Y840_STAAM Loading...

UPF0337 protein SAV0840

AlphaFold DB (Q2FZY9), UniProt , Accession Q99VG5, Species STAAM (Staphylococcus aureus (strain Mu50 / ATCC 700699)), Gene n/a, Length 64 aa.

						>Y840_STAAM|Q99VG5
MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.1	Low	75.9	Confident	170 Å²	170	94.3 Å²	94.3	84%	0.837	48%	0.484	S	S	*	.				0	-38	0	-87.7	153.1	176.1	0	112.7	D3 E4 S5	M1-D3 VanDerWaalsContact C-N 3.3Å; M1-D3 PolarHBondContact O-N 3.43Å; M1-E4 PolarHBondContact O-N 3.41Å; M1-S5 PolarHBondContact O-N 3.12Å; M1-S5 PolarHBondContact O-OG 3.42Å
2	A	60.9	Low	77.1	Confident	66 Å²	66	86.4 Å²	86.4	55%	0.545	44%	0.444	S	S	.	.	H	α-helix	trans	-56.6	-38.9	176.1	0	0	0	0	113.8	K6	A2-K6 PolarHBondContact O-N 2.86Å; A2-K6 VanDerWaalsContact O-N 3.17Å
3	D	68.3	Low	78.1	Confident	132 Å²	132	85.5 Å²	85.5	71%	0.706	44%	0.44	S	S	*	.	H	α-helix	trans	-68.2	-41.5	-178.8	-56.2	-84	0	0	112.9	M1 K6 F7	M1-D3 VanDerWaalsContact C-N 3.3Å; M1-D3 PolarHBondContact O-N 3.43Å; D3-K6 PolarHBondContact O-N 2.9Å; D3-F7 WeakPolarHBondContact O-CB 3.45Å; D3-F7 PolarHBondContact O-N 3.36Å
4	E	68.3	Low	79.2	Confident	133 Å²	133	85.9 Å²	85.9	62%	0.621	45%	0.448	S	S	*	.	H	α-helix	trans	-65.2	-42.4	178.8	-160.6	117.1	71.7	0	110.8	M1 K6 F7 E8	M1-E4 PolarHBondContact O-N 3.41Å; E4-K6 PolarHBondContact O-N 3.48Å; E4-F7 PolarHBondContact O-N 3.39Å; E4-F7 VanDerWaalsContact O-N 3.16Å; E4-E8 WeakPolarHBondContact O-CB 3.07Å; E4-E8 WeakPolarHBondContact O-CG 3.39Å; E4-E8 PolarHBondContact O-N 3.43Å
5	S	73.7	Confident	80.1	Confident	12 Å²	12	82.7 Å²	82.7	8%	0.084	43%	0.429	C	S	.	.	H	α-helix	trans	-63.9	-41.9	178.3	-64.7	0	0	0	112	M1 F7 E8 Q9	M1-S5 PolarHBondContact O-N 3.12Å; M1-S5 PolarHBondContact O-OG 3.42Å; S5-F7 VanDerWaalsContact C-N 3.33Å; S5-F7 PolarHBondContact O-N 2.79Å; S5-E8 PolarHBondContact O-N 3Å; S5-Q9 WeakPolarHBondContact O-CB 3.37Å; S5-Q9 VanDerWaalsContact O-CG 3.28Å; S5-Q9 WeakPolarHBondContact O-CG 3.21Å; S5-Q9 PolarHBondContact O-N 2.97Å
6	K	80.9	Confident	80.8	Confident	144 Å²	144	80.9 Å²	80.9	63%	0.626	42%	0.418	S	S	*	.	H	α-helix	trans	-64.9	-38.9	174.2	-73.4	-174.6	-169.7	-179.5	111.9	A2 D3 E4 Q9 A10	A2-K6 PolarHBondContact O-N 2.86Å; A2-K6 VanDerWaalsContact O-N 3.17Å; D3-K6 PolarHBondContact O-N 2.9Å; E4-K6 PolarHBondContact O-N 3.48Å; K6-Q9 PolarHBondContact O-N 3.16Å; K6-A10 VanDerWaalsContact O-CB 3.31Å; K6-A10 WeakPolarHBondContact O-CB 3.41Å; K6-A10 PolarHBondContact O-N 3.19Å
7	F	84.8	Confident	81.6	Confident	128 Å²	128	80.5 Å²	80.5	56%	0.561	42%	0.42	S	S	*	.	H	α-helix	trans	-66	-45.8	177.7	-178.3	-98.7	0	0	111.7	D3 E4 S5 A10 K11	D3-F7 WeakPolarHBondContact O-CB 3.45Å; D3-F7 PolarHBondContact O-N 3.36Å; E4-F7 PolarHBondContact O-N 3.39Å; E4-F7 VanDerWaalsContact O-N 3.16Å; S5-F7 VanDerWaalsContact C-N 3.33Å; S5-F7 PolarHBondContact O-N 2.79Å; F7-A10 PolarHBondContact O-N 2.9Å; F7-K11 HydrophobicContact CE1-CD 4.26Å; F7-K11 VanDerWaalsContact O-CB 3.23Å; F7-K11 WeakPolarHBondContact O-CB 3.37Å; F7-K11 PolarHBondContact O-N 3.43Å
8	E	84.3	Confident	82.3	Confident	56 Å²	56	80.2 Å²	80.2	26%	0.262	42%	0.422	S	S	.	.	H	α-helix	trans	-59.9	-46.2	173.3	-72	-160.8	117.8	0	110.7	E4 S5 A10 K11 G12 D34	E4-E8 WeakPolarHBondContact O-CB 3.07Å; E4-E8 WeakPolarHBondContact O-CG 3.39Å; E4-E8 PolarHBondContact O-N 3.43Å; S5-E8 PolarHBondContact O-N 3Å; E8-A10 PolarHBondContact O-N 2.97Å; E8-K11 PolarHBondContact O-N 3.32Å; E8-G12 PolarHBondContact O-N 2.78Å; E8-D34 VanDerWaalsContact CA-OD1 3.29Å; E8-D34 WeakPolarHBondContact CA-OD1 3.41Å; E8-D34 VanDerWaalsContact CB-OD1 3.32Å; E8-D34 WeakPolarHBondContact CB-OD1 3.31Å
