A0A023IPD5_HUMAN Loading...

Integrin b7 subunit

AlphaFold DB , UniProt , Accession A0A023IPD5, Species HUMAN (Homo sapiens, Human), Gene ITGB7, Length 50 aa.

						>A0A023IPD5_HUMAN|A0A023IPD5|ITGB7
QAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Q	61.5	Low	88.4	Confident	207 Å²	207	97.2 Å²	97.2	97%	0.967	60%	0.601	S	S	*	*				0	-25.2	0	-93.6	177.5	-5	0	0	114.5	I3 V4 L5	Q1-I3 VanDerWaalsContact C-N 3.28Å; Q1-I3 PolarHBondContact O-N 3.35Å; Q1-V4 PolarHBondContact O-N 3.22Å; Q1-V4 VanDerWaalsContact O-N 3.17Å; Q1-L5 PolarHBondContact O-N 3.25Å
2	A	75.1	Confident	89.1	Confident	83 Å²	83	95.8 Å²	95.8	69%	0.686	59%	0.591	S	S	*	*	H	α-helix	trans	-56.1	-34.2	-177.3	0	0	0	0	0	115.3	L5 G6	A2-L5 PolarHBondContact O-N 3.13Å; A2-G6 PolarHBondContact O-N 3.46Å
3	I	85.8	Confident	89.7	Confident	142 Å²	142	93 Å²	93	73%	0.728	58%	0.584	S	S	*	*	H	α-helix	trans	-65.2	-41.9	179.7	-56.7	172.6	0	0	0	111.2	Q1 G6 C7	Q1-I3 VanDerWaalsContact C-N 3.28Å; Q1-I3 PolarHBondContact O-N 3.35Å; I3-G6 PolarHBondContact O-N 3.3Å; I3-C7 PolarHBondContact O-N 3.19Å; I3-C7 PolarHBondContact O-SG 3.39Å
4	V	90.4	Very high	90.2	Very high	98 Å²	98	93 Å²	93	59%	0.594	58%	0.582	S	S	*	*	H	α-helix	trans	-66.2	-43.1	179.9	-178.2	0	0	0	0	110.3	Q1 G6 C7 V8	Q1-V4 PolarHBondContact O-N 3.22Å; Q1-V4 VanDerWaalsContact O-N 3.17Å; V4-G6 VanDerWaalsContact C-N 3.34Å; V4-G6 PolarHBondContact O-N 3.04Å; V4-C7 PolarHBondContact O-N 2.92Å; V4-V8 HydrophobicContact CG1-CG2 4.41Å; V4-V8 VanDerWaalsContact O-CG2 3.24Å; V4-V8 WeakPolarHBondContact O-CG2 3.29Å; V4-V8 PolarHBondContact O-N 3.4Å
5	L	89.6	Confident	90.7	Very high	127 Å²	127	89 Å²	89	67%	0.665	57%	0.566	S	S	*	*	H	α-helix	trans	-63.3	-39.6	176.5	-72	165.7	0	0	0	112.1	Q1 A2 G9	Q1-L5 PolarHBondContact O-N 3.25Å; A2-L5 PolarHBondContact O-N 3.13Å; L5-G9 PolarHBondContact O-N 3.47Å
6	G	91.2	Very high	91.1	Very high	50 Å²	50	90 Å²	90	52%	0.515	57%	0.565	S	S	.	*	H	α-helix	trans	-64.6	-45.3	174.4	0	0	0	0	0	112.8	A2 I3 V4 G9 G10	A2-G6 PolarHBondContact O-N 3.46Å; I3-G6 PolarHBondContact O-N 3.3Å; V4-G6 VanDerWaalsContact C-N 3.34Å; V4-G6 PolarHBondContact O-N 3.04Å; G6-G9 PolarHBondContact O-N 2.88Å; G6-G10 PolarHBondContact O-N 3.3Å
