CMIP3_HUMAN Loading...

Isoform 2 of Ciliary microtubule inner protein 3

Canonical isoform description:

AlphaFold DB (X6R8D5), UniProt , Accession X6R8D5-2 (canonical: X6R8D5), Species HUMAN (Homo sapiens, Human), Gene CIMIP3, Length 127 aa.

						>CMIP3_HUMAN|X6R8D5-2|CIMIP3
MGRKEHESPSQPHMCGWEDSQKPSVPSHGPKTPSCKGVKAPHSSRPRAWKQDLEQSLAAAYVPVVVDSKGQNPDKLRFNFYTSQYSNSLNPFYTLQKPTCGYLYRRDTDHTRKRFDVPPANLVLWRS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.9	Very low	48.9	Very low	248 Å²	248	164.3 Å²	164.3	100%	1.222	85%	0.85	S	S	*	*				0	134.6	0	-75.2	-149.3	-82.4	0	0	108.7
2	G	47.8	Very low	49.2	Very low	71 Å²	71	159.8 Å²	159.8	73%	0.732	84%	0.838	S	S	*	*			trans	93.9	84.8	169.6	0	0	0	0	0	115.4
3	R	53.3	Low	48.8	Very low	250 Å²	250	160 Å²	160	94%	0.943	83%	0.832	S	S	*	*				55.6	99.4	99.5	-60.3	-167.1	-162.8	-171.6	6.9	112.4
4	K	47.4	Very low	48.2	Very low	172 Å²	172	160.1 Å²	160.1	75%	0.748	83%	0.829	S	S	*	*				62.7	97.9	66.3	-150.8	-176.1	-160.7	-155.2	0	112.8
5	E	58.3	Low	48.1	Very low	200 Å²	200	156.7 Å²	156.7	94%	0.935	82%	0.823	S	S	*	*			trans	-126.9	122.8	153.5	-65.9	-158	126.3	0	0	109.3
6	H	42.5	Very low	47.3	Very low	145 Å²	145	151.4 Å²	151.4	67%	0.671	82%	0.819	S	S	*	*			trans	-86.2	129.8	173.7	-104.9	-126.7	0	0	0	107.1
7	E	45.5	Very low	46.6	Very low	197 Å²	197	157.1 Å²	157.1	92%	0.921	83%	0.826	S	S	*	*			trans	-124.8	112.4	158.7	-166.4	137.5	110.4	0	0	108.7
8	S	52.9	Low	46.1	Very low	96 Å²	96	159.2 Å²	159.2	67%	0.671	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-72.3	146.6	-178.9	-73.9	0	0	0	0	111.6	S10	S8-S10 PolarHBondContact O-N 2.84Å
9	P	45.7	Very low	45.8	Very low	123 Å²	123	159.1 Å²	159.1	80%	0.799	83%	0.831	S	S	*	*	P	Polyproline II helix	trans	-81	121.3	174.3	30.3	-27.8	0	0	0	110.7	Q11	P9-Q11 PolarHBondContact O-N 3.25Å
10	S	50.8	Low	45.6	Very low	121 Å²	121	156.7 Å²	156.7	85%	0.846	83%	0.828	S	S	*	*	P	Polyproline II helix	trans	-66.3	119.9	170.8	-52.5	0	0	0	0	110.7	S8	S8-S10 PolarHBondContact O-N 2.84Å
11	Q	50.4	Low	45.7	Very low	184 Å²	184	158 Å²	158	86%	0.86	83%	0.829	S	S	*	*	P	Polyproline II helix	trans	-70	142.3	173.6	-66.2	177	-86.3	0	0	111.1	P9	P9-Q11 PolarHBondContact O-N 3.25Å
12	P	51.8	Low	45.7	Very low	110 Å²	110	155.4 Å²	155.4	71%	0.714	81%	0.811	S	S	*	*	P	Polyproline II helix	trans	-75.4	127.7	170.6	29.3	-30.9	0	0	0	110.7	M14	P12-M14 PolarHBondContact O-N 3.31Å
13	H	44.8	Very low	45.6	Very low	163 Å²	163	157.2 Å²	157.2	76%	0.755	81%	0.811	S	S	*	*			trans	-54.5	112.6	172.8	-175.5	-93.9	0	0	0	111	C15	H13-C15 PolarHBondContact O-N 2.94Å
14	M	39.5	Very low	45	Very low	161 Å²	161	150.3 Å²	150.3	79%	0.793	80%	0.8	S	S	*	*			trans	-76.8	110.6	168.3	-71.7	-76.7	96.4	0	0	108.4	P12 G16	P12-M14 PolarHBondContact O-N 3.31Å; M14-G16 PolarHBondContact O-N 2.7Å; M14-G16 VanDerWaalsContact O-N 3.07Å
15	C	46.4	Very low	45.1	Very low	109 Å²	109	148.4 Å²	148.4	74%	0.736	80%	0.803	S	S	*	*			trans	-65	107.8	169.6	-80.7	0	0	0	0	109.5	H13	H13-C15 PolarHBondContact O-N 2.94Å
16	G	35.3	Very low	44.4	Very low	73 Å²	73	144.4 Å²	144.4	75%	0.753	79%	0.794	S	S	*	*			trans	-63.7	139.8	165.7	0	0	0	0	0	110.9	M14	M14-G16 PolarHBondContact O-N 2.7Å; M14-G16 VanDerWaalsContact O-N 3.07Å
17	W	36.5	Very low	44.8	Very low	248 Å²	248	142.7 Å²	142.7	94%	0.939	80%	0.799	S	S	*	*			trans	-117.5	75.2	175.4	59.6	-52.2	0	0	0	105.9
18	E	37.3	Very low	44.8	Very low	195 Å²	195	142.4 Å²	142.4	91%	0.911	80%	0.797	S	S	*	*			trans	-105.5	112.8	161.9	-77.9	-176.3	109.4	0	0	106.8
19	D	40.9	Very low	44.9	Very low	157 Å²	157	140.4 Å²	140.4	84%	0.84	79%	0.792	S	S	*	*			trans	-140.2	101.4	144.3	-158.8	6	0	0	0	109
20	S	41	Very low	45.3	Very low	110 Å²	110	140.7 Å²	140.7	77%	0.769	79%	0.793	S	S	*	*			trans	-95	111.2	168.6	-171.1	0	0	0	0	104.9
21	Q	48.7	Very low	45.2	Very low	184 Å²	184	144.8 Å²	144.8	86%	0.86	80%	0.796	S	S	*	*			trans	-174.3	123.1	147.9	-85.8	-108.1	-38.2	0	0	110.3
22	K	43.3	Very low	45.5	Very low	194 Å²	194	142.4 Å²	142.4	84%	0.843	79%	0.794	S	S	*	*			trans	-101.7	148.5	168.9	-146.8	166.3	-172.1	177.7	0	106.7
23	P	44.7	Very low	45.7	Very low	110 Å²	110	142.5 Å²	142.5	71%	0.714	80%	0.795	S	S	*	*				-150.1	150.1	108.1	33.2	-14	0	0	0	116.9
24	S	41.8	Very low	45.9	Very low	104 Å²	104	140.3 Å²	140.3	73%	0.727	80%	0.798	S	S	*	*			trans	29.2	112.5	147.7	61.9	0	0	0	0	120.9
25	V	49.5	Very low	46.2	Very low	132 Å²	132	138.4 Å²	138.4	80%	0.8	80%	0.799	S	S	*	*			trans	-133.7	125	146.8	-179.3	0	0	0	0	108.7	S27	V25-S27 PolarHBondContact O-N 2.92Å
26	P	44	Very low	46.6	Very low	117 Å²	117	142.4 Å²	142.4	76%	0.76	80%	0.804	S	S	*	*			trans	-85.8	97.2	175.3	32.3	-27.5	0	0	0	109.1	H28	P26-H28 PolarHBondContact O-N 3.08Å