9	Q	83.4	Confident	83	Confident	48 Å²	48	75.9 Å²	75.9	22%	0.224	40%	0.4	C	S	.	.	H	α-helix	trans	-58.8	-44.6	174	-75.2	-177	-68.4	0	112.8	S5 K6 G12 N13	S5-Q9 WeakPolarHBondContact O-CB 3.37Å; S5-Q9 VanDerWaalsContact O-CG 3.28Å; S5-Q9 WeakPolarHBondContact O-CG 3.21Å; S5-Q9 PolarHBondContact O-N 2.97Å; K6-Q9 PolarHBondContact O-N 3.16Å; Q9-G12 PolarHBondContact O-N 3.18Å; Q9-N13 WeakPolarHBondContact O-CB 3.4Å; Q9-N13 PolarHBondContact O-N 3.06Å
10	A	88.2	Confident	83.5	Confident	54 Å²	54	77.4 Å²	77.4	45%	0.446	41%	0.408	S	S	.	.	H	α-helix	trans	-65.2	-46.3	179	0	0	0	0	111.4	K6 F7 E8 G12 N13 V14	K6-A10 VanDerWaalsContact O-CB 3.31Å; K6-A10 WeakPolarHBondContact O-CB 3.41Å; K6-A10 PolarHBondContact O-N 3.19Å; F7-A10 PolarHBondContact O-N 2.9Å; E8-A10 PolarHBondContact O-N 2.97Å; A10-G12 VanDerWaalsContact C-N 3.34Å; A10-G12 PolarHBondContact O-N 2.9Å; A10-N13 PolarHBondContact O-N 2.79Å; A10-V14 WeakPolarHBondContact O-CG2 3.25Å; A10-V14 PolarHBondContact O-N 3.31Å
11	K	88.2	Confident	84.1	Confident	94 Å²	94	79.3 Å²	79.3	41%	0.409	42%	0.422	S	S	.	.	H	α-helix	trans	-60.2	-44.6	176.1	-175.4	-175.2	-178.2	-171.8	111.1	F7 E8 N13 V14 K15	F7-K11 HydrophobicContact CE1-CD 4.26Å; F7-K11 VanDerWaalsContact O-CB 3.23Å; F7-K11 WeakPolarHBondContact O-CB 3.37Å; F7-K11 PolarHBondContact O-N 3.43Å; E8-K11 PolarHBondContact O-N 3.32Å; K11-N13 PolarHBondContact O-N 3.01Å; K11-V14 PolarHBondContact O-N 2.96Å; K11-K15 WeakPolarHBondContact O-CB 3.49Å; K11-K15 WeakPolarHBondContact O-CG 3.38Å; K11-K15 PolarHBondContact O-N 3.36Å
12	G	90.4	Very high	86.1	Confident	0 Å²	0	75.4 Å²	75.4	0%	0	41%	0.408	C	S	.	.	H	α-helix	trans	-58.8	-45.5	174.5	0	0	0	0	112.1	E8 Q9 A10 V14 K15 E16 G31	E8-G12 PolarHBondContact O-N 2.78Å; Q9-G12 PolarHBondContact O-N 3.18Å; A10-G12 VanDerWaalsContact C-N 3.34Å; A10-G12 PolarHBondContact O-N 2.9Å; G12-V14 PolarHBondContact O-N 3.02Å; G12-K15 PolarHBondContact O-N 3.46Å; G12-E16 WeakPolarHBondContact O-CB 3.37Å; G12-E16 PolarHBondContact O-N 3.41Å; G12-G31 CarbonylContact C-O 3.53Å; G12-G31 VanDerWaalsContact CA-O 3.24Å; G12-G31 WeakPolarHBondContact CA-O 3.3Å; G12-G31 CarbonylContact O-C 3.44Å; G12-G31 WeakPolarHBondContact O-CA 3.23Å
13	N	89.2	Confident	87.7	Confident	74 Å²	74	79.7 Å²	79.7	40%	0.396	42%	0.422	S	S	.	.	H	α-helix	trans	-64.9	-38.9	178.2	-139.6	66.1	0	0	112.5	Q9 A10 K11 T17 K35	Q9-N13 WeakPolarHBondContact O-CB 3.4Å; Q9-N13 PolarHBondContact O-N 3.06Å; A10-N13 PolarHBondContact O-N 2.79Å; K11-N13 PolarHBondContact O-N 3.01Å; N13-T17 WeakPolarHBondContact O-CB 3.19Å; N13-T17 PolarHBondContact O-N 2.81Å; N13-T17 PolarHBondContact O-OG1 3.33Å; N13-K35 WeakPolarHBondContact OD1-CE 3.29Å; N13-K35 PolarHBondContact OD1-NZ 2.81Å
14	V	93.6	Very high	89	Confident	91 Å²	91	76.5 Å²	76.5	55%	0.552	41%	0.405	S	S	*	.	H	α-helix	trans	-65.9	-47.8	174.7	172.8	0	0	0	110.5	A10 K11 G12 E16 T17 V18	A10-V14 WeakPolarHBondContact O-CG2 3.25Å; A10-V14 PolarHBondContact O-N 3.31Å; K11-V14 PolarHBondContact O-N 2.96Å; G12-V14 PolarHBondContact O-N 3.02Å; V14-E16 PolarHBondContact O-N 3.18Å; V14-T17 PolarHBondContact O-N 3.47Å; V14-V18 HydrophobicContact CG1-CG2 4Å; V14-V18 VanDerWaalsContact O-CB 3.3Å; V14-V18 WeakPolarHBondContact O-CB 3.44Å; V14-V18 WeakPolarHBondContact O-CG2 3.12Å; V14-V18 PolarHBondContact O-N 2.8Å
15	K	93.8	Very high	90.2	Very high	39 Å²	39	77.5 Å²	77.5	17%	0.17	41%	0.407	C	S	.	.	H	α-helix	trans	-60.7	-42.5	176.3	-76.5	-175.5	-177.7	-177.3	112.2	K11 G12 G19 L27 E30	K11-K15 WeakPolarHBondContact O-CB 3.49Å; K11-K15 WeakPolarHBondContact O-CG 3.38Å; K11-K15 PolarHBondContact O-N 3.36Å; G12-K15 PolarHBondContact O-N 3.46Å; K15-G19 WeakPolarHBondContact O-CA 3.38Å; K15-G19 PolarHBondContact O-N 3.19Å; K15-L27 CarbonylContact C-O 3.45Å; K15-L27 HydrophobicContact CB-CD2 4.46Å; K15-L27 HydrophobicContact CB-CG 4.37Å; K15-L27 HydrophobicContact CG-CG 4.47Å; K15-L27 WeakPolarHBondContact O-CD2 3.33Å; K15-E30 HydrophobicContact CD-CB 4.07Å; K15-E30 IonicContact NZ-OE1 3.96Å; K15-E30 PolarHBondContact NZ-OE1 2.98Å
