ESXA_STAAM Loading...

Type VII secretion system extracellular protein A

Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion (By similarity). Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity (By similarity).

AlphaFold DB (Q2G189), UniProt , Accession Q99WU4, Species STAAM (Staphylococcus aureus (strain Mu50 / ATCC 700699)), Gene esxA, Length 97 aa.

						>ESXA_STAAM|Q99WU4|esxA
MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.8	Very low	83.9	Confident	233 Å²	233	109.5 Å²	109.5	100%	1.148	57%	0.566	S	S	*	*				0	134.2	0	-88.1	161.8	138.5	0	0	108.3	M3	M1-M3 PolarHBondContact O-N 3Å
2	A	68.4	Low	85.1	Confident	102 Å²	102	106.2 Å²	106.2	84%	0.843	54%	0.541	S	S	*	.	P	Polyproline II helix	trans	-69.7	126	169	0	0	0	0	0	108.1
3	M	72.7	Confident	86.1	Confident	175 Å²	175	102.3 Å²	102.3	86%	0.862	54%	0.535	S	S	*	.	P	Polyproline II helix	trans	-83.6	122.8	168.5	-91.6	-175.4	-87.9	0	0	108.4	M1 K5	M1-M3 PolarHBondContact O-N 3Å; M3-K5 PolarHBondContact O-N 3.38Å
4	I	77.4	Confident	86.9	Confident	86 Å²	86	103.4 Å²	103.4	44%	0.441	53%	0.533	S	S	.	.	P	Polyproline II helix	trans	-75.9	117.9	169.4	-66.3	178.9	0	0	0	106.9	M6 I11 T79 V83	I4-M6 VanDerWaalsContact C-N 3.35Å; I4-M6 HydrophobicContact CG2-CB 4.33Å; I4-M6 WeakPolarHBondContact CG2-O 3.39Å; I4-I11 HydrophobicContact CG2-CD1 3.77Å; I4-T79 HydrophobicContact CD1-CG2 3.57Å; I4-V83 HydrophobicContact CB-CG2 4.49Å; I4-V83 HydrophobicContact CD1-CG2 3.75Å; I4-V83 HydrophobicContact CG2-CG2 4.42Å
5	K	86.2	Confident	87.6	Confident	203 Å²	203	96.5 Å²	96.5	88%	0.883	50%	0.498	S	S	*	.			trans	-87.5	-4.6	-179.7	-66.9	-172.8	177.4	-176.7	0	113.8	M3	M3-K5 PolarHBondContact O-N 3.38Å
6	M	90.5	Very high	88.3	Confident	85 Å²	85	96.7 Å²	96.7	42%	0.419	50%	0.495	S	S	.	.	S	Bend	trans	-97.1	143.3	-179.3	-67.8	-177.8	-63.4	0	0	109.8	I4 E10 I11	I4-M6 VanDerWaalsContact C-N 3.35Å; I4-M6 HydrophobicContact CG2-CB 4.33Å; I4-M6 WeakPolarHBondContact CG2-O 3.39Å; M6-E10 VanDerWaalsContact CA-OE2 3.23Å; M6-E10 WeakPolarHBondContact CA-OE2 3.36Å; M6-E10 HydrophobicContact CB-CB 4.06Å; M6-I11 HydrophobicContact CB-CD1 4.48Å; M6-I11 HydrophobicContact CB-CG1 3.92Å; M6-I11 HydrophobicContact CE-CG1 4.12Å
7	S	93.2	Very high	88.9	Confident	46 Å²	46	94.9 Å²	94.9	32%	0.322	49%	0.493	S	S	.	.			trans	-67.3	158.6	171.4	78.3	0	0	0	0	111.1	E9 E10 I11	S7-E9 PolarHBondContact O-N 2.93Å; S7-E9 PolarHBondContact OG-N 3.11Å; S7-E10 PolarHBondContact N-OE2 3.49Å; S7-E10 PolarHBondContact O-N 2.9Å; S7-E10 VanDerWaalsContact O-N 3.12Å; S7-E10 WeakPolarHBondContact OG-CG 3.4Å; S7-E10 PolarHBondContact OG-N 3.09Å; S7-E10 VanDerWaalsContact OG-N 3.15Å; S7-I11 WeakPolarHBondContact O-CG1 3.28Å; S7-I11 PolarHBondContact O-N 3.36Å
8	P	95.1	Very high	89.4	Confident	14 Å²	14	94.9 Å²	94.9	9%	0.091	49%	0.487	C	S	.	.	H	α-helix	trans	-51.1	-38.2	171	-29.1	35.9	0	0	0	113.3	I11 R12 A80 V83 Q84	P8-I11 PolarHBondContact O-N 3.45Å; P8-R12 WeakPolarHBondContact O-CG 3.08Å; P8-R12 PolarHBondContact O-N 2.95Å; P8-A80 HydrophobicContact CB-CB 4.37Å; P8-A80 WeakPolarHBondContact O-CB 3.35Å; P8-V83 HydrophobicContact CG-CB 4.16Å; P8-V83 HydrophobicContact CG-CG1 3.79Å; P8-Q84 HydrophobicContact CB-CB 4.06Å; P8-Q84 HydrophobicContact CG-CB 3.86Å
9	E	96.2	Very high	89.9	Confident	153 Å²	153	90 Å²	90	72%	0.715	46%	0.462	S	S	*	.	H	α-helix	trans	-66.7	-42.6	178.7	-63.2	-177.8	173.9	0	0	112.1	S7 I11 R12 A13	S7-E9 PolarHBondContact O-N 2.93Å; S7-E9 PolarHBondContact OG-N 3.11Å; E9-I11 VanDerWaalsContact C-N 3.33Å; E9-I11 PolarHBondContact O-N 3.11Å; E9-R12 PolarHBondContact O-N 3.22Å; E9-A13 WeakPolarHBondContact O-CB 3.49Å; E9-A13 PolarHBondContact O-N 3.42Å
10	E	97	Very high	90.4	Very high	104 Å²	104	91.1 Å²	91.1	49%	0.486	47%	0.465	S	S	.	.	H	α-helix	trans	-63.5	-40.1	175.8	-71.6	176.3	131.2	0	0	111.5	M6 S7 A13 K14	M6-E10 VanDerWaalsContact CA-OE2 3.23Å; M6-E10 WeakPolarHBondContact CA-OE2 3.36Å; M6-E10 HydrophobicContact CB-CB 4.06Å; S7-E10 PolarHBondContact N-OE2 3.49Å; S7-E10 PolarHBondContact O-N 2.9Å; S7-E10 VanDerWaalsContact O-N 3.12Å; S7-E10 WeakPolarHBondContact OG-CG 3.4Å; S7-E10 PolarHBondContact OG-N 3.09Å; S7-E10 VanDerWaalsContact OG-N 3.15Å; E10-A13 WeakPolarHBondContact O-CB 3.29Å; E10-A13 PolarHBondContact O-N 3.35Å; E10-K14 WeakPolarHBondContact O-CG 3.27Å; E10-K14 PolarHBondContact O-N 2.87Å
11	I	96.9	Very high	90.8	Very high	3 Å²	3	87.5 Å²	87.5	2%	0.015	45%	0.451	C	S	.	.	H	α-helix	trans	-63.6	-44.5	176.1	-62.7	162.4	0	0	0	110.5	I4 M6 S7 P8 E9 A13 K14 S15 L76 A80 V83	I4-I11 HydrophobicContact CG2-CD1 3.77Å; M6-I11 HydrophobicContact CB-CD1 4.48Å; M6-I11 HydrophobicContact CB-CG1 3.92Å; M6-I11 HydrophobicContact CE-CG1 4.12Å; S7-I11 WeakPolarHBondContact O-CG1 3.28Å; S7-I11 PolarHBondContact O-N 3.36Å; P8-I11 PolarHBondContact O-N 3.45Å; E9-I11 VanDerWaalsContact C-N 3.33Å; E9-I11 PolarHBondContact O-N 3.11Å; I11-A13 VanDerWaalsContact C-N 3.33Å; I11-A13 PolarHBondContact O-N 3.31Å; I11-K14 PolarHBondContact O-N 3.02Å; I11-S15 PolarHBondContact O-N 3.3Å; I11-L76 HydrophobicContact CG2-CB 4.09Å; I11-L76 HydrophobicContact CG2-CD2 4.08Å; I11-L76 WeakPolarHBondContact CG2-O 3.44Å; I11-A80 HydrophobicContact CB-CB 3.98Å; I11-A80 HydrophobicContact CG2-CB 3.84Å; I11-V83 HydrophobicContact CD1-CG2 4.21Å
12	R	98	Very high	93.1	Very high	70 Å²	70	76.5 Å²	76.5	26%	0.264	40%	0.397	S	S	.	.	H	α-helix	trans	-63.1	-39.3	175.2	-72.3	-177.9	-172.1	119.9	-0.3	111.8	P8 E9 K14 S15 Q16 A80 D81	P8-R12 WeakPolarHBondContact O-CG 3.08Å; P8-R12 PolarHBondContact O-N 2.95Å; E9-R12 PolarHBondContact O-N 3.22Å; R12-K14 VanDerWaalsContact C-N 3.33Å; R12-K14 PolarHBondContact O-N 3.13Å; R12-S15 WeakPolarHBondContact O-CB 3.47Å; R12-S15 PolarHBondContact O-N 3.46Å; R12-Q16 WeakPolarHBondContact O-CG 3.5Å; R12-Q16 PolarHBondContact O-N 3.23Å; R12-A80 HydrophobicContact CG-CB 3.64Å; R12-D81 IonicContact CZ-OD1 3.67Å; R12-D81 IonicContact NE-OD1 3.75Å; R12-D81 IonicContact NH2-OD1 2.76Å; R12-D81 PolarHBondContact NH2-OD1 3.47Å
13	A	98.2	Very high	94.5	Very high	56 Å²	56	76.4 Å²	76.4	46%	0.463	38%	0.382	S	S	.	.	H	α-helix	trans	-60.6	-42.7	174.4	0	0	0	0	0	111.6	E9 E10 I11 Q16 S17	E9-A13 WeakPolarHBondContact O-CB 3.49Å; E9-A13 PolarHBondContact O-N 3.42Å; E10-A13 WeakPolarHBondContact O-CB 3.29Å; E10-A13 PolarHBondContact O-N 3.35Å; I11-A13 VanDerWaalsContact C-N 3.33Å; I11-A13 PolarHBondContact O-N 3.31Å; A13-Q16 PolarHBondContact O-N 3.31Å; A13-S17 PolarHBondContact O-N 3.47Å; A13-S17 PolarHBondContact O-OG 2.91Å
14	K	97.4	Very high	95.8	Very high	118 Å²	118	74 Å²	74	51%	0.513	37%	0.369	S	S	.	.	H	α-helix	trans	-65	-43.3	173.3	-64.4	-55.7	178.2	-171.2	0	111.9	E10 I11 R12 Q16 S17 Y18 L76	E10-K14 WeakPolarHBondContact O-CG 3.27Å; E10-K14 PolarHBondContact O-N 2.87Å; I11-K14 PolarHBondContact O-N 3.02Å; R12-K14 VanDerWaalsContact C-N 3.33Å; R12-K14 PolarHBondContact O-N 3.13Å; K14-Q16 VanDerWaalsContact C-N 3.28Å; K14-Q16 PolarHBondContact O-N 2.91Å; K14-S17 WeakPolarHBondContact O-CA 3.32Å; K14-S17 WeakPolarHBondContact O-CB 3.43Å; K14-S17 PolarHBondContact O-N 3.37Å; K14-Y18 VanDerWaalsContact O-CD2 3.27Å; K14-Y18 WeakPolarHBondContact O-CD2 3.48Å; K14-Y18 PolarHBondContact O-N 2.94Å; K14-Y18 VanDerWaalsContact O-N 3.09Å; K14-L76 HydrophobicContact CB-CD1 4.41Å