27	S	49.8	Very low	46.9	Very low	109 Å²	109	142.9 Å²	142.9	76%	0.762	81%	0.808	S	S	*	*			trans	-91.9	98.9	173.6	-176.9	0	0	0	0	110	V25 G29	V25-S27 PolarHBondContact O-N 2.92Å; S27-G29 VanDerWaalsContact C-N 3.34Å; S27-G29 PolarHBondContact O-N 2.77Å
28	H	46.5	Very low	47.6	Very low	191 Å²	191	137.5 Å²	137.5	88%	0.884	80%	0.803	S	S	*	*			trans	-60	94.5	161.7	-86.5	-82.8	0	0	0	109.4	P26	P26-H28 PolarHBondContact O-N 3.08Å
29	G	53.3	Low	48.3	Very low	54 Å²	54	137.9 Å²	137.9	56%	0.557	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-86.8	149.5	170.2	0	0	0	0	0	111.7	S27	S27-G29 VanDerWaalsContact C-N 3.34Å; S27-G29 PolarHBondContact O-N 2.77Å
30	P	54.2	Low	49	Very low	129 Å²	129	134 Å²	134	84%	0.838	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-72.6	142.5	-175.2	16.2	-6.4	0	0	0	111.5	T32	P30-T32 PolarHBondContact O-N 3.06Å
31	K	50.3	Low	49.7	Very low	207 Å²	207	134.5 Å²	134.5	90%	0.9	79%	0.792	S	S	*	*	P	Polyproline II helix	trans	-57.4	121	178.4	-70.8	175.1	175	175.3	0	111.1
32	T	56.4	Low	49.7	Very low	133 Å²	133	134.8 Å²	134.8	82%	0.816	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-71.8	137.1	167.3	21.2	0	0	0	0	110.7	P30 S34	P30-T32 PolarHBondContact O-N 3.06Å; T32-S34 PolarHBondContact O-N 2.91Å
33	P	55.9	Low	50.2	Low	112 Å²	112	130.3 Å²	130.3	73%	0.727	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-73.3	129.5	173.9	29.7	-31.3	0	0	0	110	C35	P33-C35 PolarHBondContact O-N 3.25Å; P33-C35 VanDerWaalsContact O-N 3.11Å
34	S	48.1	Very low	51	Low	117 Å²	117	130.5 Å²	130.5	82%	0.818	79%	0.79	S	S	*	*			trans	-57	109.3	174.9	-179.2	0	0	0	0	110.7	T32 K36	T32-S34 PolarHBondContact O-N 2.91Å; S34-K36 PolarHBondContact O-N 3.09Å
35	C	46.1	Very low	51.8	Low	121 Å²	121	132.5 Å²	132.5	82%	0.818	78%	0.781	S	S	*	*			trans	-75.5	108.2	173.9	-70.9	0	0	0	0	109.1	P33 G37	P33-C35 PolarHBondContact O-N 3.25Å; P33-C35 VanDerWaalsContact O-N 3.11Å; C35-G37 PolarHBondContact O-N 2.72Å
36	K	55.8	Low	52.2	Low	194 Å²	194	130.7 Å²	130.7	84%	0.843	77%	0.772	S	S	*	*	P	Polyproline II helix	trans	-58.9	132.9	170.9	-66.5	-178.7	178	-179.3	0	109.5	S34 V38	S34-K36 PolarHBondContact O-N 3.09Å; K36-V38 PolarHBondContact O-N 2.9Å
37	G	40.3	Very low	53.1	Low	82 Å²	82	135.8 Å²	135.8	85%	0.845	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-55.1	119.4	-168.9	0	0	0	0	0	114.2	C35	C35-G37 PolarHBondContact O-N 2.72Å
38	V	52.3	Low	53.7	Low	136 Å²	136	133.4 Å²	133.4	82%	0.824	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-91.2	116.3	164	178.4	0	0	0	0	106.8	K36 A40	K36-V38 PolarHBondContact O-N 2.9Å; V38-A40 PolarHBondContact O-N 3.07Å; V38-A40 VanDerWaalsContact O-N 3.13Å
39	K	51.5	Low	53.9	Low	202 Å²	202	129 Å²	129	88%	0.878	74%	0.739	S	S	*	*			trans	-59.2	115.2	172.4	-75.6	-164	173.6	-170.6	0	108.7
40	A	54.8	Low	54.3	Low	76 Å²	76	132.8 Å²	132.8	63%	0.628	74%	0.74	S	S	*	*			trans	-64.7	133.7	173.6	0	0	0	0	0	109.5	V38 H42	V38-A40 PolarHBondContact O-N 3.07Å; V38-A40 VanDerWaalsContact O-N 3.13Å; A40-H42 PolarHBondContact O-N 3.49Å
41	P	57.1	Low	54.8	Low	120 Å²	120	132.7 Å²	132.7	78%	0.779	73%	0.729	S	S	*	*			trans	-65.1	127.5	171.5	27.1	-30.3	0	0	0	107.9	S43	P41-S43 VanDerWaalsContact C-N 3.33Å; P41-S43 PolarHBondContact O-N 3.05Å
42	H	48.5	Very low	55.4	Low	191 Å²	191	128.2 Å²	128.2	88%	0.884	72%	0.715	S	S	*	*			trans	-60.4	94.9	174.7	-59.2	-75.7	0	0	0	108.9	A40 S44	A40-H42 PolarHBondContact O-N 3.49Å; H42-S44 PolarHBondContact O-N 3.38Å; H42-S44 VanDerWaalsContact O-N 3.13Å
43	S	54.2	Low	55.6	Low	100 Å²	100	125.9 Å²	125.9	70%	0.699	70%	0.696	S	S	*	*			trans	-73.5	104.5	173	64.9	0	0	0	0	108	P41 R45	P41-S43 VanDerWaalsContact C-N 3.33Å; P41-S43 PolarHBondContact O-N 3.05Å; S43-R45 PolarHBondContact O-N 3.28Å
44	S	61.4	Low	55.9	Low	114 Å²	114	126.6 Å²	126.6	80%	0.797	69%	0.69	S	S	*	*			trans	-60.3	93.5	157.8	44.1	0	0	0	0	107.3	H42	H42-S44 PolarHBondContact O-N 3.38Å; H42-S44 VanDerWaalsContact O-N 3.13Å
45	R	58.4	Low	56.6	Low	145 Å²	145	127.1 Å²	127.1	55%	0.547	68%	0.68	S	S	.	*			trans	-53.5	126.3	176.8	-120.1	-179.3	174.4	-170.3	1.3	108.1	S43 R47 L124	S43-R45 PolarHBondContact O-N 3.28Å; R45-R47 PolarHBondContact O-N 3.06Å; R45-L124 PolarHBondContact NH2-O 3.46Å
46	P	57.4	Low	57.6	Low	94 Å²	94	125.1 Å²	125.1	61%	0.61	67%	0.667	S	S	*	*			trans	-67.9	121.9	-179.9	25.3	-29.7	0	0	0	108.2	A48	P46-A48 PolarHBondContact O-N 2.95Å
47	R	62.3	Low	58.1	Low	225 Å²	225	119.9 Å²	119.9	85%	0.849	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61	-14.1	178.5	-128.1	179.8	-74.7	-115.5	2.2	113.1	R45 W49 K50	R45-R47 PolarHBondContact O-N 3.06Å; R47-W49 PolarHBondContact O-N 3.07Å; R47-K50 PolarHBondContact O-N 3.07Å