16	E	91	Very high	91.2	Very high	53 Å²	53	82.7 Å²	82.7	25%	0.248	43%	0.434	C	S	.	.	H	α-helix	trans	-59.1	-49.9	176	-177.2	178.4	79.7	0	110.5	G12 V14 G19 N20 K35	G12-E16 WeakPolarHBondContact O-CB 3.37Å; G12-E16 PolarHBondContact O-N 3.41Å; V14-E16 PolarHBondContact O-N 3.18Å; E16-G19 PolarHBondContact O-N 2.97Å; E16-N20 WeakPolarHBondContact O-CB 3.32Å; E16-N20 PolarHBondContact O-N 3.49Å; E16-K35 IonicContact OE1-NZ 2.73Å; E16-K35 PolarHBondContact OE1-NZ 2.98Å; E16-K35 IonicContact OE2-NZ 2.75Å
17	T	94.1	Very high	91.8	Very high	75 Å²	75	78 Å²	78	46%	0.46	42%	0.416	S	S	.	.	H	α-helix	trans	-66.7	-49.3	-178.5	-54.1	0	0	0	111.8	N13 V14 G19 N20 V21	N13-T17 WeakPolarHBondContact O-CB 3.19Å; N13-T17 PolarHBondContact O-N 2.81Å; N13-T17 PolarHBondContact O-OG1 3.33Å; V14-T17 PolarHBondContact O-N 3.47Å; T17-G19 VanDerWaalsContact C-N 3.27Å; T17-G19 PolarHBondContact O-N 2.83Å; T17-N20 PolarHBondContact O-N 2.88Å; T17-V21 HydrophobicContact CG2-CG2 4.44Å; T17-V21 WeakPolarHBondContact O-CB 3.3Å; T17-V21 WeakPolarHBondContact O-CG2 3.46Å; T17-V21 PolarHBondContact O-N 3.39Å
18	V	94.8	Very high	92.1	Very high	74 Å²	74	75 Å²	75	45%	0.448	40%	0.403	S	S	.	.	H	α-helix	trans	-63.6	-38.5	178.9	174.9	0	0	0	110.2	V14 V21 T22 L27	V14-V18 HydrophobicContact CG1-CG2 4Å; V14-V18 VanDerWaalsContact O-CB 3.3Å; V14-V18 WeakPolarHBondContact O-CB 3.44Å; V14-V18 WeakPolarHBondContact O-CG2 3.12Å; V14-V18 PolarHBondContact O-N 2.8Å; V18-V21 PolarHBondContact O-N 3.26Å; V18-T22 WeakPolarHBondContact O-CB 3.32Å; V18-T22 WeakPolarHBondContact O-CG2 3.35Å; V18-T22 PolarHBondContact O-N 3.46Å; V18-L27 HydrophobicContact CB-CD2 3.74Å; V18-L27 HydrophobicContact CG1-CD2 3.62Å
19	G	95.1	Very high	92.6	Very high	0 Å²	0	77 Å²	77	0%	0	42%	0.416	C	S	.	.	H	α-helix	trans	-62.9	-48.9	177.3	0	0	0	0	111.7	K15 E16 T17 V21 T22 D23 N24	K15-G19 WeakPolarHBondContact O-CA 3.38Å; K15-G19 PolarHBondContact O-N 3.19Å; E16-G19 PolarHBondContact O-N 2.97Å; T17-G19 VanDerWaalsContact C-N 3.27Å; T17-G19 PolarHBondContact O-N 2.83Å; G19-V21 PolarHBondContact O-N 3.16Å; G19-T22 PolarHBondContact O-N 3.31Å; G19-D23 CarbonylContact O-C 3.57Å; G19-D23 WeakPolarHBondContact O-CA 3.24Å; G19-D23 PolarHBondContact O-N 2.93Å; G19-N24 PolarHBondContact O-N 3.5Å
20	N	93.2	Very high	92.9	Very high	105 Å²	105	79.2 Å²	79.2	56%	0.561	43%	0.426	S	S	*	.	H	α-helix	trans	-62.2	-42	174.7	179.1	96.3	0	0	111.9	E16 T17 D23	E16-N20 WeakPolarHBondContact O-CB 3.32Å; E16-N20 PolarHBondContact O-N 3.49Å; T17-N20 PolarHBondContact O-N 2.88Å; N20-D23 PolarHBondContact O-N 2.81Å
21	V	95.3	Very high	93.1	Very high	117 Å²	117	76.6 Å²	76.6	71%	0.709	41%	0.405	S	S	*	.	H	α-helix	trans	-67.3	-38.8	179.7	170	0	0	0	112.1	T17 V18 G19 D23	T17-V21 HydrophobicContact CG2-CG2 4.44Å; T17-V21 WeakPolarHBondContact O-CB 3.3Å; T17-V21 WeakPolarHBondContact O-CG2 3.46Å; T17-V21 PolarHBondContact O-N 3.39Å; V18-V21 PolarHBondContact O-N 3.26Å; G19-V21 PolarHBondContact O-N 3.16Å; V21-D23 VanDerWaalsContact C-N 3.33Å
22	T	95.8	Very high	93.2	Very high	89 Å²	89	78.4 Å²	78.4	55%	0.546	41%	0.413	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.6	9.4	-179.9	-162.1	0	0	0	113.5	V18 G19 N24	V18-T22 WeakPolarHBondContact O-CB 3.32Å; V18-T22 WeakPolarHBondContact O-CG2 3.35Å; V18-T22 PolarHBondContact O-N 3.46Å; G19-T22 PolarHBondContact O-N 3.31Å; T22-N24 HydrophobicContact CG2-CB 3.39Å; T22-N24 PolarHBondContact O-N 3.23Å; T22-N24 VanDerWaalsContact O-N 3.12Å