7	C	94.5	Very high	91.4	Very high	76 Å²	76	87.1 Å²	87.1	51%	0.514	56%	0.556	S	S	.	*	H	α-helix	trans	-61.9	-46	176.9	-78	0	0	0	0	112.1	I3 V4 G10 I11	I3-C7 PolarHBondContact O-N 3.19Å; I3-C7 PolarHBondContact O-SG 3.39Å; V4-C7 PolarHBondContact O-N 2.92Å; C7-G10 PolarHBondContact O-N 3.44Å; C7-I11 WeakPolarHBondContact O-CG1 3.48Å; C7-I11 PolarHBondContact O-N 3.45Å
8	V	95.5	Very high	91.8	Very high	82 Å²	82	88.7 Å²	88.7	50%	0.497	56%	0.559	S	S	.	*	H	α-helix	trans	-62.9	-45.2	178.2	174.5	0	0	0	0	110.4	V4 G10 I11 V12	V4-V8 HydrophobicContact CG1-CG2 4.41Å; V4-V8 VanDerWaalsContact O-CG2 3.24Å; V4-V8 WeakPolarHBondContact O-CG2 3.29Å; V4-V8 PolarHBondContact O-N 3.4Å; V8-G10 VanDerWaalsContact C-N 3.32Å; V8-G10 PolarHBondContact O-N 3.41Å; V8-I11 PolarHBondContact O-N 2.93Å; V8-V12 HydrophobicContact CG1-CG2 4.46Å; V8-V12 VanDerWaalsContact O-CG2 3.29Å; V8-V12 WeakPolarHBondContact O-CG2 3.47Å; V8-V12 PolarHBondContact O-N 2.94Å
9	G	95.9	Very high	92	Very high	40 Å²	40	88.6 Å²	88.6	41%	0.412	56%	0.557	S	S	.	*	H	α-helix	trans	-59.3	-41.8	176.3	0	0	0	0	0	112.9	L5 G6 V12 A13	L5-G9 PolarHBondContact O-N 3.47Å; G6-G9 PolarHBondContact O-N 2.88Å; G9-V12 PolarHBondContact O-N 3.32Å; G9-A13 WeakPolarHBondContact O-CB 3.29Å; G9-A13 PolarHBondContact O-N 3.22Å
10	G	95.9	Very high	92.2	Very high	36 Å²	36	89.7 Å²	89.7	37%	0.371	56%	0.558	S	S	.	*	H	α-helix	trans	-63.2	-47.1	177.2	0	0	0	0	0	113	G6 C7 V8 V12 A13 V14	G6-G10 PolarHBondContact O-N 3.3Å; C7-G10 PolarHBondContact O-N 3.44Å; V8-G10 VanDerWaalsContact C-N 3.32Å; V8-G10 PolarHBondContact O-N 3.41Å; G10-V12 VanDerWaalsContact C-N 3.33Å; G10-V12 PolarHBondContact O-N 3.49Å; G10-A13 PolarHBondContact O-N 2.92Å; G10-V14 VanDerWaalsContact O-CG2 3.32Å; G10-V14 WeakPolarHBondContact O-CG2 3.42Å; G10-V14 PolarHBondContact O-N 3.22Å
11	I	96.8	Very high	92.4	Very high	128 Å²	128	87.8 Å²	87.8	66%	0.656	55%	0.551	S	S	*	*	H	α-helix	trans	-61.9	-43.6	179.2	-65.7	163.7	0	0	0	110.7	C7 V8 V14 G15	C7-I11 WeakPolarHBondContact O-CG1 3.48Å; C7-I11 PolarHBondContact O-N 3.45Å; V8-I11 PolarHBondContact O-N 2.93Å; I11-V14 PolarHBondContact O-N 3.17Å; I11-G15 PolarHBondContact O-N 2.89Å