48	A	62.4	Low	59.1	Low	59 Å²	59	119.3 Å²	119.3	49%	0.488	64%	0.635	S	S	.	*	H	α-helix	trans	-61.9	-35.1	-173.3	0	0	0	0	0	114.5	P46 K50 Q51 D52	P46-A48 PolarHBondContact O-N 2.95Å; A48-K50 VanDerWaalsContact C-N 3.26Å; A48-K50 PolarHBondContact O-N 3.03Å; A48-Q51 PolarHBondContact O-N 2.96Å; A48-Q51 VanDerWaalsContact O-N 3.11Å; A48-D52 PolarHBondContact O-N 2.94Å; A48-D52 VanDerWaalsContact O-N 3.13Å
49	W	51.2	Low	60	Low	97 Å²	97	116.7 Å²	116.7	37%	0.367	63%	0.627	S	S	.	*	H	α-helix	trans	-65.6	-28	-175.7	76.3	-89.7	0	0	0	113.5	R47 L53 W125	R47-W49 PolarHBondContact O-N 3.07Å; W49-L53 WeakPolarHBondContact O-CB 3.14Å; W49-L53 PolarHBondContact O-N 2.97Å; W49-L53 VanDerWaalsContact O-N 3.14Å; W49-W125 HydrophobicContact CH2-CZ3 4.04Å; W49-W125 HydrophobicContact CZ3-CZ3 4.19Å
50	K	61.5	Low	60.8	Low	135 Å²	135	110.7 Å²	110.7	59%	0.587	62%	0.615	S	S	*	*	H	α-helix	trans	-70.1	-37.4	175.5	-77.4	-159.9	170.5	-151.5	0	111.9	R47 A48 E54	R47-K50 PolarHBondContact O-N 3.07Å; A48-K50 VanDerWaalsContact C-N 3.26Å; A48-K50 PolarHBondContact O-N 3.03Å; K50-E54 WeakPolarHBondContact O-CG 3.24Å; K50-E54 PolarHBondContact O-N 3.26Å; K50-E54 VanDerWaalsContact O-N 3.15Å
51	Q	66.1	Low	61.1	Low	127 Å²	127	115.6 Å²	115.6	59%	0.593	62%	0.619	S	S	*	*	H	α-helix	trans	-70.1	-38.1	178.5	-69.7	176.6	-39.1	0	0	111.2	A48 Q55	A48-Q51 PolarHBondContact O-N 2.96Å; A48-Q51 VanDerWaalsContact O-N 3.11Å; Q51-Q55 WeakPolarHBondContact O-CB 3.48Å; Q51-Q55 VanDerWaalsContact O-CG 3.3Å; Q51-Q55 WeakPolarHBondContact O-CG 3.38Å; Q51-Q55 PolarHBondContact O-N 2.8Å
52	D	61.8	Low	61.8	Low	113 Å²	113	115.5 Å²	115.5	60%	0.604	62%	0.616	S	S	*	*	H	α-helix	trans	-65.3	-39.7	176.7	-165.2	64.9	0	0	0	112	A48 Q55 S56	A48-D52 PolarHBondContact O-N 2.94Å; A48-D52 VanDerWaalsContact O-N 3.13Å; D52-Q55 PolarHBondContact O-N 3.44Å; D52-S56 VanDerWaalsContact O-CB 3.26Å; D52-S56 WeakPolarHBondContact O-CB 3.07Å; D52-S56 PolarHBondContact O-N 3.14Å
53	L	59.9	Low	62.6	Low	83 Å²	83	111.8 Å²	111.8	44%	0.435	61%	0.609	S	S	.	*	H	α-helix	trans	-68.2	-43	177.3	-165.3	126.8	0	0	0	112.7	W49 S56 L57	W49-L53 WeakPolarHBondContact O-CB 3.14Å; W49-L53 PolarHBondContact O-N 2.97Å; W49-L53 VanDerWaalsContact O-N 3.14Å; L53-S56 PolarHBondContact O-N 3.26Å; L53-L57 HydrophobicContact CD2-CD1 3.99Å; L53-L57 WeakPolarHBondContact O-CG 3.45Å; L53-L57 PolarHBondContact O-N 2.83Å
54	E	63.8	Low	63.4	Low	128 Å²	128	112.8 Å²	112.8	60%	0.598	61%	0.611	S	S	*	*	H	α-helix	trans	-64.9	-40.8	174.4	-71	-68.6	129.8	0	0	111.4	K50 L57 A58	K50-E54 WeakPolarHBondContact O-CG 3.24Å; K50-E54 PolarHBondContact O-N 3.26Å; K50-E54 VanDerWaalsContact O-N 3.15Å; E54-L57 PolarHBondContact O-N 3.42Å; E54-A58 VanDerWaalsContact O-CB 3.24Å; E54-A58 WeakPolarHBondContact O-CB 3.06Å; E54-A58 PolarHBondContact O-N 3.05Å
55	Q	62.9	Low	63.7	Low	128 Å²	128	113.6 Å²	113.6	60%	0.598	61%	0.61	S	S	*	*	H	α-helix	trans	-64.4	-40.1	173.5	-79.1	174	38.3	0	0	111.9	Q51 D52 A58 A59	Q51-Q55 WeakPolarHBondContact O-CB 3.48Å; Q51-Q55 VanDerWaalsContact O-CG 3.3Å; Q51-Q55 WeakPolarHBondContact O-CG 3.38Å; Q51-Q55 PolarHBondContact O-N 2.8Å; D52-Q55 PolarHBondContact O-N 3.44Å; Q55-A58 PolarHBondContact O-N 3.19Å; Q55-A59 WeakPolarHBondContact O-CB 3.43Å; Q55-A59 PolarHBondContact O-N 2.88Å
56	S	67.1	Low	64.3	Low	79 Å²	79	111.4 Å²	111.4	55%	0.552	61%	0.613	S	S	*	*	H	α-helix	trans	-66.3	-38.6	178.2	-177.7	0	0	0	0	111.9	D52 L53 A60	D52-S56 VanDerWaalsContact O-CB 3.26Å; D52-S56 WeakPolarHBondContact O-CB 3.07Å; D52-S56 PolarHBondContact O-N 3.14Å; L53-S56 PolarHBondContact O-N 3.26Å; S56-A60 WeakPolarHBondContact O-CB 3.4Å; S56-A60 PolarHBondContact O-N 3.01Å; S56-A60 VanDerWaalsContact O-N 3.14Å
57	L	64.7	Low	64.7	Low	84 Å²	84	112.2 Å²	112.2	44%	0.44	61%	0.612	S	S	.	*	H	α-helix	trans	-69.5	-49.8	174	-75.6	169.6	0	0	0	110.6	L53 E54 A59 A60 Y61	L53-L57 HydrophobicContact CD2-CD1 3.99Å; L53-L57 WeakPolarHBondContact O-CG 3.45Å; L53-L57 PolarHBondContact O-N 2.83Å; E54-L57 PolarHBondContact O-N 3.42Å; L57-A59 PolarHBondContact O-N 3.11Å; L57-A60 WeakPolarHBondContact O-CA 3.23Å; L57-A60 WeakPolarHBondContact O-CB 3.2Å; L57-A60 PolarHBondContact O-N 3.45Å; L57-Y61 VanDerWaalsContact O-CD2 3.22Å; L57-Y61 WeakPolarHBondContact O-CD2 3.35Å; L57-Y61 PolarHBondContact O-N 2.95Å