23	D	94.4	Very high	93.1	Very high	156 Å²	156	84.9 Å²	84.9	83%	0.834	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.5	30.2	-175	-134.9	-85.5	0	0	113.3	G19 N20 V21 K25	G19-D23 CarbonylContact O-C 3.57Å; G19-D23 WeakPolarHBondContact O-CA 3.24Å; G19-D23 PolarHBondContact O-N 2.93Å; N20-D23 PolarHBondContact O-N 2.81Å; V21-D23 VanDerWaalsContact C-N 3.33Å; D23-K25 PolarHBondContact O-N 3.48Å
24	N	95.5	Very high	93	Very high	64 Å²	64	82.7 Å²	82.7	34%	0.342	43%	0.431	S	S	.	.			trans	-94.8	95.2	178.9	-174.9	-17.3	0	0	110.2	G19 T22 N26 L27 E28	G19-N24 PolarHBondContact O-N 3.5Å; T22-N24 HydrophobicContact CG2-CB 3.39Å; T22-N24 PolarHBondContact O-N 3.23Å; T22-N24 VanDerWaalsContact O-N 3.12Å; N24-N26 PolarHBondContact O-N 2.93Å; N24-N26 WeakPolarHBondContact OD1-CB 3.44Å; N24-N26 PolarHBondContact OD1-N 2.76Å; N24-L27 HydrophobicContact CB-CB 4.07Å; N24-L27 PolarHBondContact O-N 3.49Å; N24-L27 VanDerWaalsContact O-N 3.16Å; N24-L27 PolarHBondContact OD1-N 2.75Å; N24-E28 PolarHBondContact O-N 3.44Å
25	K	94.1	Very high	92.5	Very high	155 Å²	155	81.1 Å²	81.1	67%	0.674	42%	0.417	S	S	*	.	H	α-helix	trans	-49.5	-38.7	175.3	-158.4	83	173.3	174.5	113.4	D23 N29	D23-K25 PolarHBondContact O-N 3.48Å; K25-N29 VanDerWaalsContact O-CB 3.25Å; K25-N29 WeakPolarHBondContact O-CB 3.34Å; K25-N29 PolarHBondContact O-N 3.37Å
26	N	94.3	Very high	92.1	Very high	120 Å²	120	82 Å²	82	64%	0.642	43%	0.431	S	S	*	.	H	α-helix	trans	-70	-46.1	-177.2	-62.6	7.2	0	0	110.3	N24 N29 E30	N24-N26 PolarHBondContact O-N 2.93Å; N24-N26 WeakPolarHBondContact OD1-CB 3.44Å; N24-N26 PolarHBondContact OD1-N 2.76Å; N26-N29 PolarHBondContact O-N 3.25Å; N26-E30 WeakPolarHBondContact O-CB 3.49Å; N26-E30 PolarHBondContact O-N 2.94Å
27	L	93.5	Very high	91.6	Very high	47 Å²	47	82.5 Å²	82.5	25%	0.246	44%	0.441	C	S	.	.	H	α-helix	trans	-66.5	-40	179.7	-150.9	105.5	0	0	111.2	K15 V18 N24 G31	K15-L27 CarbonylContact C-O 3.45Å; K15-L27 HydrophobicContact CB-CD2 4.46Å; K15-L27 HydrophobicContact CB-CG 4.37Å; K15-L27 HydrophobicContact CG-CG 4.47Å; K15-L27 WeakPolarHBondContact O-CD2 3.33Å; V18-L27 HydrophobicContact CB-CD2 3.74Å; V18-L27 HydrophobicContact CG1-CD2 3.62Å; N24-L27 HydrophobicContact CB-CB 4.07Å; N24-L27 PolarHBondContact O-N 3.49Å; N24-L27 VanDerWaalsContact O-N 3.16Å; N24-L27 PolarHBondContact OD1-N 2.75Å; L27-G31 PolarHBondContact O-N 3.44Å
28	E	92.9	Very high	90.9	Very high	64 Å²	64	79 Å²	79	30%	0.299	42%	0.419	S	S	.	.	H	α-helix	trans	-58.6	-50.1	172.7	179.8	-173.5	91.8	0	111.2	N24 G31 K32	N24-E28 PolarHBondContact O-N 3.44Å; E28-G31 PolarHBondContact O-N 2.88Å; E28-K32 PolarHBondContact O-N 2.89Å
29	N	93.9	Very high	90.2	Very high	99 Å²	99	81.4 Å²	81.4	53%	0.529	42%	0.424	S	S	.	.	H	α-helix	trans	-66.6	-41.9	-176.9	-165	68.5	0	0	112.2	K25 N26 G31 K32 E33	K25-N29 VanDerWaalsContact O-CB 3.25Å; K25-N29 WeakPolarHBondContact O-CB 3.34Å; K25-N29 PolarHBondContact O-N 3.37Å; N26-N29 PolarHBondContact O-N 3.25Å; N29-G31 VanDerWaalsContact C-N 3.31Å; N29-G31 PolarHBondContact O-N 2.96Å; N29-K32 PolarHBondContact O-N 2.88Å; N29-E33 WeakPolarHBondContact O-CB 3.41Å; N29-E33 PolarHBondContact O-N 3.3Å
30	E	90	Very high	89.5	Confident	93 Å²	93	84 Å²	84	44%	0.435	45%	0.445	S	S	.	.	H	α-helix	trans	-57.5	-45.6	170.9	-82.5	-168	66.6	0	111.3	K15 N26 K32 E33 D34	K15-E30 HydrophobicContact CD-CB 4.07Å; K15-E30 IonicContact NZ-OE1 3.96Å; K15-E30 PolarHBondContact NZ-OE1 2.98Å; N26-E30 WeakPolarHBondContact O-CB 3.49Å; N26-E30 PolarHBondContact O-N 2.94Å; E30-K32 VanDerWaalsContact C-N 3.31Å; E30-K32 PolarHBondContact O-N 3.48Å; E30-E33 PolarHBondContact O-N 3.33Å; E30-D34 WeakPolarHBondContact O-CB 3.28Å; E30-D34 PolarHBondContact O-N 2.87Å