15	S	97.7	Very high	96.8	Very high	0 Å²	0	71.7 Å²	71.7	0%	0	36%	0.357	C	S	.	.	H	α-helix	trans	-52	-47.3	174.3	179.6	0	0	0	0	111.6	I11 R12 S17 Y18 G19 K73 N77	I11-S15 PolarHBondContact O-N 3.3Å; R12-S15 WeakPolarHBondContact O-CB 3.47Å; R12-S15 PolarHBondContact O-N 3.46Å; S15-S17 VanDerWaalsContact C-N 3.33Å; S15-S17 PolarHBondContact O-N 3.4Å; S15-Y18 WeakPolarHBondContact O-CB 3.4Å; S15-Y18 PolarHBondContact O-N 3.03Å; S15-Y18 VanDerWaalsContact O-N 3.1Å; S15-G19 PolarHBondContact O-N 3.19Å; S15-K73 WeakPolarHBondContact O-CG 3.4Å; S15-K73 WeakPolarHBondContact OG-CA 3.37Å; S15-K73 WeakPolarHBondContact OG-CG 3.31Å; S15-K73 PolarHBondContact OG-O 3.45Å; S15-N77 WeakPolarHBondContact CB-OD1 3.33Å; S15-N77 VanDerWaalsContact OG-CG 3.22Å; S15-N77 PolarHBondContact OG-ND2 3.3Å; S15-N77 VanDerWaalsContact OG-ND2 3.14Å; S15-N77 PolarHBondContact OG-OD1 3.01Å
16	Q	98.5	Very high	97.4	Very high	99 Å²	99	66 Å²	66	46%	0.463	33%	0.33	S	S	.	.	H	α-helix	trans	-60.1	-39.7	176.1	-67.9	-61.8	-22.2	0	0	112.8	R12 A13 K14 Y18 G19 Q20	R12-Q16 WeakPolarHBondContact O-CG 3.5Å; R12-Q16 PolarHBondContact O-N 3.23Å; A13-Q16 PolarHBondContact O-N 3.31Å; K14-Q16 VanDerWaalsContact C-N 3.28Å; K14-Q16 PolarHBondContact O-N 2.91Å; Q16-Y18 VanDerWaalsContact C-N 3.31Å; Q16-Y18 PolarHBondContact O-N 2.95Å; Q16-G19 PolarHBondContact O-N 3.22Å; Q16-Q20 WeakPolarHBondContact O-CB 3.29Å; Q16-Q20 VanDerWaalsContact O-CG 3.3Å; Q16-Q20 WeakPolarHBondContact O-CG 3.4Å; Q16-Q20 PolarHBondContact O-N 3.02Å
17	S	98.4	Very high	97.7	Very high	66 Å²	66	66.6 Å²	66.6	46%	0.462	33%	0.332	S	S	.	.	H	α-helix	trans	-60.7	-39.3	174.6	-53.5	0	0	0	0	112.5	A13 K14 S15 G21	A13-S17 PolarHBondContact O-N 3.47Å; A13-S17 PolarHBondContact O-OG 2.91Å; K14-S17 WeakPolarHBondContact O-CA 3.32Å; K14-S17 WeakPolarHBondContact O-CB 3.43Å; K14-S17 PolarHBondContact O-N 3.37Å; S15-S17 VanDerWaalsContact C-N 3.33Å; S15-S17 PolarHBondContact O-N 3.4Å; S17-G21 PolarHBondContact O-N 3.44Å
18	Y	98.5	Very high	98	Very high	95 Å²	95	69 Å²	69	37%	0.373	34%	0.34	S	S	.	.	H	α-helix	trans	-65.7	-42.6	175.3	-81.8	-87.1	0	0	0	112	K14 S15 Q16 G21 S22 L69 I72 L76	K14-Y18 VanDerWaalsContact O-CD2 3.27Å; K14-Y18 WeakPolarHBondContact O-CD2 3.48Å; K14-Y18 PolarHBondContact O-N 2.94Å; K14-Y18 VanDerWaalsContact O-N 3.09Å; S15-Y18 WeakPolarHBondContact O-CB 3.4Å; S15-Y18 PolarHBondContact O-N 3.03Å; S15-Y18 VanDerWaalsContact O-N 3.1Å; Q16-Y18 VanDerWaalsContact C-N 3.31Å; Q16-Y18 PolarHBondContact O-N 2.95Å; Y18-G21 PolarHBondContact O-N 3.37Å; Y18-S22 PolarHBondContact O-N 3.04Å; Y18-L69 HydrophobicContact CD1-CB 4.33Å; Y18-L69 HydrophobicContact CD1-CD2 3.61Å; Y18-L69 HydrophobicContact CE1-CD2 3.92Å; Y18-I72 HydrophobicContact CD1-CB 3.99Å; Y18-I72 HydrophobicContact CD1-CD1 4.28Å; Y18-I72 HydrophobicContact CD1-CG2 3.61Å; Y18-I72 HydrophobicContact CD2-CG2 4Å; Y18-I72 HydrophobicContact CE1-CB 4.31Å; Y18-I72 HydrophobicContact CE1-CD1 3.99Å; Y18-I72 HydrophobicContact CE1-CG2 3.66Å; Y18-I72 HydrophobicContact CE2-CG2 4.05Å; Y18-I72 HydrophobicContact CG-CB 4.41Å; Y18-I72 HydrophobicContact CG-CG2 3.81Å; Y18-L76 HydrophobicContact CD2-CD1 3.52Å; Y18-L76 HydrophobicContact CE2-CD1 3.76Å; Y18-L76 HydrophobicContact CG-CD1 4.39Å
19	G	98.6	Very high	98.1	Very high	2 Å²	2	69.4 Å²	69.4	2%	0.021	34%	0.341	C	S	.	.	H	α-helix	trans	-60.6	-49.3	174.6	0	0	0	0	0	112.7	S15 Q16 G21 S22 D23	S15-G19 PolarHBondContact O-N 3.19Å; Q16-G19 PolarHBondContact O-N 3.22Å; G19-G21 VanDerWaalsContact C-N 3.28Å; G19-G21 PolarHBondContact O-N 2.9Å; G19-S22 WeakPolarHBondContact O-CB 3.36Å; G19-S22 PolarHBondContact O-N 3.3Å; G19-S22 VanDerWaalsContact O-N 3.13Å; G19-D23 PolarHBondContact O-N 2.69Å
20	Q	98.7	Very high	98.2	Very high	111 Å²	111	64.7 Å²	64.7	52%	0.519	33%	0.325	S	S	.	.	H	α-helix	trans	-59.4	-40.1	176.4	-70.5	170.3	5.7	0	0	112	Q16 D23 Q24	Q16-Q20 WeakPolarHBondContact O-CB 3.29Å; Q16-Q20 VanDerWaalsContact O-CG 3.3Å; Q16-Q20 WeakPolarHBondContact O-CG 3.4Å; Q16-Q20 PolarHBondContact O-N 3.02Å; Q20-D23 PolarHBondContact O-N 3.09Å; Q20-Q24 WeakPolarHBondContact O-CB 3.26Å; Q20-Q24 VanDerWaalsContact O-CG 3.25Å; Q20-Q24 WeakPolarHBondContact O-CG 3.24Å; Q20-Q24 PolarHBondContact O-N 2.96Å
21	G	98.5	Very high	98.3	Very high	17 Å²	17	62.7 Å²	62.7	18%	0.175	32%	0.318	C	S	.	.	H	α-helix	trans	-62.7	-42	175.2	0	0	0	0	0	112.8	S17 Y18 G19 Q24 I25	S17-G21 PolarHBondContact O-N 3.44Å; Y18-G21 PolarHBondContact O-N 3.37Å; G19-G21 VanDerWaalsContact C-N 3.28Å; G19-G21 PolarHBondContact O-N 2.9Å; G21-Q24 PolarHBondContact O-N 3.23Å; G21-I25 WeakPolarHBondContact O-CB 3.43Å; G21-I25 VanDerWaalsContact O-CG1 3.23Å; G21-I25 WeakPolarHBondContact O-CG1 3.29Å; G21-I25 PolarHBondContact O-N 3.25Å
22	S	98.7	Very high	98.3	Very high	2 Å²	2	67 Å²	67	1%	0.014	34%	0.34	C	S	.	.	H	α-helix	trans	-57	-50.7	173.6	178.8	0	0	0	0	111.4	Y18 G19 Q24 I25 R26 A66	Y18-S22 PolarHBondContact O-N 3.04Å; G19-S22 WeakPolarHBondContact O-CB 3.36Å; G19-S22 PolarHBondContact O-N 3.3Å; G19-S22 VanDerWaalsContact O-N 3.13Å; S22-Q24 PolarHBondContact O-N 2.77Å; S22-I25 PolarHBondContact O-N 3.27Å; S22-R26 WeakPolarHBondContact O-CG 3.33Å; S22-R26 PolarHBondContact O-N 3.24Å; S22-A66 WeakPolarHBondContact CB-O 3.14Å; S22-A66 PolarHBondContact OG-O 2.98Å
23	D	98.7	Very high	98.2	Very high	99 Å²	99	66.9 Å²	66.9	53%	0.529	35%	0.348	S	S	.	.	H	α-helix	trans	-62.7	-44.1	-178.7	-66.3	-26.9	0	0	0	111.7	G19 Q20 I25 R26 Q27	G19-D23 PolarHBondContact O-N 2.69Å; Q20-D23 PolarHBondContact O-N 3.09Å; D23-I25 PolarHBondContact O-N 3.47Å; D23-R26 PolarHBondContact O-N 2.87Å; D23-Q27 WeakPolarHBondContact O-CB 3.42Å; D23-Q27 PolarHBondContact O-N 3.04Å
24	Q	98.7	Very high	98.1	Very high	125 Å²	125	71 Å²	71	58%	0.584	35%	0.352	S	S	*	.	H	α-helix	trans	-61.8	-42.5	177	-75.5	175.3	-15.6	0	0	112.2	Q20 G21 S22 Q27 I28	Q20-Q24 WeakPolarHBondContact O-CB 3.26Å; Q20-Q24 VanDerWaalsContact O-CG 3.25Å; Q20-Q24 WeakPolarHBondContact O-CG 3.24Å; Q20-Q24 PolarHBondContact O-N 2.96Å; G21-Q24 PolarHBondContact O-N 3.23Å; S22-Q24 PolarHBondContact O-N 2.77Å; Q24-Q27 PolarHBondContact O-N 2.86Å; Q24-I28 VanDerWaalsContact O-CG1 3.26Å; Q24-I28 WeakPolarHBondContact O-CG1 3.42Å; Q24-I28 PolarHBondContact O-N 3.27Å
25	I	98.4	Very high	98	Very high	37 Å²	37	67.3 Å²	67.3	19%	0.19	34%	0.343	C	S	.	.	H	α-helix	trans	-64.8	-43.3	178.6	-71.6	171.1	0	0	0	110.8	G21 S22 D23 Q27 I28 L29 V62 F65 A66 L69	G21-I25 WeakPolarHBondContact O-CB 3.43Å; G21-I25 VanDerWaalsContact O-CG1 3.23Å; G21-I25 WeakPolarHBondContact O-CG1 3.29Å; G21-I25 PolarHBondContact O-N 3.25Å; S22-I25 PolarHBondContact O-N 3.27Å; D23-I25 PolarHBondContact O-N 3.47Å; I25-Q27 VanDerWaalsContact C-N 3.32Å; I25-Q27 PolarHBondContact O-N 3.07Å; I25-I28 PolarHBondContact O-N 3.44Å; I25-L29 WeakPolarHBondContact O-CB 3.48Å; I25-L29 PolarHBondContact O-N 2.75Å; I25-V62 HydrophobicContact CG2-CG1 3.42Å; I25-V62 VanDerWaalsContact CG2-CG1 3.42Å; I25-F65 HydrophobicContact CD1-CD1 3.63Å; I25-F65 HydrophobicContact CD1-CE1 3.56Å; I25-A66 HydrophobicContact CB-CB 4.21Å; I25-A66 HydrophobicContact CG2-CB 3.92Å; I25-L69 HydrophobicContact CD1-CD1 3.63Å