58	A	62.7	Low	64.7	Low	69 Å²	69	105 Å²	105	57%	0.57	60%	0.596	S	S	*	*	H	α-helix	trans	-58.3	-35.9	178	0	0	0	0	0	112.5	E54 Q55 Y61	E54-A58 VanDerWaalsContact O-CB 3.24Å; E54-A58 WeakPolarHBondContact O-CB 3.06Å; E54-A58 PolarHBondContact O-N 3.05Å; Q55-A58 PolarHBondContact O-N 3.19Å; A58-Y61 PolarHBondContact O-N 2.86Å
59	A	69.4	Low	64.8	Low	81 Å²	81	110.6 Å²	110.6	67%	0.669	61%	0.609	S	S	*	*	H	α-helix	trans	-71.4	-29.1	174.6	0	0	0	0	0	113.3	Q55 L57	Q55-A59 WeakPolarHBondContact O-CB 3.43Å; Q55-A59 PolarHBondContact O-N 2.88Å; L57-A59 PolarHBondContact O-N 3.11Å
60	A	68.3	Low	65.3	Low	76 Å²	76	109.7 Å²	109.7	63%	0.628	63%	0.63	S	S	*	*	H	α-helix	trans	-76.9	-23.6	175.1	0	0	0	0	0	112.6	S56 L57 V62	S56-A60 WeakPolarHBondContact O-CB 3.4Å; S56-A60 PolarHBondContact O-N 3.01Å; S56-A60 VanDerWaalsContact O-N 3.14Å; L57-A60 WeakPolarHBondContact O-CA 3.23Å; L57-A60 WeakPolarHBondContact O-CB 3.2Å; L57-A60 PolarHBondContact O-N 3.45Å; A60-V62 PolarHBondContact O-N 2.86Å
61	Y	62.4	Low	65.3	Low	180 Å²	180	109.2 Å²	109.2	71%	0.706	63%	0.63	S	S	*	*			trans	-88.4	100.5	174.8	-79.6	-79.8	0	0	0	110.8	L57 A58 P63	L57-Y61 VanDerWaalsContact O-CD2 3.22Å; L57-Y61 WeakPolarHBondContact O-CD2 3.35Å; L57-Y61 PolarHBondContact O-N 2.95Å; A58-Y61 PolarHBondContact O-N 2.86Å; Y61-P63 VanDerWaalsContact O-CD 3.23Å; Y61-P63 WeakPolarHBondContact O-CD 3.49Å
62	V	71.3	Confident	65	Low	117 Å²	117	107.1 Å²	107.1	71%	0.709	62%	0.622	S	S	*	*			trans	-83.9	110.2	167.2	-178.6	0	0	0	0	108.3	A60 V64	A60-V62 PolarHBondContact O-N 2.86Å; V62-V64 PolarHBondContact O-N 3.44Å
63	P	66	Low	65	Low	114 Å²	114	106.1 Å²	106.1	74%	0.74	62%	0.622	S	S	*	*			trans	-68.5	108.3	175.1	27.5	-32.1	0	0	0	108.9	Y61 V65	Y61-P63 VanDerWaalsContact O-CD 3.23Å; Y61-P63 WeakPolarHBondContact O-CD 3.49Å; P63-V65 PolarHBondContact O-N 3.33Å
64	V	69.7	Low	65.1	Low	121 Å²	121	108.7 Å²	108.7	73%	0.733	64%	0.637	S	S	*	*			trans	-82.2	101.5	172.7	179.4	0	0	0	0	107.8	V62 V66	V62-V64 PolarHBondContact O-N 3.44Å; V64-V66 HydrophobicContact CG1-CG2 4.26Å; V64-V66 PolarHBondContact O-N 2.8Å
65	V	69.4	Low	64.6	Low	130 Å²	130	110 Å²	110	79%	0.788	64%	0.64	S	S	*	*			trans	-83.4	110.7	167.6	-179.4	0	0	0	0	107.6	P63 D67	P63-V65 PolarHBondContact O-N 3.33Å; V65-D67 PolarHBondContact O-N 3.44Å
66	V	69.9	Low	64.4	Low	100 Å²	100	108.7 Å²	108.7	61%	0.606	64%	0.637	S	S	*	*			trans	-79	105.2	169	179.1	0	0	0	0	107.2	V64 S68	V64-V66 HydrophobicContact CG1-CG2 4.26Å; V64-V66 PolarHBondContact O-N 2.8Å; V66-S68 PolarHBondContact O-N 2.92Å; V66-S68 VanDerWaalsContact O-N 3.08Å
67	D	66.3	Low	63.9	Low	111 Å²	111	114.8 Å²	114.8	59%	0.594	65%	0.648	S	S	*	*			trans	-64.8	106.8	166.4	176.7	9.9	0	0	0	107.6	V65 K69	V65-D67 PolarHBondContact O-N 3.44Å; D67-K69 VanDerWaalsContact CG-CG 3.46Å; D67-K69 PolarHBondContact O-N 3.13Å; D67-K69 WeakPolarHBondContact OD1-CG 3.31Å; D67-K69 PolarHBondContact OD1-N 2.93Å; D67-K69 VanDerWaalsContact OD2-CE 3.24Å; D67-K69 WeakPolarHBondContact OD2-CE 3.45Å; D67-K69 WeakPolarHBondContact OD2-CG 3.16Å
68	S	62.9	Low	63.6	Low	72 Å²	72	118.1 Å²	118.1	50%	0.503	66%	0.659	S	S	.	*			trans	-69.4	-13.2	-178.6	56.6	0	0	0	0	112.1	V66 G70 Q71	V66-S68 PolarHBondContact O-N 2.92Å; V66-S68 VanDerWaalsContact O-N 3.08Å; S68-G70 PolarHBondContact O-N 3.07Å; S68-Q71 WeakPolarHBondContact O-CB 3.44Å; S68-Q71 PolarHBondContact O-N 3.21Å
69	K	63.9	Low	63.1	Low	178 Å²	178	120.8 Å²	120.8	77%	0.774	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	38.1	33.7	-176.5	-70.1	-157.9	174	-172.7	0	114.6	D67	D67-K69 VanDerWaalsContact CG-CG 3.46Å; D67-K69 PolarHBondContact O-N 3.13Å; D67-K69 WeakPolarHBondContact OD1-CG 3.31Å; D67-K69 PolarHBondContact OD1-N 2.93Å; D67-K69 VanDerWaalsContact OD2-CE 3.24Å; D67-K69 WeakPolarHBondContact OD2-CE 3.45Å; D67-K69 WeakPolarHBondContact OD2-CG 3.16Å
70	G	61.8	Low	62.3	Low	77 Å²	77	124.7 Å²	124.7	79%	0.794	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	76.6	9.9	-176.6	0	0	0	0	0	116.4	S68	S68-G70 PolarHBondContact O-N 3.07Å
71	Q	60.2	Low	61.1	Low	126 Å²	126	129 Å²	129	59%	0.589	67%	0.667	S	S	*	*			trans	-73.1	128.6	165.3	-76.8	-139.2	17.5	0	0	110.8	S68	S68-Q71 WeakPolarHBondContact O-CB 3.44Å; S68-Q71 PolarHBondContact O-N 3.21Å
72	N	59.9	Low	60.5	Low	82 Å²	82	123.6 Å²	123.6	44%	0.439	65%	0.653	S	S	.	*			trans	-56.9	129.3	175.2	179.3	-33	0	0	0	109.8	D74 K75	N72-D74 PolarHBondContact ND2-OD2 2.98Å; N72-D74 PolarHBondContact O-N 3.43Å; N72-D74 VanDerWaalsContact O-N 3.09Å; N72-D74 WeakPolarHBondContact OD1-CA 3.26Å; N72-D74 WeakPolarHBondContact OD1-CB 3.22Å; N72-D74 PolarHBondContact OD1-N 3.31Å; N72-D74 PolarHBondContact OD1-OD2 2.96Å; N72-K75 WeakPolarHBondContact O-CB 3.3Å; N72-K75 PolarHBondContact O-N 3.18Å