31	G	92.2	Very high	88.9	Confident	0 Å²	0	84.6 Å²	84.6	0%	0	44%	0.443	C	S	.	.	H	α-helix	trans	-61.1	-41.3	-179.7	0	0	0	0	113.1	G12 L27 E28 N29 K35	G12-G31 CarbonylContact C-O 3.53Å; G12-G31 VanDerWaalsContact CA-O 3.24Å; G12-G31 WeakPolarHBondContact CA-O 3.3Å; G12-G31 CarbonylContact O-C 3.44Å; G12-G31 WeakPolarHBondContact O-CA 3.23Å; L27-G31 PolarHBondContact O-N 3.44Å; E28-G31 PolarHBondContact O-N 2.88Å; N29-G31 VanDerWaalsContact C-N 3.31Å; N29-G31 PolarHBondContact O-N 2.96Å; G31-K35 WeakPolarHBondContact O-CB 3.32Å; G31-K35 PolarHBondContact O-N 3.25Å; G31-K35 VanDerWaalsContact O-N 3.16Å
32	K	89.5	Confident	88	Confident	132 Å²	132	83.3 Å²	83.3	57%	0.574	43%	0.429	S	S	*	.	H	α-helix	trans	-66.4	-40.9	176.2	-166	-179.2	-175	-169.6	112.3	E28 N29 E30 A36	E28-K32 PolarHBondContact O-N 2.89Å; N29-K32 PolarHBondContact O-N 2.88Å; E30-K32 VanDerWaalsContact C-N 3.31Å; E30-K32 PolarHBondContact O-N 3.48Å; K32-A36 WeakPolarHBondContact O-CB 3.41Å; K32-A36 PolarHBondContact O-N 2.87Å
33	E	89.7	Confident	87.3	Confident	136 Å²	136	86.4 Å²	86.4	64%	0.636	44%	0.435	S	S	*	.	H	α-helix	trans	-66.7	-46.1	178.5	-170	172.3	96	0	111.9	N29 E30 K35 A36 S37	N29-E33 WeakPolarHBondContact O-CB 3.41Å; N29-E33 PolarHBondContact O-N 3.3Å; E30-E33 PolarHBondContact O-N 3.33Å; E33-K35 VanDerWaalsContact C-N 3.32Å; E33-K35 PolarHBondContact O-N 3.36Å; E33-A36 PolarHBondContact O-N 3.37Å; E33-S37 WeakPolarHBondContact O-CB 3.3Å; E33-S37 PolarHBondContact O-N 2.8Å
34	D	86.1	Confident	86.8	Confident	28 Å²	28	83 Å²	83	15%	0.15	42%	0.42	C	S	.	.	H	α-helix	trans	-56.9	-46.4	176.6	-140.3	-86.3	0	0	110.3	E8 E30 A36 S37 G38	E8-D34 VanDerWaalsContact CA-OD1 3.29Å; E8-D34 WeakPolarHBondContact CA-OD1 3.41Å; E8-D34 VanDerWaalsContact CB-OD1 3.32Å; E8-D34 WeakPolarHBondContact CB-OD1 3.31Å; E30-D34 WeakPolarHBondContact O-CB 3.28Å; E30-D34 PolarHBondContact O-N 2.87Å; D34-A36 PolarHBondContact O-N 3.46Å; D34-S37 PolarHBondContact O-N 3.48Å; D34-G38 PolarHBondContact O-N 3.5Å
35	K	83.1	Confident	86.2	Confident	57 Å²	57	84.1 Å²	84.1	25%	0.248	42%	0.423	C	S	.	.	H	α-helix	trans	-64.8	-39.7	177.4	-176.5	174.3	177.4	174.5	113	N13 E16 G31 E33 K39	N13-K35 WeakPolarHBondContact OD1-CE 3.29Å; N13-K35 PolarHBondContact OD1-NZ 2.81Å; E16-K35 IonicContact OE1-NZ 2.73Å; E16-K35 PolarHBondContact OE1-NZ 2.98Å; E16-K35 IonicContact OE2-NZ 2.75Å; G31-K35 WeakPolarHBondContact O-CB 3.32Å; G31-K35 PolarHBondContact O-N 3.25Å; G31-K35 VanDerWaalsContact O-N 3.16Å; E33-K35 VanDerWaalsContact C-N 3.32Å; E33-K35 PolarHBondContact O-N 3.36Å; K35-K39 PolarHBondContact O-N 3.16Å
36	A	85.1	Confident	85.6	Confident	57 Å²	57	80.5 Å²	80.5	47%	0.471	41%	0.411	S	S	.	.	H	α-helix	trans	-70.1	-44.1	177.7	0	0	0	0	111.5	K32 E33 D34 K39 A40	K32-A36 WeakPolarHBondContact O-CB 3.41Å; K32-A36 PolarHBondContact O-N 2.87Å; E33-A36 PolarHBondContact O-N 3.37Å; D34-A36 PolarHBondContact O-N 3.46Å; A36-K39 PolarHBondContact O-N 2.92Å; A36-A40 VanDerWaalsContact O-CB 3.3Å; A36-A40 WeakPolarHBondContact O-CB 3.42Å; A36-A40 PolarHBondContact O-N 3.02Å
37	S	81.8	Confident	85.1	Confident	65 Å²	65	76.9 Å²	76.9	46%	0.455	40%	0.398	S	S	.	.	H	α-helix	trans	-60.4	-47.1	177.4	-171.3	0	0	0	111.1	E33 D34 K39 A40 K41	E33-S37 WeakPolarHBondContact O-CB 3.3Å; E33-S37 PolarHBondContact O-N 2.8Å; D34-S37 PolarHBondContact O-N 3.48Å; S37-K39 PolarHBondContact O-N 3.17Å; S37-A40 PolarHBondContact O-N 2.95Å; S37-K41 VanDerWaalsContact O-CB 3.3Å; S37-K41 WeakPolarHBondContact O-CB 3.49Å; S37-K41 PolarHBondContact O-N 3.5Å
38	G	78.8	Confident	84.8	Confident	0 Å²	0	81.4 Å²	81.4	0%	0	42%	0.415	C	S	.	.	H	α-helix	trans	-58.3	-47.3	176.6	0	0	0	0	112.8	D34 K41 E42	D34-G38 PolarHBondContact O-N 3.5Å; G38-K41 PolarHBondContact O-N 3.24Å; G38-E42 WeakPolarHBondContact O-CB 3.35Å; G38-E42 PolarHBondContact O-N 3.37Å