26	R	98.6	Very high	97.7	Very high	83 Å²	83	68 Å²	68	31%	0.313	35%	0.346	S	S	.	.	H	α-helix	trans	-61.7	-41.3	175.9	-71.2	170.3	-179.2	-91.5	-3.1	111.5	S22 D23 L29 S30 E63 A66	S22-R26 WeakPolarHBondContact O-CG 3.33Å; S22-R26 PolarHBondContact O-N 3.24Å; D23-R26 PolarHBondContact O-N 2.87Å; R26-L29 PolarHBondContact O-N 3.39Å; R26-S30 WeakPolarHBondContact O-CB 3.35Å; R26-S30 PolarHBondContact O-N 2.94Å; R26-E63 IonicContact CZ-OE1 3.89Å; R26-E63 IonicContact NH1-OE1 2.59Å; R26-E63 PolarHBondContact NH1-OE1 2.87Å; R26-E63 IonicContact NH1-OE2 3.61Å; R26-E63 IonicContact NH2-OE1 2.63Å; R26-E63 PolarHBondContact NH2-OE1 3.42Å; R26-A66 HydrophobicContact CG-CB 3.82Å
27	Q	98.7	Very high	97.3	Very high	99 Å²	99	65.3 Å²	65.3	46%	0.463	34%	0.344	S	S	.	.	H	α-helix	trans	-62.2	-49.9	176.2	-176.7	56.6	50.8	0	0	111.4	D23 Q24 I25 L29 S30 D31	D23-Q27 WeakPolarHBondContact O-CB 3.42Å; D23-Q27 PolarHBondContact O-N 3.04Å; Q24-Q27 PolarHBondContact O-N 2.86Å; I25-Q27 VanDerWaalsContact C-N 3.32Å; I25-Q27 PolarHBondContact O-N 3.07Å; Q27-L29 VanDerWaalsContact C-N 3.32Å; Q27-L29 PolarHBondContact O-N 3.14Å; Q27-S30 WeakPolarHBondContact O-CB 3.44Å; Q27-S30 PolarHBondContact O-N 3.46Å; Q27-D31 VanDerWaalsContact NE2-CG 3.31Å; Q27-D31 PolarHBondContact NE2-OD1 3.18Å; Q27-D31 PolarHBondContact NE2-OD2 3.49Å; Q27-D31 VanDerWaalsContact NE2-OD2 3.11Å; Q27-D31 VanDerWaalsContact O-CG 3.27Å; Q27-D31 PolarHBondContact O-N 2.88Å
28	I	98.4	Very high	97	Very high	96 Å²	96	68.2 Å²	68.2	49%	0.492	35%	0.351	S	S	.	.	H	α-helix	trans	-58.8	-45.3	177.3	-69.5	163.7	0	0	0	110.7	Q24 I25 S30 D31 L32	Q24-I28 VanDerWaalsContact O-CG1 3.26Å; Q24-I28 WeakPolarHBondContact O-CG1 3.42Å; Q24-I28 PolarHBondContact O-N 3.27Å; I25-I28 PolarHBondContact O-N 3.44Å; I28-S30 VanDerWaalsContact C-N 3.32Å; I28-S30 PolarHBondContact O-N 3.25Å; I28-D31 PolarHBondContact O-N 3.44Å; I28-L32 HydrophobicContact CG2-CD1 3.79Å; I28-L32 HydrophobicContact CG2-CG 4.28Å; I28-L32 WeakPolarHBondContact O-CB 3.46Å; I28-L32 VanDerWaalsContact O-CG 3.31Å; I28-L32 WeakPolarHBondContact O-CG 3.44Å; I28-L32 PolarHBondContact O-N 2.92Å
29	L	98.1	Very high	96.6	Very high	22 Å²	22	67.2 Å²	67.2	12%	0.115	35%	0.351	C	S	.	.	H	α-helix	trans	-61.1	-43	178.2	-178.4	60.1	0	0	0	111.3	I25 R26 Q27 T33 F55 V62 E63	I25-L29 WeakPolarHBondContact O-CB 3.48Å; I25-L29 PolarHBondContact O-N 2.75Å; R26-L29 PolarHBondContact O-N 3.39Å; Q27-L29 VanDerWaalsContact C-N 3.32Å; Q27-L29 PolarHBondContact O-N 3.14Å; L29-T33 WeakPolarHBondContact O-CB 3.31Å; L29-T33 PolarHBondContact O-N 3.4Å; L29-T33 PolarHBondContact O-OG1 3.26Å; L29-F55 HydrophobicContact CD1-CZ 4.31Å; L29-V62 HydrophobicContact CB-CG1 4.36Å; L29-V62 HydrophobicContact CD1-CB 4.45Å; L29-V62 HydrophobicContact CD1-CG1 4.42Å; L29-V62 HydrophobicContact CD2-CB 4.3Å; L29-V62 HydrophobicContact CD2-CG1 4.21Å; L29-E63 HydrophobicContact CD2-CB 4.07Å
30	S	98.2	Very high	96	Very high	54 Å²	54	68.9 Å²	68.9	38%	0.378	36%	0.364	S	S	.	.	H	α-helix	trans	-62.1	-43.8	175.3	-176.3	0	0	0	0	112.1	R26 Q27 I28 T33 R34	R26-S30 WeakPolarHBondContact O-CB 3.35Å; R26-S30 PolarHBondContact O-N 2.94Å; Q27-S30 WeakPolarHBondContact O-CB 3.44Å; Q27-S30 PolarHBondContact O-N 3.46Å; I28-S30 VanDerWaalsContact C-N 3.32Å; I28-S30 PolarHBondContact O-N 3.25Å; S30-T33 PolarHBondContact O-N 3.03Å; S30-R34 WeakPolarHBondContact O-CG 3.47Å; S30-R34 PolarHBondContact O-N 3.37Å; S30-R34 VanDerWaalsContact O-N 3.14Å
31	D	98.4	Very high	95.5	Very high	63 Å²	63	67.7 Å²	67.7	34%	0.337	37%	0.374	S	S	.	.	H	α-helix	trans	-62.9	-47.9	179.5	-69.5	-27.7	0	0	0	111.4	Q27 I28 T33 R34 A35	Q27-D31 VanDerWaalsContact NE2-CG 3.31Å; Q27-D31 PolarHBondContact NE2-OD1 3.18Å; Q27-D31 PolarHBondContact NE2-OD2 3.49Å; Q27-D31 VanDerWaalsContact NE2-OD2 3.11Å; Q27-D31 VanDerWaalsContact O-CG 3.27Å; Q27-D31 PolarHBondContact O-N 2.88Å; I28-D31 PolarHBondContact O-N 3.44Å; D31-T33 VanDerWaalsContact C-N 3.34Å; D31-T33 PolarHBondContact O-N 2.94Å; D31-R34 PolarHBondContact O-N 3.12Å; D31-R34 IonicContact OD1-CZ 3.18Å; D31-R34 IonicContact OD1-NE 3.98Å; D31-R34 IonicContact OD1-NH2 3.39Å; D31-R34 PolarHBondContact OD1-NH2 3.48Å; D31-A35 PolarHBondContact O-N 3.41Å
32	L	96.9	Very high	95	Very high	92 Å²	92	73.6 Å²	73.6	48%	0.482	40%	0.401	S	S	.	.	H	α-helix	trans	-67.5	-34.3	179.3	-66.2	176.7	0	0	0	112.3	I28 R34 A35 Q36 F55	I28-L32 HydrophobicContact CG2-CD1 3.79Å; I28-L32 HydrophobicContact CG2-CG 4.28Å; I28-L32 WeakPolarHBondContact O-CB 3.46Å; I28-L32 VanDerWaalsContact O-CG 3.31Å; I28-L32 WeakPolarHBondContact O-CG 3.44Å; I28-L32 PolarHBondContact O-N 2.92Å; L32-R34 VanDerWaalsContact C-N 3.33Å; L32-R34 PolarHBondContact O-N 2.94Å; L32-A35 PolarHBondContact O-N 2.96Å; L32-Q36 WeakPolarHBondContact O-CB 3.47Å; L32-Q36 PolarHBondContact O-N 2.59Å; L32-F55 HydrophobicContact CB-CE2 3.8Å; L32-F55 HydrophobicContact CB-CZ 3.78Å
33	T	95.9	Very high	94.1	Very high	69 Å²	69	80 Å²	80	42%	0.423	43%	0.425	S	S	.	.	H	α-helix	trans	-64.3	-39.6	175.5	-58.8	0	0	0	0	111.2	L29 S30 D31 Q36 G37	L29-T33 WeakPolarHBondContact O-CB 3.31Å; L29-T33 PolarHBondContact O-N 3.4Å; L29-T33 PolarHBondContact O-OG1 3.26Å; S30-T33 PolarHBondContact O-N 3.03Å; D31-T33 VanDerWaalsContact C-N 3.34Å; D31-T33 PolarHBondContact O-N 2.94Å; T33-Q36 PolarHBondContact O-N 3.39Å; T33-G37 PolarHBondContact O-N 2.94Å; T33-G37 VanDerWaalsContact O-N 3.09Å
34	R	96.7	Very high	92.9	Very high	143 Å²	143	84.5 Å²	84.5	54%	0.54	44%	0.443	S	S	.	.	H	α-helix	trans	-64.7	-49.6	174	-71.1	-173.2	-68.9	-147.5	8	111.7	S30 D31 L32 Q36 G37 E38	S30-R34 WeakPolarHBondContact O-CG 3.47Å; S30-R34 PolarHBondContact O-N 3.37Å; S30-R34 VanDerWaalsContact O-N 3.14Å; D31-R34 PolarHBondContact O-N 3.12Å; D31-R34 IonicContact OD1-CZ 3.18Å; D31-R34 IonicContact OD1-NE 3.98Å; D31-R34 IonicContact OD1-NH2 3.39Å; D31-R34 PolarHBondContact OD1-NH2 3.48Å; L32-R34 VanDerWaalsContact C-N 3.33Å; L32-R34 PolarHBondContact O-N 2.94Å; R34-Q36 PolarHBondContact O-N 3.44Å; R34-G37 PolarHBondContact O-N 2.94Å; R34-E38 PolarHBondContact O-N 2.63Å
35	A	94.7	Very high	91.6	Very high	39 Å²	39	81.3 Å²	81.3	32%	0.322	44%	0.443	S	S	.	.	H	α-helix	trans	-57.6	-39.4	177.2	0	0	0	0	0	112	D31 L32 E38 I39	D31-A35 PolarHBondContact O-N 3.41Å; L32-A35 PolarHBondContact O-N 2.96Å; A35-E38 PolarHBondContact O-N 2.94Å; A35-I39 VanDerWaalsContact O-CG1 3.29Å; A35-I39 WeakPolarHBondContact O-CG1 3.4Å; A35-I39 PolarHBondContact O-N 3.32Å
36	Q	91.7	Very high	90.3	Very high	16 Å²	16	87.8 Å²	87.8	8%	0.075	47%	0.473	C	S	.	.	H	α-helix	trans	-62.4	-44.1	173.9	172	160	-35.5	0	0	112.6	L32 T33 R34 E38 I39 A40 F48 F55	L32-Q36 WeakPolarHBondContact O-CB 3.47Å; L32-Q36 PolarHBondContact O-N 2.59Å; T33-Q36 PolarHBondContact O-N 3.39Å; R34-Q36 PolarHBondContact O-N 3.44Å; Q36-E38 VanDerWaalsContact C-N 3.3Å; Q36-E38 PolarHBondContact O-N 3.47Å; Q36-I39 PolarHBondContact O-N 3.42Å; Q36-A40 WeakPolarHBondContact O-CB 3.48Å; Q36-A40 PolarHBondContact O-N 2.92Å; Q36-F48 HydrophobicContact CG-CE1 4.44Å; Q36-F55 VanDerWaalsContact CD-CD1 3.5Å