73	P	61.8	Low	59.8	Low	93 Å²	93	124.3 Å²	124.3	60%	0.604	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-58.2	-20.5	178.2	25.8	-35.4	0	0	0	113.8	K75 L76	P73-K75 PolarHBondContact O-N 3.31Å; P73-L76 HydrophobicContact CB-CD1 4.43Å; P73-L76 WeakPolarHBondContact O-CB 3.33Å; P73-L76 PolarHBondContact O-N 3.14Å
74	D	61.8	Low	59.5	Low	137 Å²	137	127.1 Å²	127.1	73%	0.733	67%	0.666	S	S	*	*	G	3₁₀ helix	trans	-65.9	-17.1	172.9	-52.1	-30.7	0	0	0	112.6	N72	N72-D74 PolarHBondContact ND2-OD2 2.98Å; N72-D74 PolarHBondContact O-N 3.43Å; N72-D74 VanDerWaalsContact O-N 3.09Å; N72-D74 WeakPolarHBondContact OD1-CA 3.26Å; N72-D74 WeakPolarHBondContact OD1-CB 3.22Å; N72-D74 PolarHBondContact OD1-N 3.31Å; N72-D74 PolarHBondContact OD1-OD2 2.96Å
75	K	53.8	Low	58.6	Low	154 Å²	154	129.3 Å²	129.3	67%	0.67	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-89.6	-1.1	172.5	-79.8	-176.5	177.2	177.9	0	113.9	N72 P73 R77	N72-K75 WeakPolarHBondContact O-CB 3.3Å; N72-K75 PolarHBondContact O-N 3.18Å; P73-K75 PolarHBondContact O-N 3.31Å; K75-R77 PolarHBondContact O-N 3.15Å
76	L	59.9	Low	57.6	Low	102 Å²	102	127.3 Å²	127.3	53%	0.534	65%	0.654	S	S	.	*			trans	-68.6	80.9	164	-81.3	146.9	0	0	0	108.3	P73 F78	P73-L76 HydrophobicContact CB-CD1 4.43Å; P73-L76 WeakPolarHBondContact O-CB 3.33Å; P73-L76 PolarHBondContact O-N 3.14Å; L76-F78 VanDerWaalsContact C-N 3.32Å; L76-F78 PolarHBondContact O-N 3.06Å
77	R	55.6	Low	56.5	Low	207 Å²	207	124.5 Å²	124.5	78%	0.781	64%	0.636	S	S	*	*			trans	-66	99.8	164.8	-80.7	-179.8	65.1	-166.4	-0.7	106.7	K75 N79	K75-R77 PolarHBondContact O-N 3.15Å; R77-N79 VanDerWaalsContact C-N 3.32Å; R77-N79 PolarHBondContact O-N 3.4Å
78	F	58.1	Low	56	Low	154 Å²	154	124.5 Å²	124.5	68%	0.675	65%	0.645	S	S	*	*			trans	-55.1	105.8	155.9	-60.9	-79.9	0	0	0	106.1	L76 F80	L76-F78 VanDerWaalsContact C-N 3.32Å; L76-F78 PolarHBondContact O-N 3.06Å; F78-F80 HydrophobicContact CB-CD2 4.08Å; F78-F80 HydrophobicContact CB-CE1 4.21Å; F78-F80 HydrophobicContact CB-CE2 3.58Å; F78-F80 HydrophobicContact CB-CZ 3.65Å; F78-F80 HydrophobicContact CG-CZ 4.29Å; F78-F80 WeakPolarHBondContact O-CD2 3.24Å; F78-F80 PolarHBondContact O-N 3.11Å
79	N	52.5	Low	55.6	Low	124 Å²	124	128.4 Å²	128.4	66%	0.663	66%	0.659	S	S	*	*			trans	-71.3	82.7	171.9	-69.9	-39.5	0	0	0	106.3	R77	R77-N79 VanDerWaalsContact C-N 3.32Å; R77-N79 PolarHBondContact O-N 3.4Å
80	F	52.2	Low	55.1	Low	163 Å²	163	121.5 Å²	121.5	72%	0.715	63%	0.631	S	S	*	*			trans	-59.7	148.1	168.4	-63.6	-74.7	0	0	0	108.6	F78 T82	F78-F80 HydrophobicContact CB-CD2 4.08Å; F78-F80 HydrophobicContact CB-CE1 4.21Å; F78-F80 HydrophobicContact CB-CE2 3.58Å; F78-F80 HydrophobicContact CB-CZ 3.65Å; F78-F80 HydrophobicContact CG-CZ 4.29Å; F78-F80 WeakPolarHBondContact O-CD2 3.24Å; F78-F80 PolarHBondContact O-N 3.11Å; F80-T82 PolarHBondContact O-N 3.49Å; F80-T82 VanDerWaalsContact O-N 3.07Å
81	Y	44.2	Very low	54.8	Low	167 Å²	167	122.7 Å²	122.7	66%	0.655	62%	0.624	S	S	*	*			trans	-38	112.7	-178.1	-74	-92.2	0	0	0	112.8	N87 N90	Y81-N87 HydrophobicContact CE1-CB 4.1Å; Y81-N87 VanDerWaalsContact CE1-ND2 3.31Å; Y81-N87 WeakPolarHBondContact CE1-ND2 3.49Å; Y81-N87 PolarHBondContact OH-ND2 3.28Å; Y81-N90 PolarHBondContact OH-OD1 3.24Å; Y81-N90 VanDerWaalsContact OH-OD1 3.11Å
82	T	49.5	Very low	54.7	Low	66 Å²	66	123.1 Å²	123.1	41%	0.405	62%	0.624	S	S	.	*			trans	-111.7	144.8	158.3	77.2	0	0	0	0	107.1	F80 Q84 Y85	F80-T82 PolarHBondContact O-N 3.49Å; F80-T82 VanDerWaalsContact O-N 3.07Å; T82-Q84 PolarHBondContact O-N 3.14Å; T82-Y85 HydrophobicContact CG2-CD2 4.47Å; T82-Y85 PolarHBondContact O-N 3.37Å; T82-Y85 WeakPolarHBondContact OG1-CD2 3.25Å
83	S	56	Low	54.3	Low	133 Å²	133	125.7 Å²	125.7	93%	0.93	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.7	-13.8	179.6	53.5	0	0	0	0	114
84	Q	60.9	Low	54	Low	172 Å²	172	124.4 Å²	124.4	80%	0.804	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.5	-13.1	-179.7	-59.2	-166.5	-9.4	0	0	113.9	T82	T82-Q84 PolarHBondContact O-N 3.14Å
85	Y	49.6	Very low	54.1	Low	168 Å²	168	125.6 Å²	125.6	66%	0.659	63%	0.625	S	S	*	*	S	Bend	trans	-109.4	114.1	176.8	-68.1	-64.9	0	0	0	110.6	T82 N87	T82-Y85 HydrophobicContact CG2-CD2 4.47Å; T82-Y85 PolarHBondContact O-N 3.37Å; T82-Y85 WeakPolarHBondContact OG1-CD2 3.25Å; Y85-N87 PolarHBondContact O-N 3.39Å
86	S	49.8	Very low	54.5	Low	88 Å²	88	125.4 Å²	125.4	62%	0.615	63%	0.627	S	S	*	*			trans	-64.7	123.6	171	-176.7	0	0	0	0	109.5	S88	S86-S88 PolarHBondContact O-N 3.19Å