39	K	79.3	Confident	84.4	Confident	126 Å²	126	84.8 Å²	84.8	55%	0.548	43%	0.431	S	S	.	.	H	α-helix	trans	-65.5	-42	177.2	-75.9	-166.6	176.2	-152.4	113.1	K35 A36 S37 K41 E42 F43	K35-K39 PolarHBondContact O-N 3.16Å; A36-K39 PolarHBondContact O-N 2.92Å; S37-K39 PolarHBondContact O-N 3.17Å; K39-K41 VanDerWaalsContact C-N 3.35Å; K39-E42 PolarHBondContact O-N 2.78Å; K39-F43 WeakPolarHBondContact O-CB 3.47Å; K39-F43 PolarHBondContact O-N 3.45Å
40	A	81.4	Confident	83.9	Confident	54 Å²	54	87.2 Å²	87.2	45%	0.446	44%	0.437	S	S	.	.	H	α-helix	trans	-64.6	-42.8	179.7	0	0	0	0	110.9	A36 S37 F43 V44	A36-A40 VanDerWaalsContact O-CB 3.3Å; A36-A40 WeakPolarHBondContact O-CB 3.42Å; A36-A40 PolarHBondContact O-N 3.02Å; S37-A40 PolarHBondContact O-N 2.95Å; A40-F43 PolarHBondContact O-N 3.41Å; A40-V44 WeakPolarHBondContact O-CB 3.22Å; A40-V44 WeakPolarHBondContact O-CG2 3.22Å; A40-V44 PolarHBondContact O-N 3.5Å
41	K	79.3	Confident	83.8	Confident	118 Å²	118	85 Å²	85	51%	0.513	44%	0.435	S	S	.	.	H	α-helix	trans	-62	-47.5	176.6	-157.7	-179.8	-153.9	175.9	111.1	S37 G38 K39 F43 V44 E45	S37-K41 VanDerWaalsContact O-CB 3.3Å; S37-K41 WeakPolarHBondContact O-CB 3.49Å; S37-K41 PolarHBondContact O-N 3.5Å; G38-K41 PolarHBondContact O-N 3.24Å; K39-K41 VanDerWaalsContact C-N 3.35Å; K41-F43 VanDerWaalsContact C-N 3.34Å; K41-F43 PolarHBondContact O-N 2.99Å; K41-V44 PolarHBondContact O-N 2.83Å; K41-E45 VanDerWaalsContact O-CB 3.24Å; K41-E45 WeakPolarHBondContact O-CB 3.33Å; K41-E45 PolarHBondContact O-N 2.88Å
42	E	76.8	Confident	83.5	Confident	90 Å²	90	89.1 Å²	89.1	42%	0.421	46%	0.46	S	S	.	.	H	α-helix	trans	-60.5	-43.5	177.4	-163.8	-175.9	101.3	0	111.5	G38 K39 N46	G38-E42 WeakPolarHBondContact O-CB 3.35Å; G38-E42 PolarHBondContact O-N 3.37Å; K39-E42 PolarHBondContact O-N 2.78Å; E42-N46 WeakPolarHBondContact O-CB 3.21Å; E42-N46 PolarHBondContact O-N 3.42Å; E42-N46 PolarHBondContact O-ND2 3.05Å
43	F	82	Confident	83.3	Confident	153 Å²	153	87.1 Å²	87.1	67%	0.671	46%	0.455	S	S	*	.	H	α-helix	trans	-65.9	-45.4	177.7	-174.4	-95.3	0	0	112.6	K39 A40 K41 A47	K39-F43 WeakPolarHBondContact O-CB 3.47Å; K39-F43 PolarHBondContact O-N 3.45Å; A40-F43 PolarHBondContact O-N 3.41Å; K41-F43 VanDerWaalsContact C-N 3.34Å; K41-F43 PolarHBondContact O-N 2.99Å; F43-A47 WeakPolarHBondContact O-CB 3.24Å; F43-A47 PolarHBondContact O-N 2.83Å
44	V	84	Confident	83.2	Confident	86 Å²	86	87.1 Å²	87.1	52%	0.521	45%	0.454	S	S	.	.	H	α-helix	trans	-66.1	-39.8	179.2	170.2	0	0	0	111.1	A40 K41 A47 K48	A40-V44 WeakPolarHBondContact O-CB 3.22Å; A40-V44 WeakPolarHBondContact O-CG2 3.22Å; A40-V44 PolarHBondContact O-N 3.5Å; K41-V44 PolarHBondContact O-N 2.83Å; V44-A47 PolarHBondContact O-N 3.44Å; V44-K48 WeakPolarHBondContact O-CB 3.35Å; V44-K48 PolarHBondContact O-N 3.34Å
45	E	82.1	Confident	83.3	Confident	87 Å²	87	91 Å²	91	41%	0.407	47%	0.473	S	S	.	.	H	α-helix	trans	-66.9	-47.5	178.7	-153.6	-177.2	117.7	0	110.6	K41 A47 K48 E49	K41-E45 VanDerWaalsContact O-CB 3.24Å; K41-E45 WeakPolarHBondContact O-CB 3.33Å; K41-E45 PolarHBondContact O-N 2.88Å; E45-A47 VanDerWaalsContact C-N 3.34Å; E45-A47 PolarHBondContact O-N 2.88Å; E45-K48 PolarHBondContact O-N 2.87Å; E45-E49 WeakPolarHBondContact O-CB 3.45Å; E45-E49 PolarHBondContact O-N 3.39Å
46	N	82.1	Confident	83.5	Confident	78 Å²	78	93.6 Å²	93.6	42%	0.417	49%	0.49	S	S	.	.	H	α-helix	trans	-59.3	-41.9	173.5	-84.6	-77.6	0	0	112.6	E42 K50	E42-N46 WeakPolarHBondContact O-CB 3.21Å; E42-N46 PolarHBondContact O-N 3.42Å; E42-N46 PolarHBondContact O-ND2 3.05Å; N46-K50 WeakPolarHBondContact O-CB 3.23Å; N46-K50 WeakPolarHBondContact O-CG 3.36Å; N46-K50 PolarHBondContact O-N 3.33Å