12	V	96.8	Very high	94	Very high	80 Å²	80	85.6 Å²	85.6	49%	0.485	54%	0.535	S	S	.	.	H	α-helix	trans	-63.6	-43.3	178.4	173.6	0	0	0	0	111.1	V8 G9 G10 G15 L16	V8-V12 HydrophobicContact CG1-CG2 4.46Å; V8-V12 VanDerWaalsContact O-CG2 3.29Å; V8-V12 WeakPolarHBondContact O-CG2 3.47Å; V8-V12 PolarHBondContact O-N 2.94Å; G9-V12 PolarHBondContact O-N 3.32Å; G10-V12 VanDerWaalsContact C-N 3.33Å; G10-V12 PolarHBondContact O-N 3.49Å; V12-G15 PolarHBondContact O-N 3.47Å; V12-L16 HydrophobicContact CG1-CD1 3.95Å; V12-L16 WeakPolarHBondContact O-CB 3.5Å; V12-L16 WeakPolarHBondContact O-CG 3.46Å; V12-L16 PolarHBondContact O-N 3.41Å
13	A	96.9	Very high	94.8	Very high	60 Å²	60	90.3 Å²	90.3	50%	0.496	54%	0.536	S	S	.	.	H	α-helix	trans	-63.1	-42.8	177.8	0	0	0	0	0	112.3	G9 G10 L16 G17	G9-A13 WeakPolarHBondContact O-CB 3.29Å; G9-A13 PolarHBondContact O-N 3.22Å; G10-A13 PolarHBondContact O-N 2.92Å; A13-L16 PolarHBondContact O-N 3.02Å; A13-G17 PolarHBondContact O-N 2.99Å
14	V	97.3	Very high	95.1	Very high	93 Å²	93	88.5 Å²	88.5	56%	0.564	53%	0.527	S	S	*	.	H	α-helix	trans	-65	-44.5	176.6	173	0	0	0	0	111	G10 I11 L16 G17 L18	G10-V14 VanDerWaalsContact O-CG2 3.32Å; G10-V14 WeakPolarHBondContact O-CG2 3.42Å; G10-V14 PolarHBondContact O-N 3.22Å; I11-V14 PolarHBondContact O-N 3.17Å; V14-L16 PolarHBondContact O-N 3.36Å; V14-G17 PolarHBondContact O-N 3.36Å; V14-L18 HydrophobicContact CG1-CD1 4.11Å; V14-L18 PolarHBondContact O-N 3.36Å
15	G	96.9	Very high	95.2	Very high	33 Å²	33	87.6 Å²	87.6	34%	0.34	52%	0.524	S	S	.	.	H	α-helix	trans	-60	-44.8	176.3	0	0	0	0	0	112.4	I11 V12 L18 V19	I11-G15 PolarHBondContact O-N 2.89Å; V12-G15 PolarHBondContact O-N 3.47Å; G15-L18 PolarHBondContact O-N 3.11Å; G15-V19 VanDerWaalsContact O-CG2 3.31Å; G15-V19 WeakPolarHBondContact O-CG2 3.29Å; G15-V19 PolarHBondContact O-N 3.35Å
16	L	97.1	Very high	95.3	Very high	105 Å²	105	84.7 Å²	84.7	55%	0.55	51%	0.512	S	S	.	.	H	α-helix	trans	-61.8	-43.5	175.3	-81.5	166.8	0	0	0	112.2	V12 A13 V14 L18 V19 L20	V12-L16 HydrophobicContact CG1-CD1 3.95Å; V12-L16 WeakPolarHBondContact O-CB 3.5Å; V12-L16 WeakPolarHBondContact O-CG 3.46Å; V12-L16 PolarHBondContact O-N 3.41Å; A13-L16 PolarHBondContact O-N 3.02Å; V14-L16 PolarHBondContact O-N 3.36Å; L16-L18 PolarHBondContact O-N 3.06Å; L16-V19 PolarHBondContact O-N 2.86Å; L16-L20 WeakPolarHBondContact O-CG 3.49Å; L16-L20 PolarHBondContact O-N 3.23Å