87	N	46.9	Very low	54.5	Low	40 Å²	40	126.7 Å²	126.7	21%	0.214	63%	0.628	C	S	.	*			trans	-74.5	97.4	-179.9	-178.1	-19.6	0	0	0	110.3	Y81 Y85 L89 N90	Y81-N87 HydrophobicContact CE1-CB 4.1Å; Y81-N87 VanDerWaalsContact CE1-ND2 3.31Å; Y81-N87 WeakPolarHBondContact CE1-ND2 3.49Å; Y81-N87 PolarHBondContact OH-ND2 3.28Å; Y85-N87 PolarHBondContact O-N 3.39Å; N87-L89 PolarHBondContact OD1-N 3.3Å; N87-L89 PolarHBondContact OD1-O 3.42Å; N87-N90 PolarHBondContact ND2-ND2 2.72Å; N87-N90 VanDerWaalsContact ND2-ND2 3.19Å; N87-N90 PolarHBondContact ND2-OD1 3.47Å; N87-N90 PolarHBondContact OD1-N 3.05Å
88	S	55.8	Low	54.8	Low	112 Å²	112	119.1 Å²	119.1	78%	0.783	61%	0.605	S	S	*	*	S	Bend	trans	-88	0.9	173.4	65.4	0	0	0	0	114.1	S86	S86-S88 PolarHBondContact O-N 3.19Å
89	L	54.2	Low	54.9	Low	153 Å²	153	113.5 Å²	113.5	80%	0.801	58%	0.584	S	S	*	*			trans	-129.9	70.4	-178.3	-67.6	174.3	0	0	0	108.8	N87 P91	N87-L89 PolarHBondContact OD1-N 3.3Å; N87-L89 PolarHBondContact OD1-O 3.42Å; L89-P91 WeakPolarHBondContact O-CD 3.48Å
90	N	53.8	Low	55.3	Low	34 Å²	34	109.9 Å²	109.9	18%	0.182	57%	0.567	C	S	.	*			trans	-105.3	106.6	-173.3	-121.5	-31.2	0	0	0	110.3	Y81 N87 F92	Y81-N90 PolarHBondContact OH-OD1 3.24Å; Y81-N90 VanDerWaalsContact OH-OD1 3.11Å; N87-N90 PolarHBondContact ND2-ND2 2.72Å; N87-N90 VanDerWaalsContact ND2-ND2 3.19Å; N87-N90 PolarHBondContact ND2-OD1 3.47Å; N87-N90 PolarHBondContact OD1-N 3.05Å; N90-F92 PolarHBondContact O-N 3.01Å
91	P	55.4	Low	56	Low	101 Å²	101	103.4 Å²	103.4	66%	0.656	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.6	6.3	-175	27.2	-30.8	0	0	0	114.3	L89	L89-P91 WeakPolarHBondContact O-CD 3.48Å
92	F	57.2	Low	56.6	Low	135 Å²	135	102.6 Å²	102.6	59%	0.592	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-127.5	0.2	-172.1	-54.1	-63.7	0	0	0	115.6	N90 T94 C100	N90-F92 PolarHBondContact O-N 3.01Å; F92-T94 PolarHBondContact O-N 2.67Å; F92-C100 PolarHBondContact O-SG 2.81Å
93	Y	51	Low	57.4	Low	136 Å²	136	103.6 Å²	103.6	53%	0.533	55%	0.546	S	S	.	.			trans	-78.9	103.7	171.7	-174.1	-101.6	0	0	0	109.4	L103	Y93-L103 HydrophobicContact CE2-CD1 4.29Å
94	T	57.1	Low	57.9	Low	67 Å²	67	103.5 Å²	103.5	41%	0.411	53%	0.527	S	S	.	.	B	Isolated β-bridge	trans	-120.4	146.2	172.8	62.4	0	0	0	0	108.9	F92 Q96 K97	F92-T94 PolarHBondContact O-N 2.67Å; T94-Q96 PolarHBondContact O-N 2.83Å; T94-K97 CarbonylContact O-C 3.34Å; T94-K97 PolarHBondContact O-N 3.18Å; T94-K97 PolarHBondContact OG1-N 3.03Å
95	L	62.9	Low	58.4	Low	161 Å²	161	102.8 Å²	102.8	84%	0.843	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.3	-25.6	171.8	-85.3	146.7	0	0	0	112.7
96	Q	61.5	Low	59.5	Low	151 Å²	151	105.5 Å²	105.5	71%	0.706	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.3	-24.6	-178.4	-160	173.2	-18.2	0	0	113.9	T94	T94-Q96 PolarHBondContact O-N 2.83Å
97	K	61.5	Low	60.8	Low	129 Å²	129	107.6 Å²	107.6	56%	0.561	53%	0.53	S	S	*	.	B	Isolated β-bridge	trans	-133.8	76.2	178.7	-67.6	-173.6	176.3	-179.7	0	110.8	T94 T99 C100	T94-K97 CarbonylContact O-C 3.34Å; T94-K97 PolarHBondContact O-N 3.18Å; T94-K97 PolarHBondContact OG1-N 3.03Å; K97-T99 PolarHBondContact O-N 3.47Å; K97-C100 WeakPolarHBondContact CB-SG 3.37Å; K97-C100 PolarHBondContact O-N 2.77Å; K97-C100 PolarHBondContact O-SG 3.21Å
98	P	60.3	Low	61.8	Low	47 Å²	47	107.7 Å²	107.7	31%	0.305	53%	0.532	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.5	-8	-179.7	29.1	-35.8	0	0	0	113.4
99	T	60.9	Low	62.6	Low	36 Å²	36	107.5 Å²	107.5	22%	0.221	52%	0.522	C	S	.	.	T	Hydrogen-bonded Turn	trans	-99	-10.2	-174.4	57.8	0	0	0	0	114	K97 T108	K97-T99 PolarHBondContact O-N 3.47Å; T99-T108 HydrophobicContact CG2-CG2 3.65Å
100	C	59.8	Low	63.3	Low	48 Å²	48	104.7 Å²	104.7	32%	0.324	51%	0.505	S	S	.	.	S	Bend	trans	-103	109.1	174.5	63.6	0	0	0	0	110.5	F92 K97	F92-C100 PolarHBondContact O-SG 2.81Å; K97-C100 WeakPolarHBondContact CB-SG 3.37Å; K97-C100 PolarHBondContact O-N 2.77Å; K97-C100 PolarHBondContact O-SG 3.21Å
101	G	67.5	Low	64	Low	28 Å²	28	107.5 Å²	107.5	29%	0.289	52%	0.523	S	S	.	.	S	Bend	trans	137.2	-150.8	176.5	0	0	0	0	0	113.4	L103 Y104	G101-L103 PolarHBondContact O-N 2.73Å; G101-Y104 VanDerWaalsContact O-CB 3.25Å; G101-Y104 WeakPolarHBondContact O-CB 2.9Å; G101-Y104 PolarHBondContact O-N 2.81Å
102	Y	57.9	Low	64.5	Low	149 Å²	149	113 Å²	113	58%	0.584	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54	-27.9	-173.9	-175.7	-106.3	0	0	0	115.1
103	L	65.1	Low	65	Low	88 Å²	88	113.5 Å²	113.5	46%	0.461	53%	0.533	S	S	.	.	T	Hydrogen-bonded Turn	trans	-94.8	12.7	179.6	-59.2	177.8	0	0	0	113.4	Y93 G101 R105	Y93-L103 HydrophobicContact CE2-CD1 4.29Å; G101-L103 PolarHBondContact O-N 2.73Å; L103-R105 PolarHBondContact O-N 3.4Å