37	G	90.3	Very high	89.3	Confident	41 Å²	41	87.9 Å²	87.9	42%	0.423	49%	0.492	S	S	.	.	H	α-helix	trans	-60.3	-40.4	176.7	0	0	0	0	0	112.4	T33 R34 A40 A41	T33-G37 PolarHBondContact O-N 2.94Å; T33-G37 VanDerWaalsContact O-N 3.09Å; R34-G37 PolarHBondContact O-N 2.94Å; G37-A40 PolarHBondContact O-N 2.93Å; G37-A41 WeakPolarHBondContact O-CB 3.26Å; G37-A41 PolarHBondContact O-N 3.11Å
38	E	92	Very high	88.6	Confident	128 Å²	128	84.7 Å²	84.7	60%	0.598	48%	0.476	S	S	*	.	H	α-helix	trans	-63.9	-44.7	174.8	-68.9	173.1	-166.6	0	0	111.9	R34 A35 Q36 A41 N42	R34-E38 PolarHBondContact O-N 2.63Å; A35-E38 PolarHBondContact O-N 2.94Å; Q36-E38 VanDerWaalsContact C-N 3.3Å; Q36-E38 PolarHBondContact O-N 3.47Å; E38-A41 PolarHBondContact O-N 3.36Å; E38-N42 PolarHBondContact O-N 3.2Å; E38-N42 PolarHBondContact O-ND2 2.87Å
39	I	89.2	Confident	88	Confident	73 Å²	73	82.6 Å²	82.6	37%	0.374	47%	0.47	S	S	.	.	H	α-helix	trans	-64.1	-46.1	177.5	-65.6	163.7	0	0	0	110.5	A35 Q36 A41 N42 W43 F48	A35-I39 VanDerWaalsContact O-CG1 3.29Å; A35-I39 WeakPolarHBondContact O-CG1 3.4Å; A35-I39 PolarHBondContact O-N 3.32Å; Q36-I39 PolarHBondContact O-N 3.42Å; I39-A41 VanDerWaalsContact C-N 3.28Å; I39-A41 PolarHBondContact O-N 3.4Å; I39-N42 PolarHBondContact O-N 3.04Å; I39-N42 VanDerWaalsContact O-N 3.13Å; I39-W43 HydrophobicContact CG2-CE3 4.48Å; I39-W43 VanDerWaalsContact O-CB 3.28Å; I39-W43 WeakPolarHBondContact O-CB 3.27Å; I39-W43 PolarHBondContact O-N 3.29Å; I39-F48 HydrophobicContact CB-CE1 4.36Å; I39-F48 HydrophobicContact CB-CZ 4.07Å; I39-F48 HydrophobicContact CD1-CZ 4.41Å; I39-F48 HydrophobicContact CG2-CD1 4.28Å; I39-F48 HydrophobicContact CG2-CD2 4.11Å; I39-F48 HydrophobicContact CG2-CE1 3.83Å; I39-F48 HydrophobicContact CG2-CE2 3.64Å; I39-F48 HydrophobicContact CG2-CG 4.39Å; I39-F48 HydrophobicContact CG2-CZ 3.45Å; I39-F48 VanDerWaalsContact CG2-CZ 3.45Å
40	A	86.9	Confident	87.5	Confident	37 Å²	37	90.9 Å²	90.9	31%	0.306	50%	0.5	S	S	.	.	H	α-helix	trans	-61.3	-36.8	179.9	0	0	0	0	0	112.3	Q36 G37 N42	Q36-A40 WeakPolarHBondContact O-CB 3.48Å; Q36-A40 PolarHBondContact O-N 2.92Å; G37-A40 PolarHBondContact O-N 2.93Å; A40-N42 VanDerWaalsContact C-N 3.34Å
41	A	88.2	Confident	86.9	Confident	87 Å²	87	93.1 Å²	93.1	72%	0.719	50%	0.503	S	S	*	.	H	α-helix	trans	-69.9	-28.9	176.6	0	0	0	0	0	113.5	G37 E38 I39	G37-A41 WeakPolarHBondContact O-CB 3.26Å; G37-A41 PolarHBondContact O-N 3.11Å; E38-A41 PolarHBondContact O-N 3.36Å; I39-A41 VanDerWaalsContact C-N 3.28Å; I39-A41 PolarHBondContact O-N 3.4Å
42	N	87.3	Confident	86.5	Confident	140 Å²	140	93.3 Å²	93.3	75%	0.749	50%	0.502	S	S	*	.	H	α-helix	trans	-97.5	-10.4	-177.4	-72.7	-74.7	0	0	0	113.8	E38 I39 A40	E38-N42 PolarHBondContact O-N 3.2Å; E38-N42 PolarHBondContact O-ND2 2.87Å; I39-N42 PolarHBondContact O-N 3.04Å; I39-N42 VanDerWaalsContact O-N 3.13Å; A40-N42 VanDerWaalsContact C-N 3.34Å
43	W	80.9	Confident	86.3	Confident	137 Å²	137	94 Å²	94	52%	0.519	50%	0.503	S	S	.	.			trans	-100.6	105.6	-176.2	-163.2	-66.4	0	0	0	111.4	I39 G45 A47 F48	I39-W43 HydrophobicContact CG2-CE3 4.48Å; I39-W43 VanDerWaalsContact O-CB 3.28Å; I39-W43 WeakPolarHBondContact O-CB 3.27Å; I39-W43 PolarHBondContact O-N 3.29Å; W43-G45 PolarHBondContact O-N 3.47Å; W43-A47 HydrophobicContact CZ2-CB 4.14Å; W43-F48 HydrophobicContact CD2-CB 4.46Å; W43-F48 HydrophobicContact CG-CB 4.21Å
44	E	72.9	Confident	86.2	Confident	194 Å²	194	96.1 Å²	96.1	91%	0.907	51%	0.508	S	S	*	.			trans	-75.8	116.1	169.7	-70.6	-174.5	-178.4	0	0	110.7
45	G	71.6	Confident	86.1	Confident	57 Å²	57	91 Å²	91	59%	0.588	49%	0.49	S	S	*	.	S	Bend	trans	112	162.5	167.4	0	0	0	0	0	116.1	W43 A47	W43-G45 PolarHBondContact O-N 3.47Å; G45-A47 PolarHBondContact O-N 2.91Å
46	Q	71.7	Confident	86.1	Confident	174 Å²	174	94.6 Å²	94.6	81%	0.813	50%	0.499	S	S	*	.	G	3₁₀ helix	trans	-67.7	-2.2	-170.3	-67.2	178.7	70.2	0	0	115.2	F48 S49	Q46-F48 PolarHBondContact O-N 3.31Å; Q46-F48 VanDerWaalsContact O-N 3.11Å; Q46-S49 WeakPolarHBondContact O-CB 3.42Å; Q46-S49 PolarHBondContact O-N 3.18Å; Q46-S49 VanDerWaalsContact O-N 3.11Å; Q46-S49 PolarHBondContact O-OG 3.13Å
47	A	77.5	Confident	86.3	Confident	85 Å²	85	99 Å²	99	70%	0.702	52%	0.52	S	S	*	.	G	3₁₀ helix	trans	-60.8	-25.7	-176	0	0	0	0	0	112.7	W43 G45	W43-A47 HydrophobicContact CZ2-CB 4.14Å; G45-A47 PolarHBondContact O-N 2.91Å
48	F	83.3	Confident	86.6	Confident	32 Å²	32	101.4 Å²	101.4	14%	0.14	52%	0.523	C	S	.	.	G	3₁₀ helix	trans	-95	-9.6	179.8	-163.3	-109.1	0	0	0	114.4	Q36 I39 W43 Q46 R50 F51 E52	Q36-F48 HydrophobicContact CG-CE1 4.44Å; I39-F48 HydrophobicContact CB-CE1 4.36Å; I39-F48 HydrophobicContact CB-CZ 4.07Å; I39-F48 HydrophobicContact CD1-CZ 4.41Å; I39-F48 HydrophobicContact CG2-CD1 4.28Å; I39-F48 HydrophobicContact CG2-CD2 4.11Å; I39-F48 HydrophobicContact CG2-CE1 3.83Å; I39-F48 HydrophobicContact CG2-CE2 3.64Å; I39-F48 HydrophobicContact CG2-CG 4.39Å; I39-F48 HydrophobicContact CG2-CZ 3.45Å; I39-F48 VanDerWaalsContact CG2-CZ 3.45Å; W43-F48 HydrophobicContact CD2-CB 4.46Å; W43-F48 HydrophobicContact CG-CB 4.21Å; Q46-F48 PolarHBondContact O-N 3.31Å; Q46-F48 VanDerWaalsContact O-N 3.11Å; F48-R50 VanDerWaalsContact C-N 3.32Å; F48-R50 PolarHBondContact O-N 3.49Å; F48-F51 HydrophobicContact CD1-CD1 4.36Å; F48-F51 HydrophobicContact CD2-CB 4.15Å; F48-F51 HydrophobicContact CD2-CD1 4.19Å; F48-F51 HydrophobicContact CD2-CG 4.38Å; F48-F51 AromaticContact CE1-CD1 3.58Å; F48-F51 HydrophobicContact CE1-CD1 3.58Å; F48-F51 HydrophobicContact CE1-CE1 4.13Å; F48-F51 HydrophobicContact CE2-CB 4.07Å; F48-F51 AromaticContact CE2-CD1 3.35Å; F48-F51 HydrophobicContact CE2-CD1 3.35Å; F48-F51 AromaticContact CE2-CE1 3.92Å; F48-F51 HydrophobicContact CE2-CE1 3.92Å; F48-F51 AromaticContact CE2-CG 3.79Å; F48-F51 HydrophobicContact CE2-CG 3.79Å; F48-F51 HydrophobicContact CZ-CB 4.43Å; F48-F51 AromaticContact CZ-CD1 3.01Å; F48-F51 HydrophobicContact CZ-CD1 3.01Å; F48-F51 AromaticContact CZ-CE1 3.37Å; F48-F51 HydrophobicContact CZ-CE1 3.37Å; F48-F51 AromaticContact CZ-CG 3.94Å; F48-F51 HydrophobicContact CZ-CG 3.94Å; F48-F51 HydrophobicContact CZ-CZ 4.49Å; F48-F51 WeakPolarHBondContact O-CB 3.43Å; F48-F51 PolarHBondContact O-N 3.41Å; F48-E52 HydrophobicContact CD1-CB 4.27Å; F48-E52 HydrophobicContact CE1-CB 4.42Å; F48-E52 PolarHBondContact O-N 3.07Å
49	S	85.4	Confident	86.9	Confident	52 Å²	52	96.4 Å²	96.4	36%	0.364	50%	0.502	S	S	.	.	H	α-helix	trans	-60.1	-39.3	-170.1	65.2	0	0	0	0	113.4	Q46 F51 E52 E53	Q46-S49 WeakPolarHBondContact O-CB 3.42Å; Q46-S49 PolarHBondContact O-N 3.18Å; Q46-S49 VanDerWaalsContact O-N 3.11Å; Q46-S49 PolarHBondContact O-OG 3.13Å; S49-F51 VanDerWaalsContact C-N 3.33Å; S49-F51 PolarHBondContact O-N 3.02Å; S49-E52 PolarHBondContact O-N 3.17Å; S49-E53 WeakPolarHBondContact O-CB 3.49Å; S49-E53 PolarHBondContact O-N 3.37Å
50	R	87.9	Confident	87.3	Confident	195 Å²	195	96.2 Å²	96.2	74%	0.736	51%	0.505	S	S	*	.	H	α-helix	trans	-66.6	-33.4	177.5	-71.2	-173.8	178.2	174	0.2	113	F48 Q54	F48-R50 VanDerWaalsContact C-N 3.32Å; F48-R50 PolarHBondContact O-N 3.49Å; R50-Q54 WeakPolarHBondContact O-CB 3.45Å; R50-Q54 VanDerWaalsContact O-CG 3.29Å; R50-Q54 WeakPolarHBondContact O-CG 3.33Å; R50-Q54 PolarHBondContact O-N 3.35Å; R50-Q54 PolarHBondContact O-NE2 3.06Å