17	G	97.4	Very high	95.1	Very high	40 Å²	40	88.8 Å²	88.8	41%	0.412	52%	0.518	S	S	.	.	H	α-helix	trans	-60	-44.9	176.5	0	0	0	0	0	112.7	A13 V14 L20 A21	A13-G17 PolarHBondContact O-N 2.99Å; V14-G17 PolarHBondContact O-N 3.36Å; G17-L20 PolarHBondContact O-N 2.92Å; G17-A21 WeakPolarHBondContact O-CB 2.87Å; G17-A21 PolarHBondContact O-N 3.39Å
18	L	97	Very high	94.7	Very high	117 Å²	117	89.9 Å²	89.9	61%	0.613	52%	0.518	S	S	*	.	H	α-helix	trans	-63.7	-43.2	176.5	-82.7	163.9	0	0	0	112.4	V14 G15 L16 A21 Y22	V14-L18 HydrophobicContact CG1-CD1 4.11Å; V14-L18 PolarHBondContact O-N 3.36Å; G15-L18 PolarHBondContact O-N 3.11Å; L16-L18 PolarHBondContact O-N 3.06Å; L18-A21 PolarHBondContact O-N 3.44Å; L18-Y22 WeakPolarHBondContact O-CB 3.32Å; L18-Y22 PolarHBondContact O-N 2.95Å
19	V	96.4	Very high	94.1	Very high	86 Å²	86	93.6 Å²	93.6	52%	0.521	52%	0.524	S	S	.	.	H	α-helix	trans	-63.5	-42.7	178.3	169.1	0	0	0	0	111.3	G15 L16 Y22 R23	G15-V19 VanDerWaalsContact O-CG2 3.31Å; G15-V19 WeakPolarHBondContact O-CG2 3.29Å; G15-V19 PolarHBondContact O-N 3.35Å; L16-V19 PolarHBondContact O-N 2.86Å; V19-Y22 PolarHBondContact O-N 3.45Å; V19-R23 WeakPolarHBondContact O-CB 3.21Å; V19-R23 WeakPolarHBondContact O-CG 3.41Å; V19-R23 PolarHBondContact O-N 2.86Å
20	L	95.6	Very high	93.3	Very high	111 Å²	111	96.8 Å²	96.8	58%	0.581	53%	0.531	S	S	*	.	H	α-helix	trans	-64.9	-45.3	176.5	-74.2	172	0	0	0	111.6	L16 G17 Y22 R23 L24	L16-L20 WeakPolarHBondContact O-CG 3.49Å; L16-L20 PolarHBondContact O-N 3.23Å; G17-L20 PolarHBondContact O-N 2.92Å; L20-Y22 VanDerWaalsContact C-N 3.31Å; L20-Y22 PolarHBondContact O-N 3.41Å; L20-R23 PolarHBondContact O-N 2.97Å; L20-L24 WeakPolarHBondContact O-CG 3.32Å; L20-L24 PolarHBondContact O-N 3.45Å
21	A	96.1	Very high	92.4	Very high	50 Å²	50	104.5 Å²	104.5	41%	0.413	55%	0.549	S	S	.	.	H	α-helix	trans	-58.2	-45.7	175.6	0	0	0	0	0	111	G17 L18 L24 S25	G17-A21 WeakPolarHBondContact O-CB 2.87Å; G17-A21 PolarHBondContact O-N 3.39Å; L18-A21 PolarHBondContact O-N 3.44Å; A21-L24 PolarHBondContact O-N 3.41Å; A21-S25 WeakPolarHBondContact O-CB 3.46Å; A21-S25 PolarHBondContact O-N 3.06Å; A21-S25 PolarHBondContact O-OG 3.35Å