104	Y	66.9	Low	65.7	Low	131 Å²	131	117.6 Å²	117.6	51%	0.514	55%	0.547	S	S	.	.			trans	-59.8	123.3	174.9	175.9	-99.5	0	0	0	110	G101 R106 H110	G101-Y104 VanDerWaalsContact O-CB 3.25Å; G101-Y104 WeakPolarHBondContact O-CB 2.9Å; G101-Y104 PolarHBondContact O-N 2.81Å; Y104-R106 HydrophobicContact CE1-CG 4.27Å; Y104-H110 AromaticContact CD2-NE2 3.8Å; Y104-H110 AromaticContact CE2-CE1 3.91Å; Y104-H110 AromaticContact CE2-NE2 3.47Å; Y104-H110 WeakPolarHBondContact CE2-NE2 3.26Å
105	R	71.4	Confident	66.1	Low	156 Å²	156	119.2 Å²	119.2	59%	0.589	55%	0.549	S	S	*	.			trans	-132.5	146.9	167.1	-39.2	-174.1	-175.4	-148.6	-0.4	108.5	L103 D107 T108	L103-R105 PolarHBondContact O-N 3.4Å; R105-D107 WeakPolarHBondContact CB-OD1 3.28Å; R105-D107 PolarHBondContact O-N 3.13Å; R105-T108 VanDerWaalsContact CB-OG1 3.32Å; R105-T108 WeakPolarHBondContact CB-OG1 3.32Å; R105-T108 PolarHBondContact N-OG1 3.48Å; R105-T108 VanDerWaalsContact O-CB 3.28Å; R105-T108 WeakPolarHBondContact O-CB 3.47Å; R105-T108 PolarHBondContact O-N 2.81Å; R105-T108 VanDerWaalsContact O-N 3.14Å; R105-T108 PolarHBondContact O-OG1 3.05Å
106	R	73.3	Confident	66.6	Low	225 Å²	225	119.3 Å²	119.3	85%	0.849	55%	0.55	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	-27.5	-179.5	-78.7	-175.2	177.5	158	-0.8	112.6	Y104	Y104-R106 HydrophobicContact CE1-CG 4.27Å
107	D	76.1	Confident	67.1	Low	133 Å²	133	117.1 Å²	117.1	71%	0.711	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84	-8.2	175.5	60.5	-40.9	0	0	0	113.1	R105 D109	R105-D107 WeakPolarHBondContact CB-OD1 3.28Å; R105-D107 PolarHBondContact O-N 3.13Å; D107-D109 PolarHBondContact O-N 2.86Å
108	T	68.6	Low	67.9	Low	41 Å²	41	115.9 Å²	115.9	25%	0.252	55%	0.552	S	S	.	*	S	Bend	trans	-63.6	131.7	175.6	-60.1	0	0	0	0	109.3	T99 R105 H110	T99-T108 HydrophobicContact CG2-CG2 3.65Å; R105-T108 VanDerWaalsContact CB-OG1 3.32Å; R105-T108 WeakPolarHBondContact CB-OG1 3.32Å; R105-T108 PolarHBondContact N-OG1 3.48Å; R105-T108 VanDerWaalsContact O-CB 3.28Å; R105-T108 WeakPolarHBondContact O-CB 3.47Å; R105-T108 PolarHBondContact O-N 2.81Å; R105-T108 VanDerWaalsContact O-N 3.14Å; R105-T108 PolarHBondContact O-OG1 3.05Å; T108-H110 PolarHBondContact O-CE1 3.23Å; T108-H110 VanDerWaalsContact O-CE1 3.3Å; T108-H110 PolarHBondContact O-N 2.96Å; T108-H110 PolarHBondContact O-ND1 3.19Å
109	D	72.6	Confident	68.6	Low	108 Å²	108	119.6 Å²	119.6	58%	0.578	58%	0.576	S	S	*	*			trans	-69.2	113.8	172	-175.7	8.6	0	0	0	110	D107 T111	D107-D109 PolarHBondContact O-N 2.86Å; D109-T111 VanDerWaalsContact C-N 3.31Å; D109-T111 VanDerWaalsContact OD1-CB 3.26Å; D109-T111 WeakPolarHBondContact OD1-CB 3.4Å; D109-T111 WeakPolarHBondContact OD1-CG2 3.02Å; D109-T111 PolarHBondContact OD1-N 3.27Å; D109-T111 PolarHBondContact OD1-OG1 3.13Å; D109-T111 PolarHBondContact OD2-OG1 3.38Å
110	H	68.2	Low	69.6	Low	94 Å²	94	121.5 Å²	121.5	44%	0.435	60%	0.596	S	S	.	*			trans	-91.1	5.9	177.1	-65.9	59.5	0	0	0	112.1	Y104 T108 R112	Y104-H110 AromaticContact CD2-NE2 3.8Å; Y104-H110 AromaticContact CE2-CE1 3.91Å; Y104-H110 AromaticContact CE2-NE2 3.47Å; Y104-H110 WeakPolarHBondContact CE2-NE2 3.26Å; T108-H110 PolarHBondContact O-CE1 3.23Å; T108-H110 VanDerWaalsContact O-CE1 3.3Å; T108-H110 PolarHBondContact O-N 2.96Å; T108-H110 PolarHBondContact O-ND1 3.19Å; H110-R112 PolarHBondContact O-N 3.16Å
111	T	68.6	Low	70.8	Confident	94 Å²	94	123.4 Å²	123.4	58%	0.577	60%	0.602	S	S	*	*	S	Bend	trans	-55.2	131.4	171.5	65.3	0	0	0	0	108.2	D109 K113	D109-T111 VanDerWaalsContact C-N 3.31Å; D109-T111 VanDerWaalsContact OD1-CB 3.26Å; D109-T111 WeakPolarHBondContact OD1-CB 3.4Å; D109-T111 WeakPolarHBondContact OD1-CG2 3.02Å; D109-T111 PolarHBondContact OD1-N 3.27Å; D109-T111 PolarHBondContact OD1-OG1 3.13Å; D109-T111 PolarHBondContact OD2-OG1 3.38Å; T111-K113 PolarHBondContact O-N 3.13Å
112	R	65.4	Low	71.7	Confident	217 Å²	217	127.8 Å²	127.8	82%	0.819	62%	0.619	S	S	*	*			trans	-57.7	106.8	178.9	-173.1	174.8	79.8	116.9	-0.4	106.6	H110 R114	H110-R112 PolarHBondContact O-N 3.16Å; R112-R114 PolarHBondContact O-N 3.44Å
113	K	67.7	Low	72.9	Confident	144 Å²	144	125.7 Å²	125.7	63%	0.626	62%	0.621	S	S	*	*			trans	-49.4	123	168.8	-67.3	-165.4	178.6	-172.6	0	105.7	T111 F115	T111-K113 PolarHBondContact O-N 3.13Å; K113-F115 HydrophobicContact CB-CD2 4.35Å; K113-F115 HydrophobicContact CB-CE2 4.32Å; K113-F115 PolarHBondContact O-N 3.32Å
114	R	65.9	Low	73.7	Confident	223 Å²	223	126.8 Å²	126.8	84%	0.842	63%	0.627	S	S	*	*			trans	-62.5	92.8	169.1	-82.8	-165.9	170.4	-172.3	-1.4	105.7	R112 D116	R112-R114 PolarHBondContact O-N 3.44Å; R114-D116 PolarHBondContact O-N 3.41Å