51	F	86.6	Confident	87.8	Confident	101 Å²	101	100.8 Å²	100.8	44%	0.443	52%	0.518	S	S	.	.	H	α-helix	trans	-70.8	-46.8	175.6	173.5	-86.8	0	0	0	109.7	F48 S49 E53 Q54 F55	F48-F51 HydrophobicContact CD1-CD1 4.36Å; F48-F51 HydrophobicContact CD2-CB 4.15Å; F48-F51 HydrophobicContact CD2-CD1 4.19Å; F48-F51 HydrophobicContact CD2-CG 4.38Å; F48-F51 AromaticContact CE1-CD1 3.58Å; F48-F51 HydrophobicContact CE1-CD1 3.58Å; F48-F51 HydrophobicContact CE1-CE1 4.13Å; F48-F51 HydrophobicContact CE2-CB 4.07Å; F48-F51 AromaticContact CE2-CD1 3.35Å; F48-F51 HydrophobicContact CE2-CD1 3.35Å; F48-F51 AromaticContact CE2-CE1 3.92Å; F48-F51 HydrophobicContact CE2-CE1 3.92Å; F48-F51 AromaticContact CE2-CG 3.79Å; F48-F51 HydrophobicContact CE2-CG 3.79Å; F48-F51 HydrophobicContact CZ-CB 4.43Å; F48-F51 AromaticContact CZ-CD1 3.01Å; F48-F51 HydrophobicContact CZ-CD1 3.01Å; F48-F51 AromaticContact CZ-CE1 3.37Å; F48-F51 HydrophobicContact CZ-CE1 3.37Å; F48-F51 AromaticContact CZ-CG 3.94Å; F48-F51 HydrophobicContact CZ-CG 3.94Å; F48-F51 HydrophobicContact CZ-CZ 4.49Å; F48-F51 WeakPolarHBondContact O-CB 3.43Å; F48-F51 PolarHBondContact O-N 3.41Å; S49-F51 VanDerWaalsContact C-N 3.33Å; S49-F51 PolarHBondContact O-N 3.02Å; F51-E53 VanDerWaalsContact C-N 3.33Å; F51-E53 PolarHBondContact O-N 3.47Å; F51-Q54 PolarHBondContact O-N 3.01Å; F51-F55 HydrophobicContact CE1-CB 4.48Å; F51-F55 PolarHBondContact O-N 3.39Å
52	E	90.2	Very high	88.3	Confident	68 Å²	68	99.3 Å²	99.3	32%	0.318	50%	0.5	S	S	.	.	H	α-helix	trans	-56.5	-47	177.2	172	168.2	-146.4	0	0	111.7	F48 S49 Q54 F55 Q56	F48-E52 HydrophobicContact CD1-CB 4.27Å; F48-E52 HydrophobicContact CE1-CB 4.42Å; F48-E52 PolarHBondContact O-N 3.07Å; S49-E52 PolarHBondContact O-N 3.17Å; E52-Q54 PolarHBondContact O-N 3.41Å; E52-F55 PolarHBondContact O-N 3.16Å; E52-Q56 HydrophobicContact CG-CG 4.43Å; E52-Q56 WeakPolarHBondContact O-CB 3.33Å; E52-Q56 VanDerWaalsContact O-CG 3.29Å; E52-Q56 WeakPolarHBondContact O-CG 3.25Å; E52-Q56 PolarHBondContact O-N 3Å; E52-Q56 PolarHBondContact OE1-NE2 2.95Å
53	E	92.4	Very high	88.8	Confident	107 Å²	107	95.9 Å²	95.9	50%	0.5	48%	0.48	S	S	.	.	H	α-helix	trans	-58.7	-47.4	177	-174.7	-174.3	175.3	0	0	111.5	S49 F51 F55 Q56 Q57	S49-E53 WeakPolarHBondContact O-CB 3.49Å; S49-E53 PolarHBondContact O-N 3.37Å; F51-E53 VanDerWaalsContact C-N 3.33Å; F51-E53 PolarHBondContact O-N 3.47Å; E53-F55 PolarHBondContact O-N 2.94Å; E53-Q56 PolarHBondContact O-N 3.47Å; E53-Q57 WeakPolarHBondContact O-CB 3.41Å; E53-Q57 VanDerWaalsContact O-CG 3.27Å; E53-Q57 WeakPolarHBondContact O-CG 3.23Å; E53-Q57 PolarHBondContact O-N 2.99Å; E53-Q57 PolarHBondContact OE1-NE2 3.25Å; E53-Q57 VanDerWaalsContact OE1-NE2 3.09Å
54	Q	93.7	Very high	89.7	Confident	113 Å²	113	96.6 Å²	96.6	53%	0.528	49%	0.487	S	S	.	.	H	α-helix	trans	-63	-42.2	178.8	-77.3	173.1	84.7	0	0	112.1	R50 F51 E52 Q57 L58	R50-Q54 WeakPolarHBondContact O-CB 3.45Å; R50-Q54 VanDerWaalsContact O-CG 3.29Å; R50-Q54 WeakPolarHBondContact O-CG 3.33Å; R50-Q54 PolarHBondContact O-N 3.35Å; R50-Q54 PolarHBondContact O-NE2 3.06Å; F51-Q54 PolarHBondContact O-N 3.01Å; E52-Q54 PolarHBondContact O-N 3.41Å; Q54-Q57 PolarHBondContact O-N 3.48Å; Q54-L58 WeakPolarHBondContact O-CB 3.37Å; Q54-L58 WeakPolarHBondContact O-CG 3.13Å; Q54-L58 PolarHBondContact O-N 2.81Å
55	F	94.6	Very high	90.9	Very high	36 Å²	36	92.4 Å²	92.4	16%	0.158	47%	0.466	C	S	.	.	H	α-helix	trans	-65.5	-43.2	178	-172.8	-87.5	0	0	0	111.7	L29 L32 Q36 F51 E52 E53 Q57 L58 S59	L29-F55 HydrophobicContact CD1-CZ 4.31Å; L32-F55 HydrophobicContact CB-CE2 3.8Å; L32-F55 HydrophobicContact CB-CZ 3.78Å; Q36-F55 VanDerWaalsContact CD-CD1 3.5Å; F51-F55 HydrophobicContact CE1-CB 4.48Å; F51-F55 PolarHBondContact O-N 3.39Å; E52-F55 PolarHBondContact O-N 3.16Å; E53-F55 PolarHBondContact O-N 2.94Å; F55-Q57 VanDerWaalsContact C-N 3.28Å; F55-Q57 PolarHBondContact O-N 3.13Å; F55-L58 PolarHBondContact O-N 2.98Å; F55-S59 VanDerWaalsContact CD1-OG 3.26Å; F55-S59 WeakPolarHBondContact CD1-OG 3.42Å; F55-S59 WeakPolarHBondContact CE1-OG 3.03Å; F55-S59 WeakPolarHBondContact O-CB 3.32Å; F55-S59 PolarHBondContact O-N 3.34Å; F55-S59 PolarHBondContact O-OG 2.93Å
56	Q	93.5	Very high	92.2	Very high	113 Å²	113	89.7 Å²	89.7	53%	0.528	44%	0.438	S	S	.	.	H	α-helix	trans	-62.3	-35.2	175.6	-72.9	176.2	-0.5	0	0	111.9	E52 E53 P60	E52-Q56 HydrophobicContact CG-CG 4.43Å; E52-Q56 WeakPolarHBondContact O-CB 3.33Å; E52-Q56 VanDerWaalsContact O-CG 3.29Å; E52-Q56 WeakPolarHBondContact O-CG 3.25Å; E52-Q56 PolarHBondContact O-N 3Å; E52-Q56 PolarHBondContact OE1-NE2 2.95Å; E53-Q56 PolarHBondContact O-N 3.47Å; Q56-P60 WeakPolarHBondContact O-CD 3.44Å
57	Q	96.5	Very high	93.5	Very high	109 Å²	109	85.1 Å²	85.1	51%	0.509	42%	0.416	S	S	.	.	H	α-helix	trans	-74	-32.4	175.6	-72.3	178.5	17.7	0	0	113.6	E53 Q54 F55	E53-Q57 WeakPolarHBondContact O-CB 3.41Å; E53-Q57 VanDerWaalsContact O-CG 3.27Å; E53-Q57 WeakPolarHBondContact O-CG 3.23Å; E53-Q57 PolarHBondContact O-N 2.99Å; E53-Q57 PolarHBondContact OE1-NE2 3.25Å; E53-Q57 VanDerWaalsContact OE1-NE2 3.09Å; Q54-Q57 PolarHBondContact O-N 3.48Å; F55-Q57 VanDerWaalsContact C-N 3.28Å; F55-Q57 PolarHBondContact O-N 3.13Å
58	L	96.6	Very high	94.5	Very high	92 Å²	92	84.7 Å²	84.7	48%	0.482	40%	0.401	S	S	.	.	H	α-helix	trans	-85.5	-33.5	-178.1	-73.5	175.4	0	0	0	113.1	Q54 F55 K61 V62	Q54-L58 WeakPolarHBondContact O-CB 3.37Å; Q54-L58 WeakPolarHBondContact O-CG 3.13Å; Q54-L58 PolarHBondContact O-N 2.81Å; F55-L58 PolarHBondContact O-N 2.98Å; L58-K61 HydrophobicContact CD2-CD 4.19Å; L58-K61 WeakPolarHBondContact O-CA 3.49Å; L58-K61 WeakPolarHBondContact O-CB 3.38Å; L58-K61 PolarHBondContact O-N 3.38Å; L58-V62 PolarHBondContact O-N 3.3Å
59	S	97.6	Very high	95.2	Very high	22 Å²	22	84 Å²	84	15%	0.154	40%	0.399	C	S	.	.	H	α-helix	trans	-51.8	-45.6	-177.5	-65	0	0	0	0	113.3	F55 K61 V62 E63	F55-S59 VanDerWaalsContact CD1-OG 3.26Å; F55-S59 WeakPolarHBondContact CD1-OG 3.42Å; F55-S59 WeakPolarHBondContact CE1-OG 3.03Å; F55-S59 WeakPolarHBondContact O-CB 3.32Å; F55-S59 PolarHBondContact O-N 3.34Å; F55-S59 PolarHBondContact O-OG 2.93Å; S59-K61 PolarHBondContact O-N 3.42Å; S59-V62 PolarHBondContact O-N 3.02Å; S59-E63 PolarHBondContact O-N 3.31Å
60	P	98.2	Very high	95.8	Very high	69 Å²	69	83.4 Å²	83.4	45%	0.448	39%	0.391	S	S	.	.	H	α-helix	trans	-63.9	-27.4	176	-22.7	34.3	0	0	0	113.8	Q56 K64	Q56-P60 WeakPolarHBondContact O-CD 3.44Å; P60-K64 WeakPolarHBondContact O-CB 3.35Å; P60-K64 VanDerWaalsContact O-CG 3.24Å; P60-K64 WeakPolarHBondContact O-CG 3.3Å; P60-K64 PolarHBondContact O-N 3.33Å
61	K	98.1	Very high	96.3	Very high	134 Å²	134	77.7 Å²	77.7	58%	0.583	37%	0.372	S	S	*	.	H	α-helix	trans	-75.2	-39.4	177.3	-58.4	-178.5	-172.7	173.2	0	111	L58 S59 K64 F65	L58-K61 HydrophobicContact CD2-CD 4.19Å; L58-K61 WeakPolarHBondContact O-CA 3.49Å; L58-K61 WeakPolarHBondContact O-CB 3.38Å; L58-K61 PolarHBondContact O-N 3.38Å; S59-K61 PolarHBondContact O-N 3.42Å; K61-K64 PolarHBondContact O-N 2.96Å; K61-F65 PolarHBondContact O-N 3.4Å