22	Y	95.4	Very high	91.4	Very high	160 Å²	160	107.7 Å²	107.7	63%	0.627	55%	0.553	S	S	*	*	H	α-helix	trans	-61.7	-46.3	176.8	178.9	-102.8	0	0	0	112.4	L18 V19 L20 L24 S25 V26	L18-Y22 WeakPolarHBondContact O-CB 3.32Å; L18-Y22 PolarHBondContact O-N 2.95Å; V19-Y22 PolarHBondContact O-N 3.45Å; L20-Y22 VanDerWaalsContact C-N 3.31Å; L20-Y22 PolarHBondContact O-N 3.41Å; Y22-L24 VanDerWaalsContact C-N 3.34Å; Y22-L24 PolarHBondContact O-N 2.9Å; Y22-S25 PolarHBondContact O-N 3.18Å; Y22-V26 HydrophobicContact CD1-CG2 4.2Å; Y22-V26 HydrophobicContact CD2-CG2 4.21Å; Y22-V26 HydrophobicContact CE1-CG2 3.76Å; Y22-V26 HydrophobicContact CE2-CG2 3.77Å; Y22-V26 HydrophobicContact CG-CG2 4.41Å; Y22-V26 WeakPolarHBondContact O-CB 3.4Å; Y22-V26 WeakPolarHBondContact O-CG2 3.37Å; Y22-V26 PolarHBondContact O-N 3.41Å
23	R	93.3	Very high	90.4	Very high	183 Å²	183	108.4 Å²	108.4	69%	0.691	55%	0.551	S	S	*	*	H	α-helix	trans	-56.7	-46.8	176.7	-82.4	-75.7	-169.3	170.1	0.9	111.8	V19 L20 V26 E27	V19-R23 WeakPolarHBondContact O-CB 3.21Å; V19-R23 WeakPolarHBondContact O-CG 3.41Å; V19-R23 PolarHBondContact O-N 2.86Å; L20-R23 PolarHBondContact O-N 2.97Å; R23-V26 PolarHBondContact O-N 3.41Å; R23-E27 WeakPolarHBondContact O-CB 3.31Å; R23-E27 PolarHBondContact O-N 3.29Å
24	L	91.6	Very high	89	Confident	104 Å²	104	112.6 Å²	112.6	55%	0.545	56%	0.555	S	S	.	*	H	α-helix	trans	-65.9	-43.2	177.2	-68.6	174.2	0	0	0	111.8	L20 A21 Y22 V26 E27 I28	L20-L24 WeakPolarHBondContact O-CG 3.32Å; L20-L24 PolarHBondContact O-N 3.45Å; A21-L24 PolarHBondContact O-N 3.41Å; Y22-L24 VanDerWaalsContact C-N 3.34Å; Y22-L24 PolarHBondContact O-N 2.9Å; L24-V26 VanDerWaalsContact C-N 3.33Å; L24-V26 PolarHBondContact O-N 3.38Å; L24-E27 PolarHBondContact O-N 3.24Å; L24-I28 WeakPolarHBondContact O-CB 3.4Å; L24-I28 WeakPolarHBondContact O-CD1 3.19Å; L24-I28 WeakPolarHBondContact O-CG1 3.45Å; L24-I28 PolarHBondContact O-N 2.89Å
25	S	92.6	Very high	87.9	Confident	78 Å²	78	110.9 Å²	110.9	55%	0.545	55%	0.547	S	S	.	.	H	α-helix	trans	-58.8	-45.1	176.1	-68	0	0	0	0	111.5	A21 Y22 Y29	A21-S25 WeakPolarHBondContact O-CB 3.46Å; A21-S25 PolarHBondContact O-N 3.06Å; A21-S25 PolarHBondContact O-OG 3.35Å; Y22-S25 PolarHBondContact O-N 3.18Å; S25-Y29 WeakPolarHBondContact O-CB 3.39Å; S25-Y29 PolarHBondContact O-N 3.03Å