115	F	66.6	Low	74.3	Confident	100 Å²	100	128.6 Å²	128.6	44%	0.439	63%	0.633	S	S	.	*			trans	-65.3	125.4	156.8	-84.4	-90.4	0	0	0	104.6	K113 V117	K113-F115 HydrophobicContact CB-CD2 4.35Å; K113-F115 HydrophobicContact CB-CE2 4.32Å; K113-F115 PolarHBondContact O-N 3.32Å; F115-V117 HydrophobicContact CB-CB 4.1Å; F115-V117 HydrophobicContact CB-CG2 3.87Å; F115-V117 HydrophobicContact CD1-CG2 4.29Å; F115-V117 PolarHBondContact O-N 3.38Å
116	D	73.5	Confident	74.7	Confident	164 Å²	164	130.8 Å²	130.8	88%	0.877	64%	0.641	S	S	*	*	S	Bend	trans	-65.8	22.8	170.5	-60.7	-48.5	0	0	0	112	R114 P118	R114-D116 PolarHBondContact O-N 3.41Å; D116-P118 WeakPolarHBondContact O-CD 3.41Å
117	V	71.5	Confident	74.6	Confident	105 Å²	105	128.5 Å²	128.5	64%	0.636	66%	0.659	S	S	*	*			trans	-79.6	115.7	175.4	176.8	0	0	0	0	107.1	F115	F115-V117 HydrophobicContact CB-CB 4.1Å; F115-V117 HydrophobicContact CB-CG2 3.87Å; F115-V117 HydrophobicContact CD1-CG2 4.29Å; F115-V117 PolarHBondContact O-N 3.38Å
118	P	77.9	Confident	74.5	Confident	103 Å²	103	128.3 Å²	128.3	67%	0.669	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-61.5	144.4	177.5	25.1	-32.6	0	0	0	109.9	D116 A120	D116-P118 WeakPolarHBondContact O-CD 3.41Å; P118-A120 PolarHBondContact O-N 3.13Å
119	P	75.1	Confident	74.8	Confident	125 Å²	125	132.8 Å²	132.8	81%	0.812	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-58.3	137.1	173.8	25.2	-32.6	0	0	0	109.7	N121	P119-N121 PolarHBondContact O-N 3.23Å
120	A	83	Confident	75	Confident	76 Å²	76	134.2 Å²	134.2	63%	0.628	68%	0.684	S	S	*	*	P	Polyproline II helix	trans	-60.7	127.4	178.5	0	0	0	0	0	110.1	P118 L122	P118-A120 PolarHBondContact O-N 3.13Å; A120-L122 PolarHBondContact O-N 3.07Å
121	N	83.7	Confident	75.4	Confident	87 Å²	87	136.6 Å²	136.6	47%	0.465	70%	0.698	S	S	.	*			trans	-72.8	99.9	174.7	-177.5	-12.1	0	0	0	109.6	P119 V123 L124	P119-N121 PolarHBondContact O-N 3.23Å; N121-V123 PolarHBondContact O-N 3.48Å; N121-V123 VanDerWaalsContact OD1-CB 3.23Å; N121-V123 WeakPolarHBondContact OD1-CB 3.46Å; N121-V123 WeakPolarHBondContact OD1-CG2 3.23Å; N121-V123 PolarHBondContact OD1-N 3.33Å; N121-L124 HydrophobicContact CB-CD1 4.06Å; N121-L124 HydrophobicContact CB-CG 4.15Å; N121-L124 PolarHBondContact O-N 3.28Å
122	L	86.5	Confident	75.8	Confident	121 Å²	121	139.3 Å²	139.3	63%	0.634	71%	0.706	S	S	*	*	G	3₁₀ helix	trans	-62.5	-21.9	-179.4	-60	-179.7	0	0	0	113.3	A120 L124 W125	A120-L122 PolarHBondContact O-N 3.07Å; L122-L124 VanDerWaalsContact C-N 3.25Å; L122-L124 PolarHBondContact O-N 3.11Å; L122-W125 WeakPolarHBondContact O-CB 3.5Å; L122-W125 PolarHBondContact O-N 3.27Å; L122-W125 VanDerWaalsContact O-N 3.13Å
123	V	83.6	Confident	76.5	Confident	105 Å²	105	134.1 Å²	134.1	64%	0.636	70%	0.699	S	S	*	*	G	3₁₀ helix	trans	-65.2	-32.1	179.3	-174.8	0	0	0	0	110.9	N121 W125 R126	N121-V123 PolarHBondContact O-N 3.48Å; N121-V123 VanDerWaalsContact OD1-CB 3.23Å; N121-V123 WeakPolarHBondContact OD1-CB 3.46Å; N121-V123 WeakPolarHBondContact OD1-CG2 3.23Å; N121-V123 PolarHBondContact OD1-N 3.33Å; V123-W125 PolarHBondContact O-N 3.49Å; V123-W125 VanDerWaalsContact O-N 3.13Å; V123-R126 PolarHBondContact O-N 3.33Å; V123-R126 VanDerWaalsContact O-N 3.16Å
124	L	81.5	Confident	77.1	Confident	111 Å²	111	133.4 Å²	133.4	58%	0.581	70%	0.704	S	S	*	*	G	3₁₀ helix	trans	-64.7	-17.2	176.6	-61.5	177	0	0	0	113.4	R45 N121 L122	R45-L124 PolarHBondContact NH2-O 3.46Å; N121-L124 HydrophobicContact CB-CD1 4.06Å; N121-L124 HydrophobicContact CB-CG 4.15Å; N121-L124 PolarHBondContact O-N 3.28Å; L122-L124 VanDerWaalsContact C-N 3.25Å; L122-L124 PolarHBondContact O-N 3.11Å
125	W	80.7	Confident	78	Confident	169 Å²	169	126.5 Å²	126.5	64%	0.64	69%	0.693	S	S	*	*	G	3₁₀ helix	trans	-98.4	-10.6	-179.2	-61.1	82	0	0	0	112.9	W49 L122 V123 S127	W49-W125 HydrophobicContact CH2-CZ3 4.04Å; W49-W125 HydrophobicContact CZ3-CZ3 4.19Å; L122-W125 WeakPolarHBondContact O-CB 3.5Å; L122-W125 PolarHBondContact O-N 3.27Å; L122-W125 VanDerWaalsContact O-N 3.13Å; V123-W125 PolarHBondContact O-N 3.49Å; V123-W125 VanDerWaalsContact O-N 3.13Å; W125-S127 PolarHBondContact O-N 2.94Å
126	R	79.7	Confident	78.9	Confident	202 Å²	202	128.7 Å²	128.7	76%	0.762	71%	0.714	S	S	*	*			trans	-86.4	106.7	172.3	-62.2	-171.9	-179.3	-169.9	-0.1	107.7	V123	V123-R126 PolarHBondContact O-N 3.33Å; V123-R126 VanDerWaalsContact O-N 3.16Å
127	S	70.5	Confident	79.4	Confident	176 Å²	176	125.5 Å²	125.5	100%	1.231	70%	0.699	S	S	*	*			trans	-73.5	0	169.7	54.9	0	0	0	0	111.5	W125	W125-S127 PolarHBondContact O-N 2.94Å

Retrieved 127 of 127 residues in 78.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).