.7	178.4	-69.4	-61.2	150.2	0	0	111.6	L49 S50	E46-L49 PolarHBondContact O-N 2.57Å; E46-S50 VanDerWaalsContact O-CB 3.26Å; E46-S50 WeakPolarHBondContact O-CB 3.16Å; E46-S50 PolarHBondContact O-N 3.34Å; E46-S50 PolarHBondContact O-OG 3.22Å
47	T	59.9	Low	64.1	Low	97 Å²	97	110.9 Å²	110.9	60%	0.595	60%	0.601	S	S	*	*	H	α-helix	trans	-66.8	-39.7	176.6	-49.2	0	0	0	0	111.8	D43 N45 S50 S51	D43-T47 PolarHBondContact O-OG1 3.19Å; N45-T47 VanDerWaalsContact C-N 3.33Å; N45-T47 PolarHBondContact O-N 2.88Å; T47-S50 PolarHBondContact O-OG 2.85Å; T47-S51 WeakPolarHBondContact O-CB 3.39Å; T47-S51 PolarHBondContact O-N 3.28Å; T47-S51 PolarHBondContact O-OG 3.39Å
48	Y	59.2	Low	62.9	Low	162 Å²	162	108.6 Å²	108.6	64%	0.635	59%	0.592	S	S	*	*	H	α-helix	trans	-69.3	-43	175.9	-171.7	-97.3	0	0	0	111.9	C44 N45 S51 N52	C44-Y48 PolarHBondContact O-N 3.12Å; C44-Y48 VanDerWaalsContact O-N 3.16Å; N45-Y48 PolarHBondContact O-N 3.16Å; Y48-S51 PolarHBondContact O-N 3.36Å; Y48-S51 PolarHBondContact O-OG 3.39Å; Y48-N52 PolarHBondContact O-N 3.47Å
49	L	59.7	Low	61.6	Low	96 Å²	96	106.6 Å²	106.6	50%	0.503	59%	0.587	S	S	.	*	H	α-helix	trans	-70.9	-36.1	-179.6	-68.1	170.9	0	0	0	113	N45 E46 N52 S53	N45-L49 VanDerWaalsContact O-CB 3.31Å; N45-L49 WeakPolarHBondContact O-CB 3.31Å; N45-L49 WeakPolarHBondContact O-CG 3.26Å; N45-L49 PolarHBondContact O-N 3.41Å; E46-L49 PolarHBondContact O-N 2.57Å; L49-N52 PolarHBondContact O-N 2.88Å; L49-S53 PolarHBondContact O-N 3.4Å; L49-S53 PolarHBondContact O-OG 3.44Å
50	S	61	Low	60.3	Low	67 Å²	67	111.5 Å²	111.5	47%	0.469	61%	0.612	S	S	.	*	H	α-helix	trans	-75	-25.8	176.5	53	0	0	0	0	113.6	E46 T47 N52 S53 T54	E46-S50 VanDerWaalsContact O-CB 3.26Å; E46-S50 WeakPolarHBondContact O-CB 3.16Å; E46-S50 PolarHBondContact O-N 3.34Å; E46-S50 PolarHBondContact O-OG 3.22Å; T47-S50 PolarHBondContact O-OG 2.85Å; S50-N52 VanDerWaalsContact C-N 3.34Å; S50-S53 PolarHBondContact O-OG 3.19Å; S50-T54 PolarHBondContact O-OG1 3.48Å
51	S	60.2	Low	59.5	Low	63 Å²	63	107.6 Å²	107.6	44%	0.441	60%	0.599	S	S	.	*	H	α-helix	trans	-75.9	-20.8	172.7	72.3	0	0	0	0	113.9	T47 Y48 N55	T47-S51 WeakPolarHBondContact O-CB 3.39Å; T47-S51 PolarHBondContact O-N 3.28Å; T47-S51 PolarHBondContact O-OG 3.39Å; Y48-S51 PolarHBondContact O-N 3.36Å; Y48-S51 PolarHBondContact O-OG 3.39Å; S51-N55 PolarHBondContact O-ND2 3.25Å
52	N	57.8	Low	58.6	Low	105 Å²	105	110.7 Å²	110.7	56%	0.561	61%	0.606	S	S	*	*	H	α-helix	trans	-95.1	-15.1	-178.7	-150.7	46.3	0	0	0	113.4	Y48 L49 S50	Y48-N52 PolarHBondContact O-N 3.47Å; L49-N52 PolarHBondContact O-N 2.88Å; S50-N52 VanDerWaalsContact C-N 3.34Å
53	S	59.7	Low	58.1	Low	85 Å²	85	114.6 Å²	114.6	59%	0.594	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.1	-4.5	178.1	55.7	0	0	0	0	114.6	L49 S50	L49-S53 PolarHBondContact O-N 3.4Å; L49-S53 PolarHBondContact O-OG 3.44Å; S50-S53 PolarHBondContact O-OG 3.19Å
54	T	59.3	Low	57.9	Low	109 Å²	109	113.5 Å²	113.5	67%	0.669	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.2	5.6	174.1	30.3	0	0	0	0	113.5	S50	S50-T54 PolarHBondContact O-OG1 3.48Å
55	N	57.3	Low	57.8	Low	134 Å²	134	116.3 Å²	116.3	72%	0.717	62%	0.624	S	S	*	*			trans	-118.6	12.8	-178.9	-69.9	-48	0	0	0	114.5	S51	S51-N55 PolarHBondContact O-ND2 3.25Å
56	E	45.4	Very low	57.8	Low	247 Å²	247	117.9 Å²	117.9	100%	1.154	63%	0.632	S	S	*	*			trans	-114.2	0	163.6	-74.3	-169.1	132.2	0	0	110.2

Retrieved 56 of 56 residues in 256.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).