62	V	98	Very high	96.9	Very high	56 Å²	56	75 Å²	75	34%	0.339	36%	0.362	S	S	.	.	H	α-helix	trans	-64	-43.8	174.2	177.9	0	0	0	0	110.3	I25 L29 L58 S59 K64 F65 A66	I25-V62 HydrophobicContact CG2-CG1 3.42Å; I25-V62 VanDerWaalsContact CG2-CG1 3.42Å; L29-V62 HydrophobicContact CB-CG1 4.36Å; L29-V62 HydrophobicContact CD1-CB 4.45Å; L29-V62 HydrophobicContact CD1-CG1 4.42Å; L29-V62 HydrophobicContact CD2-CB 4.3Å; L29-V62 HydrophobicContact CD2-CG1 4.21Å; L58-V62 PolarHBondContact O-N 3.3Å; S59-V62 PolarHBondContact O-N 3.02Å; V62-K64 PolarHBondContact O-N 3.33Å; V62-F65 WeakPolarHBondContact O-CB 3.3Å; V62-F65 PolarHBondContact O-N 3.37Å; V62-F65 VanDerWaalsContact O-N 3.12Å; V62-A66 PolarHBondContact O-N 3.14Å
63	E	98.5	Very high	97.3	Very high	68 Å²	68	73.8 Å²	73.8	32%	0.318	36%	0.356	S	S	.	.	H	α-helix	trans	-61.1	-44.3	175.4	-178.5	58.9	-160.5	0	0	112	R26 L29 S59 F65 A66 Q67	R26-E63 IonicContact CZ-OE1 3.89Å; R26-E63 IonicContact NH1-OE1 2.59Å; R26-E63 PolarHBondContact NH1-OE1 2.87Å; R26-E63 IonicContact NH1-OE2 3.61Å; R26-E63 IonicContact NH2-OE1 2.63Å; R26-E63 PolarHBondContact NH2-OE1 3.42Å; L29-E63 HydrophobicContact CD2-CB 4.07Å; S59-E63 PolarHBondContact O-N 3.31Å; E63-F65 VanDerWaalsContact C-N 3.27Å; E63-F65 PolarHBondContact O-N 2.9Å; E63-A66 PolarHBondContact O-N 3.27Å; E63-Q67 PolarHBondContact O-N 3.03Å
64	K	98.5	Very high	97.6	Very high	152 Å²	152	73.7 Å²	73.7	66%	0.661	36%	0.355	S	S	*	.	H	α-helix	trans	-61.6	-35.2	173.5	-78	175.1	179.9	-175.9	0	112.9	P60 K61 V62 Q67 L68	P60-K64 WeakPolarHBondContact O-CB 3.35Å; P60-K64 VanDerWaalsContact O-CG 3.24Å; P60-K64 WeakPolarHBondContact O-CG 3.3Å; P60-K64 PolarHBondContact O-N 3.33Å; K61-K64 PolarHBondContact O-N 2.96Å; V62-K64 PolarHBondContact O-N 3.33Å; K64-Q67 PolarHBondContact O-N 2.9Å; K64-L68 PolarHBondContact O-N 3.01Å
65	F	98.5	Very high	97.8	Very high	106 Å²	106	74 Å²	74	47%	0.465	36%	0.357	S	S	.	.	H	α-helix	trans	-68.2	-43.4	176.1	-179.4	-120.7	0	0	0	111.3	I25 K61 V62 E63 Q67 L68 L69	I25-F65 HydrophobicContact CD1-CD1 3.63Å; I25-F65 HydrophobicContact CD1-CE1 3.56Å; K61-F65 PolarHBondContact O-N 3.4Å; V62-F65 WeakPolarHBondContact O-CB 3.3Å; V62-F65 PolarHBondContact O-N 3.37Å; V62-F65 VanDerWaalsContact O-N 3.12Å; E63-F65 VanDerWaalsContact C-N 3.27Å; E63-F65 PolarHBondContact O-N 2.9Å; F65-Q67 VanDerWaalsContact C-N 3.31Å; F65-Q67 PolarHBondContact O-N 3.28Å; F65-L68 HydrophobicContact CD2-CD2 4.4Å; F65-L68 WeakPolarHBondContact O-CB 3.35Å; F65-L68 PolarHBondContact O-N 3.1Å; F65-L69 HydrophobicContact CE1-CD1 4.17Å; F65-L69 HydrophobicContact CE2-CD2 4.06Å; F65-L69 HydrophobicContact CE2-CG 4.47Å; F65-L69 HydrophobicContact CZ-CD1 4.32Å; F65-L69 HydrophobicContact CZ-CD2 3.97Å; F65-L69 HydrophobicContact CZ-CG 4.35Å; F65-L69 WeakPolarHBondContact O-CG 3.44Å; F65-L69 PolarHBondContact O-N 2.74Å; F65-L69 VanDerWaalsContact O-N 3.07Å
66	A	98.6	Very high	97.9	Very high	0 Å²	0	74.1 Å²	74.1	0%	0	36%	0.359	C	S	.	.	H	α-helix	trans	-58.2	-44.3	172.2	0	0	0	0	0	111.7	S22 I25 R26 V62 E63 L68 L69 E70	S22-A66 WeakPolarHBondContact CB-O 3.14Å; S22-A66 PolarHBondContact OG-O 2.98Å; I25-A66 HydrophobicContact CB-CB 4.21Å; I25-A66 HydrophobicContact CG2-CB 3.92Å; R26-A66 HydrophobicContact CG-CB 3.82Å; V62-A66 PolarHBondContact O-N 3.14Å; E63-A66 PolarHBondContact O-N 3.27Å; A66-L68 VanDerWaalsContact C-N 3.34Å; A66-L68 PolarHBondContact O-N 3.09Å; A66-L69 WeakPolarHBondContact O-CB 3.46Å; A66-L69 PolarHBondContact O-N 3.12Å; A66-L69 VanDerWaalsContact O-N 3.13Å; A66-E70 PolarHBondContact O-N 2.94Å; A66-E70 VanDerWaalsContact O-N 3.16Å
67	Q	98.6	Very high	98.2	Very high	77 Å²	77	70.9 Å²	70.9	36%	0.36	35%	0.345	S	S	.	.	H	α-helix	trans	-57.5	-44.5	174.5	-178.8	58	34.8	0	0	112.6	E63 K64 F65 L69 E70 E71	E63-Q67 PolarHBondContact O-N 3.03Å; K64-Q67 PolarHBondContact O-N 2.9Å; F65-Q67 VanDerWaalsContact C-N 3.31Å; F65-Q67 PolarHBondContact O-N 3.28Å; Q67-L69 VanDerWaalsContact C-N 3.3Å; Q67-L69 PolarHBondContact O-N 2.83Å; Q67-E70 PolarHBondContact O-N 2.74Å; Q67-E70 VanDerWaalsContact O-N 3.17Å; Q67-E71 WeakPolarHBondContact CG-OE1 3.34Å; Q67-E71 PolarHBondContact NE2-OE1 3.36Å; Q67-E71 WeakPolarHBondContact O-CG 3.46Å; Q67-E71 PolarHBondContact O-N 3.02Å
68	L	98.6	Very high	98.2	Very high	76 Å²	76	69.3 Å²	69.3	40%	0.398	35%	0.346	S	S	.	.	H	α-helix	trans	-59.6	-39.1	175.7	175.3	63.9	0	0	0	112.2	K64 F65 A66 E70 E71 I72	K64-L68 PolarHBondContact O-N 3.01Å; F65-L68 HydrophobicContact CD2-CD2 4.4Å; F65-L68 WeakPolarHBondContact O-CB 3.35Å; F65-L68 PolarHBondContact O-N 3.1Å; A66-L68 VanDerWaalsContact C-N 3.34Å; A66-L68 PolarHBondContact O-N 3.09Å; L68-E70 VanDerWaalsContact C-N 3.33Å; L68-E70 PolarHBondContact O-N 3.01Å; L68-E71 PolarHBondContact O-N 3.33Å; L68-I72 HydrophobicContact CD1-CD1 4.21Å; L68-I72 HydrophobicContact CD1-CG1 4.33Å; L68-I72 HydrophobicContact CG-CD1 3.97Å; L68-I72 VanDerWaalsContact O-CG1 3.27Å; L68-I72 WeakPolarHBondContact O-CG1 3.49Å; L68-I72 PolarHBondContact O-N 2.87Å
69	L	98.8	Very high	98.1	Very high	17 Å²	17	67.4 Å²	67.4	9%	0.089	34%	0.338	C	S	.	.	H	α-helix	trans	-64.5	-38.5	177.1	-60.5	179.1	0	0	0	111.8	Y18 I25 F65 A66 Q67 I72 K73	Y18-L69 HydrophobicContact CD1-CB 4.33Å; Y18-L69 HydrophobicContact CD1-CD2 3.61Å; Y18-L69 HydrophobicContact CE1-CD2 3.92Å; I25-L69 HydrophobicContact CD1-CD1 3.63Å; F65-L69 HydrophobicContact CE1-CD1 4.17Å; F65-L69 HydrophobicContact CE2-CD2 4.06Å; F65-L69 HydrophobicContact CE2-CG 4.47Å; F65-L69 HydrophobicContact CZ-CD1 4.32Å; F65-L69 HydrophobicContact CZ-CD2 3.97Å; F65-L69 HydrophobicContact CZ-CG 4.35Å; F65-L69 WeakPolarHBondContact O-CG 3.44Å; F65-L69 PolarHBondContact O-N 2.74Å; F65-L69 VanDerWaalsContact O-N 3.07Å; A66-L69 WeakPolarHBondContact O-CB 3.46Å; A66-L69 PolarHBondContact O-N 3.12Å; A66-L69 VanDerWaalsContact O-N 3.13Å; Q67-L69 VanDerWaalsContact C-N 3.3Å; Q67-L69 PolarHBondContact O-N 2.83Å; L69-I72 PolarHBondContact O-N 3.49Å; L69-K73 PolarHBondContact O-N 2.94Å
70	E	98.6	Very high	98.1	Very high	40 Å²	40	66.3 Å²	66.3	19%	0.187	33%	0.331	C	S	.	.	H	α-helix	trans	-66.4	-39.1	175.2	-173.4	60.6	-159	0	0	111.7	A66 Q67 L68 K73 Q74	A66-E70 PolarHBondContact O-N 2.94Å; A66-E70 VanDerWaalsContact O-N 3.16Å; Q67-E70 PolarHBondContact O-N 2.74Å; Q67-E70 VanDerWaalsContact O-N 3.17Å; L68-E70 VanDerWaalsContact C-N 3.33Å; L68-E70 PolarHBondContact O-N 3.01Å; E70-K73 VanDerWaalsContact CD-CD 3.49Å; E70-K73 VanDerWaalsContact CD-NZ 3.33Å; E70-K73 WeakPolarHBondContact O-CB 3.33Å; E70-K73 PolarHBondContact O-N 3.48Å; E70-K73 WeakPolarHBondContact OE1-CD 3.27Å; E70-K73 IonicContact OE1-NZ 2.81Å; E70-K73 PolarHBondContact OE1-NZ 2.76Å; E70-K73 WeakPolarHBondContact OE2-CD 3.39Å; E70-K73 IonicContact OE2-NZ 3.01Å; E70-K73 PolarHBondContact OE2-NZ 3.31Å; E70-Q74 WeakPolarHBondContact O-CG 3.37Å; E70-Q74 PolarHBondContact O-N 2.97Å
71	E	98.5	Very high	98	Very high	76 Å²	76	67.1 Å²	67.1	36%	0.355	33%	0.332	S	S	.	.	H	α-helix	trans	-62.8	-42.2	173.4	-70.8	168.9	-164.1	0	0	111.7	Q67 L68 Q74 Q75	Q67-E71 WeakPolarHBondContact CG-OE1 3.34Å; Q67-E71 PolarHBondContact NE2-OE1 3.36Å; Q67-E71 WeakPolarHBondContact O-CG 3.46Å; Q67-E71 PolarHBondContact O-N 3.02Å; L68-E71 PolarHBondContact O-N 3.33Å; E71-Q74 PolarHBondContact O-N 3.07Å; E71-Q75 VanDerWaalsContact O-CG 3.32Å; E71-Q75 WeakPolarHBondContact O-CG 3.41Å; E71-Q75 PolarHBondContact O-N 3.29Å