47	A	84.3	Confident	83.4	Confident	44 Å²	44	97 Å²	97	36%	0.364	49%	0.494	S	S	.	.	H	α-helix	trans	-67.9	-43.1	178.7	0	0	0	0	111.6	F43 V44 E45 A51	F43-A47 WeakPolarHBondContact O-CB 3.24Å; F43-A47 PolarHBondContact O-N 2.83Å; V44-A47 PolarHBondContact O-N 3.44Å; E45-A47 VanDerWaalsContact C-N 3.34Å; E45-A47 PolarHBondContact O-N 2.88Å; A47-A51 VanDerWaalsContact O-CB 3.23Å; A47-A51 WeakPolarHBondContact O-CB 3.28Å; A47-A51 PolarHBondContact O-N 2.85Å
48	K	85.7	Confident	83.6	Confident	143 Å²	143	98 Å²	98	62%	0.622	50%	0.497	S	S	*	.	H	α-helix	trans	-65.2	-42.1	177.5	-175.5	-175.9	-75.4	-174.2	111.1	V44 E45 A51 T52	V44-K48 WeakPolarHBondContact O-CB 3.35Å; V44-K48 PolarHBondContact O-N 3.34Å; E45-K48 PolarHBondContact O-N 2.87Å; K48-A51 PolarHBondContact O-N 3.43Å; K48-T52 VanDerWaalsContact O-CB 3.28Å; K48-T52 WeakPolarHBondContact O-CB 3.38Å; K48-T52 PolarHBondContact O-N 2.73Å; K48-T52 PolarHBondContact O-OG1 3.29Å
49	E	84.2	Confident	83.7	Confident	134 Å²	134	105.6 Å²	105.6	63%	0.626	53%	0.53	S	S	*	.	H	α-helix	trans	-61.4	-50.5	176.8	-173.4	177.2	83.5	0	110.8	E45 A51 T52 D53	E45-E49 WeakPolarHBondContact O-CB 3.45Å; E45-E49 PolarHBondContact O-N 3.39Å; E49-A51 PolarHBondContact O-N 3Å; E49-T52 PolarHBondContact O-N 3.47Å; E49-D53 PolarHBondContact O-N 3.34Å
50	K	83.9	Confident	83.4	Confident	151 Å²	151	101.7 Å²	101.7	66%	0.657	53%	0.525	S	S	*	.	H	α-helix	trans	-60.6	-42.7	176.2	-76.3	177	-176.8	-72.6	113	N46 T52 F54	N46-K50 WeakPolarHBondContact O-CB 3.23Å; N46-K50 WeakPolarHBondContact O-CG 3.36Å; N46-K50 PolarHBondContact O-N 3.33Å; K50-T52 VanDerWaalsContact C-N 3.35Å; K50-F54 WeakPolarHBondContact O-CB 3.49Å; K50-F54 PolarHBondContact O-N 3.26Å
51	A	87.9	Confident	82.4	Confident	47 Å²	47	106 Å²	106	39%	0.388	54%	0.541	S	S	.	.	H	α-helix	trans	-65.4	-41.5	178.8	0	0	0	0	111.2	A47 K48 E49 F54 I55	A47-A51 VanDerWaalsContact O-CB 3.23Å; A47-A51 WeakPolarHBondContact O-CB 3.28Å; A47-A51 PolarHBondContact O-N 2.85Å; K48-A51 PolarHBondContact O-N 3.43Å; E49-A51 PolarHBondContact O-N 3Å; A51-F54 PolarHBondContact O-N 2.94Å; A51-I55 WeakPolarHBondContact O-CB 3.23Å; A51-I55 WeakPolarHBondContact O-CD1 3.33Å; A51-I55 VanDerWaalsContact O-CG1 3.23Å; A51-I55 WeakPolarHBondContact O-CG1 3.31Å; A51-I55 PolarHBondContact O-N 3.38Å
52	T	85.6	Confident	81.2	Confident	86 Å²	86	109.7 Å²	109.7	53%	0.528	56%	0.557	S	S	.	*	H	α-helix	trans	-64.8	-47.7	177.2	-56.7	0	0	0	110.8	K48 E49 K50 F54 I55 D56	K48-T52 VanDerWaalsContact O-CB 3.28Å; K48-T52 WeakPolarHBondContact O-CB 3.38Å; K48-T52 PolarHBondContact O-N 2.73Å; K48-T52 PolarHBondContact O-OG1 3.29Å; E49-T52 PolarHBondContact O-N 3.47Å; K50-T52 VanDerWaalsContact C-N 3.35Å; T52-F54 VanDerWaalsContact C-N 3.31Å; T52-F54 PolarHBondContact O-N 3.42Å; T52-I55 PolarHBondContact O-N 2.89Å; T52-D56 VanDerWaalsContact O-CB 3.31Å; T52-D56 WeakPolarHBondContact O-CB 3.36Å; T52-D56 PolarHBondContact O-N 2.87Å
53	D	86.4	Confident	80.2	Confident	89 Å²	89	108.6 Å²	108.6	48%	0.476	57%	0.57	S	S	.	*	H	α-helix	trans	-60	-40.4	177.2	-171.9	-92.6	0	0	112.2	E49 K57	E49-D53 PolarHBondContact O-N 3.34Å; D53-K57 PolarHBondContact O-N 3.35Å; D53-K57 IonicContact OD1-NZ 3.06Å; D53-K57 PolarHBondContact OD1-NZ 2.73Å
54	F	87.7	Confident	78.6	Confident	137 Å²	137	113.4 Å²	113.4	60%	0.601	60%	0.595	S	S	*	*	H	α-helix	trans	-68.1	-46.9	177.5	-176.7	-97.3	0	0	112.5	K50 A51 T52 D56 K57 V58	K50-F54 WeakPolarHBondContact O-CB 3.49Å; K50-F54 PolarHBondContact O-N 3.26Å; A51-F54 PolarHBondContact O-N 2.94Å; T52-F54 VanDerWaalsContact C-N 3.31Å; T52-F54 PolarHBondContact O-N 3.42Å; F54-D56 VanDerWaalsContact C-N 3.27Å; F54-D56 PolarHBondContact O-N 3.39Å; F54-K57 PolarHBondContact O-N 3.39Å; F54-V58 HydrophobicContact CD1-CG2 4.15Å; F54-V58 HydrophobicContact CE1-CG2 3.71Å; F54-V58 HydrophobicContact CE2-CG2 4.21Å; F54-V58 HydrophobicContact CZ-CG2 3.74Å; F54-V58 WeakPolarHBondContact O-CG2 3.18Å; F54-V58 PolarHBondContact O-N 2.85Å