72	I	98.2	Very high	97.9	Very high	44 Å²	44	63.5 Å²	63.5	23%	0.226	33%	0.326	C	S	.	.	H	α-helix	trans	-62.7	-43.5	175.3	-69	165.7	0	0	0	110.6	Y18 L68 L69 Q74 Q75 L76	Y18-I72 HydrophobicContact CD1-CB 3.99Å; Y18-I72 HydrophobicContact CD1-CD1 4.28Å; Y18-I72 HydrophobicContact CD1-CG2 3.61Å; Y18-I72 HydrophobicContact CD2-CG2 4Å; Y18-I72 HydrophobicContact CE1-CB 4.31Å; Y18-I72 HydrophobicContact CE1-CD1 3.99Å; Y18-I72 HydrophobicContact CE1-CG2 3.66Å; Y18-I72 HydrophobicContact CE2-CG2 4.05Å; Y18-I72 HydrophobicContact CG-CB 4.41Å; Y18-I72 HydrophobicContact CG-CG2 3.81Å; L68-I72 HydrophobicContact CD1-CD1 4.21Å; L68-I72 HydrophobicContact CD1-CG1 4.33Å; L68-I72 HydrophobicContact CG-CD1 3.97Å; L68-I72 VanDerWaalsContact O-CG1 3.27Å; L68-I72 WeakPolarHBondContact O-CG1 3.49Å; L68-I72 PolarHBondContact O-N 2.87Å; L69-I72 PolarHBondContact O-N 3.49Å; I72-Q74 VanDerWaalsContact C-N 3.34Å; I72-Q74 PolarHBondContact O-N 3.1Å; I72-Q75 PolarHBondContact O-N 2.87Å; I72-L76 HydrophobicContact CG2-CD1 3.82Å; I72-L76 HydrophobicContact CG2-CG 4.16Å; I72-L76 WeakPolarHBondContact O-CB 3.49Å; I72-L76 VanDerWaalsContact O-CG 3.3Å; I72-L76 WeakPolarHBondContact O-CG 3.13Å; I72-L76 PolarHBondContact O-N 2.94Å
73	K	98.4	Very high	97.6	Very high	42 Å²	42	61.7 Å²	61.7	18%	0.183	32%	0.315	C	S	.	.	H	α-helix	trans	-55.8	-47.6	174.5	168.4	-154.5	-175.7	-176.9	0	111.4	S15 L69 E70 Q75 L76 N77	S15-K73 WeakPolarHBondContact O-CG 3.4Å; S15-K73 WeakPolarHBondContact OG-CA 3.37Å; S15-K73 WeakPolarHBondContact OG-CG 3.31Å; S15-K73 PolarHBondContact OG-O 3.45Å; L69-K73 PolarHBondContact O-N 2.94Å; E70-K73 VanDerWaalsContact CD-CD 3.49Å; E70-K73 VanDerWaalsContact CD-NZ 3.33Å; E70-K73 WeakPolarHBondContact O-CB 3.33Å; E70-K73 PolarHBondContact O-N 3.48Å; E70-K73 WeakPolarHBondContact OE1-CD 3.27Å; E70-K73 IonicContact OE1-NZ 2.81Å; E70-K73 PolarHBondContact OE1-NZ 2.76Å; E70-K73 WeakPolarHBondContact OE2-CD 3.39Å; E70-K73 IonicContact OE2-NZ 3.01Å; E70-K73 PolarHBondContact OE2-NZ 3.31Å; K73-Q75 PolarHBondContact O-N 3.29Å; K73-L76 PolarHBondContact O-N 3.4Å; K73-N77 PolarHBondContact O-N 3.48Å; K73-N77 PolarHBondContact O-ND2 2.98Å
74	Q	98.6	Very high	97.4	Very high	105 Å²	105	61.8 Å²	61.8	49%	0.491	32%	0.316	S	S	.	.	H	α-helix	trans	-61.6	-43.1	178.3	-69.2	173.1	10.1	0	0	112	E70 E71 I72 N77 S78	E70-Q74 WeakPolarHBondContact O-CG 3.37Å; E70-Q74 PolarHBondContact O-N 2.97Å; E71-Q74 PolarHBondContact O-N 3.07Å; I72-Q74 VanDerWaalsContact C-N 3.34Å; I72-Q74 PolarHBondContact O-N 3.1Å; Q74-N77 PolarHBondContact O-N 2.87Å; Q74-S78 PolarHBondContact O-N 3.22Å; Q74-S78 PolarHBondContact O-OG 2.98Å
75	Q	98	Very high	97.1	Very high	121 Å²	121	60 Å²	60	57%	0.565	31%	0.31	S	S	*	.	H	α-helix	trans	-64.7	-40.1	176.3	-70.3	172.4	43	0	0	111.9	E71 I72 K73 S78 T79	E71-Q75 VanDerWaalsContact O-CG 3.32Å; E71-Q75 WeakPolarHBondContact O-CG 3.41Å; E71-Q75 PolarHBondContact O-N 3.29Å; I72-Q75 PolarHBondContact O-N 2.87Å; K73-Q75 PolarHBondContact O-N 3.29Å; Q75-S78 PolarHBondContact O-N 3.25Å; Q75-T79 WeakPolarHBondContact O-CB 3.5Å; Q75-T79 PolarHBondContact O-N 3.06Å; Q75-T79 PolarHBondContact O-OG1 2.97Å
76	L	97.8	Very high	96.6	Very high	37 Å²	37	60.1 Å²	60.1	19%	0.194	31%	0.312	C	S	.	.	H	α-helix	trans	-65.9	-40.1	176.4	-72.8	172.7	0	0	0	111.8	I11 K14 Y18 I72 K73 T79 A80	I11-L76 HydrophobicContact CG2-CB 4.09Å; I11-L76 HydrophobicContact CG2-CD2 4.08Å; I11-L76 WeakPolarHBondContact CG2-O 3.44Å; K14-L76 HydrophobicContact CB-CD1 4.41Å; Y18-L76 HydrophobicContact CD2-CD1 3.52Å; Y18-L76 HydrophobicContact CE2-CD1 3.76Å; Y18-L76 HydrophobicContact CG-CD1 4.39Å; I72-L76 HydrophobicContact CG2-CD1 3.82Å; I72-L76 HydrophobicContact CG2-CG 4.16Å; I72-L76 WeakPolarHBondContact O-CB 3.49Å; I72-L76 VanDerWaalsContact O-CG 3.3Å; I72-L76 WeakPolarHBondContact O-CG 3.13Å; I72-L76 PolarHBondContact O-N 2.94Å; K73-L76 PolarHBondContact O-N 3.4Å; L76-T79 PolarHBondContact O-N 3.22Å; L76-A80 PolarHBondContact O-N 2.84Å
77	N	98.3	Very high	96.1	Very high	45 Å²	45	64 Å²	64	24%	0.241	33%	0.333	C	S	.	.	H	α-helix	trans	-62.5	-47.7	174.4	-74.5	-31.3	0	0	0	111.3	S15 K73 Q74 T79 A80 D81	S15-N77 WeakPolarHBondContact CB-OD1 3.33Å; S15-N77 VanDerWaalsContact OG-CG 3.22Å; S15-N77 PolarHBondContact OG-ND2 3.3Å; S15-N77 VanDerWaalsContact OG-ND2 3.14Å; S15-N77 PolarHBondContact OG-OD1 3.01Å; K73-N77 PolarHBondContact O-N 3.48Å; K73-N77 PolarHBondContact O-ND2 2.98Å; Q74-N77 PolarHBondContact O-N 2.87Å; N77-T79 PolarHBondContact O-N 3.3Å; N77-A80 WeakPolarHBondContact O-CB 3.48Å; N77-A80 PolarHBondContact O-N 3.45Å; N77-A80 VanDerWaalsContact O-N 3.1Å; N77-D81 PolarHBondContact O-N 2.93Å
78	S	97.2	Very high	95.6	Very high	76 Å²	76	65.4 Å²	65.4	53%	0.531	34%	0.339	S	S	.	.	H	α-helix	trans	-59.2	-37.9	176.4	-52.8	0	0	0	0	111.8	Q74 Q75 D81 A82	Q74-S78 PolarHBondContact O-N 3.22Å; Q74-S78 PolarHBondContact O-OG 2.98Å; Q75-S78 PolarHBondContact O-N 3.25Å; S78-D81 PolarHBondContact O-N 3.41Å; S78-A82 PolarHBondContact O-N 3.2Å; S78-A82 VanDerWaalsContact O-N 3.07Å
79	T	95.4	Very high	95.1	Very high	52 Å²	52	66.5 Å²	66.5	32%	0.319	34%	0.342	S	S	.	.	H	α-helix	trans	-66.8	-43.1	175.8	-56.9	0	0	0	0	111.5	I4 Q75 L76 N77 D81 A82 V83	I4-T79 HydrophobicContact CD1-CG2 3.57Å; Q75-T79 WeakPolarHBondContact O-CB 3.5Å; Q75-T79 PolarHBondContact O-N 3.06Å; Q75-T79 PolarHBondContact O-OG1 2.97Å; L76-T79 PolarHBondContact O-N 3.22Å; N77-T79 PolarHBondContact O-N 3.3Å; T79-D81 VanDerWaalsContact C-N 3.31Å; T79-D81 PolarHBondContact O-N 3.2Å; T79-A82 PolarHBondContact O-N 3.43Å; T79-V83 HydrophobicContact CG2-CG2 4.47Å; T79-V83 VanDerWaalsContact O-CG2 3.31Å; T79-V83 WeakPolarHBondContact O-CG2 3.3Å; T79-V83 PolarHBondContact O-N 3.31Å
80	A	96.3	Very high	94.4	Very high	0 Å²	0	69.5 Å²	69.5	0%	0	36%	0.358	C	S	.	.	H	α-helix	trans	-61.7	-40.3	176.8	0	0	0	0	0	111.9	P8 I11 R12 L76 N77 V83 Q84	P8-A80 HydrophobicContact CB-CB 4.37Å; P8-A80 WeakPolarHBondContact O-CB 3.35Å; I11-A80 HydrophobicContact CB-CB 3.98Å; I11-A80 HydrophobicContact CG2-CB 3.84Å; R12-A80 HydrophobicContact CG-CB 3.64Å; L76-A80 PolarHBondContact O-N 2.84Å; N77-A80 WeakPolarHBondContact O-CB 3.48Å; N77-A80 PolarHBondContact O-N 3.45Å; N77-A80 VanDerWaalsContact O-N 3.1Å; A80-V83 PolarHBondContact O-N 3.32Å; A80-Q84 WeakPolarHBondContact O-CB 3.23Å; A80-Q84 PolarHBondContact O-N 3.45Å
81	D	96.8	Very high	93.7	Very high	86 Å²	86	71.3 Å²	71.3	46%	0.46	38%	0.375	S	S	.	.	H	α-helix	trans	-64.1	-44.1	177.1	-64.7	-21.6	0	0	0	111.1	R12 N77 S78 T79 V83 Q84 E85	R12-D81 IonicContact CZ-OD1 3.67Å; R12-D81 IonicContact NE-OD1 3.75Å; R12-D81 IonicContact NH2-OD1 2.76Å; R12-D81 PolarHBondContact NH2-OD1 3.47Å; N77-D81 PolarHBondContact O-N 2.93Å; S78-D81 PolarHBondContact O-N 3.41Å; T79-D81 VanDerWaalsContact C-N 3.31Å; T79-D81 PolarHBondContact O-N 3.2Å; D81-V83 PolarHBondContact O-N 3.43Å; D81-Q84 PolarHBondContact O-N 3.42Å; D81-E85 PolarHBondContact O-N 3.47Å
82	A	94.8	Very high	93.1	Very high	57 Å²	57	73 Å²	73	47%	0.471	39%	0.387	S	S	.	.	H	α-helix	trans	-63	-40.8	176.1	0	0	0	0	0	113	S78 T79 Q86	S78-A82 PolarHBondContact O-N 3.2Å; S78-A82 VanDerWaalsContact O-N 3.07Å; T79-A82 PolarHBondContact O-N 3.43Å; A82-Q86 WeakPolarHBondContact O-CB 3.48Å; A82-Q86 PolarHBondContact O-N 2.92Å
83	V	92.5	Very high	92.4	Very high	18 Å²	18	76.7 Å²	76.7	11%	0.109	41%	0.407	C	S	.	.	H	α-helix	trans	-66.1	-43.2	176.1	175.6	0	0	0	0	110.5	I4 P8 I11 T79 A80 D81 E85 Q86 D87	I4-V83 HydrophobicContact CB-CG2 4.49Å; I4-V83 HydrophobicContact CD1-CG2 3.75Å; I4-V83 HydrophobicContact CG2-CG2 4.42Å; P8-V83 HydrophobicContact CG-CB 4.16Å; P8-V83 HydrophobicContact CG-CG1 3.79Å; I11-V83 HydrophobicContact CD1-CG2 4.21Å; T79-V83 HydrophobicContact CG2-CG2 4.47Å; T79-V83 VanDerWaalsContact O-CG2 3.31Å; T79-V83 WeakPolarHBondContact O-CG2 3.3Å; T79-V83 PolarHBondContact O-N 3.31Å; A80-V83 PolarHBondContact O-N 3.32Å; D81-V83 PolarHBondContact O-N 3.43Å; V83-E85 PolarHBondContact O-N 3.32Å; V83-Q86 PolarHBondContact O-N 3.12Å; V83-D87 PolarHBondContact O-N 3.15Å
84	Q	93.6	Very high	91.5	Very high	71 Å²	71	83 Å²	83	33%	0.332	43%	0.434	S	S	.	.	H	α-helix	trans	-63.8	-42.2	179.2	-172.3	-179.4	-65	0	0	112.2	P8 A80 D81 D87 Q88	P8-Q84 HydrophobicContact CB-CB 4.06Å; P8-Q84 HydrophobicContact CG-CB 3.86Å; A80-Q84 WeakPolarHBondContact O-CB 3.23Å; A80-Q84 PolarHBondContact O-N 3.45Å; D81-Q84 PolarHBondContact O-N 3.42Å; Q84-D87 PolarHBondContact O-N 3.43Å; Q84-Q88 VanDerWaalsContact O-CG 3.29Å; Q84-Q88 WeakPolarHBondContact O-CG 3.31Å; Q84-Q88 PolarHBondContact O-N 2.94Å
85	E	92.4	Very high	90.2	Very high	113 Å²	113	81 Å²	81	53%	0.528	44%	0.443	S	S	.	.	H	α-helix	trans	-63	-44.7	175.9	-174	-177.8	174.5	0	0	111.1	D81 V83 D87 Q88 Q89	D81-E85 PolarHBondContact O-N 3.47Å; V83-E85 PolarHBondContact O-N 3.32Å; E85-D87 PolarHBondContact O-N 3.23Å; E85-Q88 PolarHBondContact O-N 3.48Å; E85-Q89 VanDerWaalsContact O-CG 3.3Å; E85-Q89 WeakPolarHBondContact O-CG 3.49Å; E85-Q89 PolarHBondContact O-N 3.03Å; E85-Q89 PolarHBondContact OE1-NE2 3.04Å; E85-Q89 VanDerWaalsContact OE1-NE2 3.12Å
86	Q	89.2	Confident	88.2	Confident	110 Å²	110	81.9 Å²	81.9	51%	0.514	45%	0.451	S	S	.	.	H	α-helix	trans	-60	-44.9	176.4	177.6	170.2	79.1	0	0	111.9	A82 V83 Q88 Q89 L90	A82-Q86 WeakPolarHBondContact O-CB 3.48Å; A82-Q86 PolarHBondContact O-N 2.92Å; V83-Q86 PolarHBondContact O-N 3.12Å; Q86-Q88 PolarHBondContact O-N 3.22Å; Q86-Q89 PolarHBondContact O-N 2.94Å; Q86-L90 HydrophobicContact CG-CD1 4.06Å; Q86-L90 WeakPolarHBondContact O-CB 3.43Å; Q86-L90 VanDerWaalsContact O-CG 3.31Å; Q86-L90 WeakPolarHBondContact O-CG 3.29Å; Q86-L90 PolarHBondContact O-N 2.83Å
87	D	86.8	Confident	85.9	Confident	82 Å²	82	93.1 Å²	93.1	44%	0.439	50%	0.502	S	S	.	.	H	α-helix	trans	-63.1	-41.1	178.2	-78.3	-13.4	0	0	0	112	V83 Q84 E85 L90 S91	V83-D87 PolarHBondContact O-N 3.15Å; Q84-D87 PolarHBondContact O-N 3.43Å; E85-D87 PolarHBondContact O-N 3.23Å; D87-L90 PolarHBondContact O-N 3.04Å; D87-S91 WeakPolarHBondContact O-CB 3.45Å; D87-S91 PolarHBondContact O-N 3.44Å
88	Q	88.1	Confident	85.3	Confident	105 Å²	105	95.6 Å²	95.6	49%	0.491	52%	0.515	S	S	.	.	H	α-helix	trans	-64.4	-43.9	175.7	-72.6	174.6	5.2	0	0	111.8	Q84 E85 Q86 S91 N92	Q84-Q88 VanDerWaalsContact O-CG 3.29Å; Q84-Q88 WeakPolarHBondContact O-CG 3.31Å; Q84-Q88 PolarHBondContact O-N 2.94Å; E85-Q88 PolarHBondContact O-N 3.48Å; Q86-Q88 PolarHBondContact O-N 3.22Å; Q88-S91 PolarHBondContact O-N 3.33Å; Q88-N92 WeakPolarHBondContact O-CB 3.35Å; Q88-N92 PolarHBondContact O-N 3.36Å; Q88-N92 PolarHBondContact O-ND2 3.38Å
89	Q	88.2	Confident	84.7	Confident	100 Å²	100	96.6 Å²	96.6	47%	0.467	51%	0.514	S	S	.	.	H	α-helix	trans	-61.8	-44.1	176.3	-72.2	176.6	8.7	0	0	111.6	E85 Q86 N92 N93	E85-Q89 VanDerWaalsContact O-CG 3.3Å; E85-Q89 WeakPolarHBondContact O-CG 3.49Å; E85-Q89 PolarHBondContact O-N 3.03Å; E85-Q89 PolarHBondContact OE1-NE2 3.04Å; E85-Q89 VanDerWaalsContact OE1-NE2 3.12Å; Q86-Q89 PolarHBondContact O-N 2.94Å; Q89-N92 PolarHBondContact O-N 3.48Å; Q89-N93 PolarHBondContact O-N 2.88Å; Q89-N93 PolarHBondContact O-ND2 3.43Å
90	L	85.2	Confident	84.1	Confident	80 Å²	80	99.1 Å²	99.1	42%	0.419	53%	0.525	S	S	.	.	H	α-helix	trans	-62.4	-47.4	175.5	-71.4	171.4	0	0	0	111.1	Q86 D87 N92 N93 F94	Q86-L90 HydrophobicContact CG-CD1 4.06Å; Q86-L90 WeakPolarHBondContact O-CB 3.43Å; Q86-L90 VanDerWaalsContact O-CG 3.31Å; Q86-L90 WeakPolarHBondContact O-CG 3.29Å; Q86-L90 PolarHBondContact O-N 2.83Å; D87-L90 PolarHBondContact O-N 3.04Å; L90-N92 VanDerWaalsContact C-N 3.32Å; L90-N92 PolarHBondContact O-N 3.1Å; L90-N93 WeakPolarHBondContact O-CB 3.47Å; L90-N93 PolarHBondContact O-N 2.94Å; L90-N93 VanDerWaalsContact O-N 3.1Å; L90-F94 HydrophobicContact CB-CE2 4.43Å; L90-F94 WeakPolarHBondContact O-CD2 3.05Å; L90-F94 PolarHBondContact O-N 3.01Å
91	S	83.5	Confident	83.4	Confident	78 Å²	78	104.9 Å²	104.9	55%	0.545	56%	0.556	S	S	.	*	H	α-helix	trans	-57.8	-43.7	177.8	-176.3	0	0	0	0	112.3	D87 Q88 N93 F94 G95	D87-S91 WeakPolarHBondContact O-CB 3.45Å; D87-S91 PolarHBondContact O-N 3.44Å; Q88-S91 PolarHBondContact O-N 3.33Å; S91-N93 VanDerWaalsContact C-N 3.33Å; S91-N93 PolarHBondContact O-N 3.23Å; S91-F94 PolarHBondContact O-N 2.93Å; S91-G95 PolarHBondContact O-N 3.45Å
92	N	86.1	Confident	82.5	Confident	111 Å²	111	106.1 Å²	106.1	59%	0.594	56%	0.562	S	S	*	*	H	α-helix	trans	-62.8	-38.7	175.7	-69.1	-22.7	0	0	0	112.3	Q88 Q89 L90 F94 G95	Q88-N92 WeakPolarHBondContact O-CB 3.35Å; Q88-N92 PolarHBondContact O-N 3.36Å; Q88-N92 PolarHBondContact O-ND2 3.38Å; Q89-N92 PolarHBondContact O-N 3.48Å; L90-N92 VanDerWaalsContact C-N 3.32Å; L90-N92 PolarHBondContact O-N 3.1Å; N92-F94 VanDerWaalsContact C-N 3.33Å; N92-G95 PolarHBondContact O-N 3.43Å
93	N	83.2	Confident	81.7	Confident	122 Å²	122	109.3 Å²	109.3	65%	0.652	57%	0.568	S	S	*	*	H	α-helix	trans	-68.5	-30.9	177.1	-69.9	-24.4	0	0	0	112.7	Q89 L90 S91	Q89-N93 PolarHBondContact O-N 2.88Å; Q89-N93 PolarHBondContact O-ND2 3.43Å; L90-N93 WeakPolarHBondContact O-CB 3.47Å; L90-N93 PolarHBondContact O-N 2.94Å; L90-N93 VanDerWaalsContact O-N 3.1Å; S91-N93 VanDerWaalsContact C-N 3.33Å; S91-N93 PolarHBondContact O-N 3.23Å
94	F	80.2	Confident	80.9	Confident	173 Å²	173	115.9 Å²	115.9	76%	0.759	60%	0.601	S	S	*	*	H	α-helix	trans	-83.1	-24.9	175.5	-73.3	-68.6	0	0	0	113.4	L90 S91 N92 L96	L90-F94 HydrophobicContact CB-CE2 4.43Å; L90-F94 WeakPolarHBondContact O-CD2 3.05Å; L90-F94 PolarHBondContact O-N 3.01Å; S91-F94 PolarHBondContact O-N 2.93Å; N92-F94 VanDerWaalsContact C-N 3.33Å; F94-L96 PolarHBondContact O-N 3.06Å
95	G	70.8	Confident	80	Confident	65 Å²	65	119.3 Å²	119.3	67%	0.67	62%	0.622	S	S	*	*	S	Bend	trans	-72	10.7	-178.7	0	0	0	0	0	115.8	S91 N92	S91-G95 PolarHBondContact O-N 3.45Å; N92-G95 PolarHBondContact O-N 3.43Å
96	L	56.3	Low	78.9	Confident	139 Å²	139	119.8 Å²	119.8	73%	0.728	63%	0.629	S	S	*	*			trans	-131.8	90.8	-174.6	-75.1	164.3	0	0	0	111.4	F94	F94-L96 PolarHBondContact O-N 3.06Å
97	Q	49.5	Very low	78	Confident	273 Å²	273	120.7 Å²	120.7	100%	1.276	64%	0.64	S	S	*	*				-172.7	0	121.8	-98.2	176	25.5	0	0	110.4

Retrieved 97 of 97 residues in 595.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).