55	I	87.9	Confident	78.3	Confident	109 Å²	109	114.8 Å²	114.8	56%	0.559	60%	0.598	S	S	*	*	H	α-helix	trans	-61.5	-40.9	177.3	-70.3	166.2	0	0	110	A51 T52 V58 K59	A51-I55 WeakPolarHBondContact O-CB 3.23Å; A51-I55 WeakPolarHBondContact O-CD1 3.33Å; A51-I55 VanDerWaalsContact O-CG1 3.23Å; A51-I55 WeakPolarHBondContact O-CG1 3.31Å; A51-I55 PolarHBondContact O-N 3.38Å; T52-I55 PolarHBondContact O-N 2.89Å; I55-V58 PolarHBondContact O-N 2.94Å; I55-K59 WeakPolarHBondContact O-CB 3.42Å; I55-K59 PolarHBondContact O-N 2.96Å
56	D	86.4	Confident	78.1	Confident	112 Å²	112	116.2 Å²	116.2	60%	0.599	61%	0.608	S	S	*	*	H	α-helix	trans	-64.4	-45.9	177.4	-165.3	-103.4	0	0	111.7	T52 F54 V58 K59 G60	T52-D56 VanDerWaalsContact O-CB 3.31Å; T52-D56 WeakPolarHBondContact O-CB 3.36Å; T52-D56 PolarHBondContact O-N 2.87Å; F54-D56 VanDerWaalsContact C-N 3.27Å; F54-D56 PolarHBondContact O-N 3.39Å; D56-V58 PolarHBondContact O-N 3.16Å; D56-K59 PolarHBondContact O-N 2.74Å; D56-G60 PolarHBondContact O-N 3.27Å
57	K	83.7	Confident	77.9	Confident	129 Å²	129	118.3 Å²	118.3	56%	0.561	62%	0.619	S	S	*	*	H	α-helix	trans	-56.2	-47.1	171.9	-89.7	-162.8	-170.3	82.9	113	D53 F54 K59 N61	D53-K57 PolarHBondContact O-N 3.35Å; D53-K57 IonicContact OD1-NZ 3.06Å; D53-K57 PolarHBondContact OD1-NZ 2.73Å; F54-K57 PolarHBondContact O-N 3.39Å; K57-K59 VanDerWaalsContact C-N 3.34Å; K57-N61 PolarHBondContact O-N 3.44Å; K57-N61 VanDerWaalsContact O-N 3.16Å
58	V	86.1	Confident	77.5	Confident	86 Å²	86	122.7 Å²	122.7	52%	0.521	63%	0.634	S	S	.	*	H	α-helix	trans	-67.3	-38.1	-178.5	171.5	0	0	0	111	F54 I55 D56	F54-V58 HydrophobicContact CD1-CG2 4.15Å; F54-V58 HydrophobicContact CE1-CG2 3.71Å; F54-V58 HydrophobicContact CE2-CG2 4.21Å; F54-V58 HydrophobicContact CZ-CG2 3.74Å; F54-V58 WeakPolarHBondContact O-CG2 3.18Å; F54-V58 PolarHBondContact O-N 2.85Å; I55-V58 PolarHBondContact O-N 2.94Å; D56-V58 PolarHBondContact O-N 3.16Å
59	K	82	Confident	77	Confident	159 Å²	159	121.4 Å²	121.4	69%	0.691	64%	0.635	S	S	*	*	H	α-helix	trans	-75	-38	179.1	-166	177.3	-176.6	-176	111.9	I55 D56 K57 K62	I55-K59 WeakPolarHBondContact O-CB 3.42Å; I55-K59 PolarHBondContact O-N 2.96Å; D56-K59 PolarHBondContact O-N 2.74Å; K57-K59 VanDerWaalsContact C-N 3.34Å; K59-K62 PolarHBondContact O-N 3.15Å; K59-K62 VanDerWaalsContact O-N 3.15Å
60	G	71.7	Confident	76.5	Confident	43 Å²	43	120.6 Å²	120.6	44%	0.443	64%	0.635	S	S	.	*	H	α-helix	trans	-60.7	-42.3	176.3	0	0	0	0	112.1	D56 K62 G63	D56-G60 PolarHBondContact O-N 3.27Å; G60-K62 PolarHBondContact O-N 3.08Å; G60-G63 PolarHBondContact O-N 3.01Å; G60-G63 VanDerWaalsContact O-N 3.08Å
61	N	60.3	Low	76	Confident	145 Å²	145	118.4 Å²	118.4	78%	0.775	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	-2.8	176.3	-84.9	11.6	0	0	115.1	K57	K57-N61 PolarHBondContact O-N 3.44Å; K57-N61 VanDerWaalsContact O-N 3.16Å
62	K	54.5	Low	75.1	Confident	195 Å²	195	123.9 Å²	123.9	85%	0.848	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	3.6	175	-159.5	140.9	-176.2	161.9	113.1	K59 G60	K59-K62 PolarHBondContact O-N 3.15Å; K59-K62 VanDerWaalsContact O-N 3.15Å; G60-K62 PolarHBondContact O-N 3.08Å
63	G	56.4	Low	74.2	Confident	68 Å²	68	127.1 Å²	127.1	70%	0.701	66%	0.663	S	S	*	*			trans	-110.6	-7.8	-176.1	0	0	0	0	116.6	G60	G60-G63 PolarHBondContact O-N 3.01Å; G60-G63 VanDerWaalsContact O-N 3.08Å
64	E	47.1	Very low	73.1	Confident	253 Å²	253	130.5 Å²	130.5	100%	1.182	68%	0.68	S	S	*	*			trans	-103.8	0	173.2	-69.3	-167.9	100.9	0	112.3

Retrieved 64 of 64 residues in 215 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).