26	V	90.2	Very high	87	Confident	67 Å²	67	118.1 Å²	118.1	41%	0.406	56%	0.564	S	S	.	*	H	α-helix	trans	-64.2	-46.8	177.2	170.6	0	0	0	0	110.9	Y22 R23 L24 I28 Y29 D30	Y22-V26 HydrophobicContact CD1-CG2 4.2Å; Y22-V26 HydrophobicContact CD2-CG2 4.21Å; Y22-V26 HydrophobicContact CE1-CG2 3.76Å; Y22-V26 HydrophobicContact CE2-CG2 3.77Å; Y22-V26 HydrophobicContact CG-CG2 4.41Å; Y22-V26 WeakPolarHBondContact O-CB 3.4Å; Y22-V26 WeakPolarHBondContact O-CG2 3.37Å; Y22-V26 PolarHBondContact O-N 3.41Å; R23-V26 PolarHBondContact O-N 3.41Å; L24-V26 VanDerWaalsContact C-N 3.33Å; L24-V26 PolarHBondContact O-N 3.38Å; V26-I28 VanDerWaalsContact C-N 3.34Å; V26-I28 PolarHBondContact O-N 2.99Å; V26-Y29 PolarHBondContact O-N 2.86Å; V26-D30 WeakPolarHBondContact O-CB 3.39Å; V26-D30 PolarHBondContact O-N 2.91Å
27	E	88.4	Confident	85.9	Confident	135 Å²	135	119 Å²	119	63%	0.631	56%	0.564	S	S	*	*	H	α-helix	trans	-64.7	-37.4	-179.1	-170.9	164.5	106.7	0	0	112.8	R23 L24 R31	R23-E27 WeakPolarHBondContact O-CB 3.31Å; R23-E27 PolarHBondContact O-N 3.29Å; L24-E27 PolarHBondContact O-N 3.24Å; E27-R31 PolarHBondContact O-N 3.43Å
28	I	85.4	Confident	84.8	Confident	100 Å²	100	122.6 Å²	122.6	51%	0.513	57%	0.57	S	S	.	*	H	α-helix	trans	-70.3	-40.7	174.8	-67	166.1	0	0	0	111	L24 V26 D30 R31 R32	L24-I28 WeakPolarHBondContact O-CB 3.4Å; L24-I28 WeakPolarHBondContact O-CD1 3.19Å; L24-I28 WeakPolarHBondContact O-CG1 3.45Å; L24-I28 PolarHBondContact O-N 2.89Å; V26-I28 VanDerWaalsContact C-N 3.34Å; V26-I28 PolarHBondContact O-N 2.99Å; I28-D30 VanDerWaalsContact C-N 3.35Å; I28-R31 PolarHBondContact O-N 2.9Å; I28-R32 PolarHBondContact O-N 2.98Å
29	Y	82.3	Confident	83.7	Confident	159 Å²	159	123.8 Å²	123.8	62%	0.624	57%	0.57	S	S	*	*	H	α-helix	trans	-62.2	-46.8	178.2	-167	-102	0	0	0	110.5	S25 V26 R31 R32 E33	S25-Y29 WeakPolarHBondContact O-CB 3.39Å; S25-Y29 PolarHBondContact O-N 3.03Å; V26-Y29 PolarHBondContact O-N 2.86Å; Y29-R31 PolarHBondContact O-N 3.48Å; Y29-R32 PolarHBondContact O-N 3.38Å; Y29-E33 WeakPolarHBondContact CD1-OE2 3.38Å; Y29-E33 WeakPolarHBondContact CE1-OE2 3.39Å; Y29-E33 PolarHBondContact O-N 3.38Å
30	D	80.1	Confident	82.8	Confident	108 Å²	108	125 Å²	125	58%	0.578	57%	0.57	S	S	*	*	H	α-helix	trans	-57.6	-48.6	175.8	-161.3	69	0	0	0	111	V26 I28 R32 E33 Y34	V26-D30 WeakPolarHBondContact O-CB 3.39Å; V26-D30 PolarHBondContact O-N 2.91Å; I28-D30 VanDerWaalsContact C-N 3.35Å; D30-R32 PolarHBondContact O-N 3.45Å; D30-E33 PolarHBondContact O-N 2.9Å; D30-Y34 VanDerWaalsContact O-CB 3.29Å; D30-Y34 WeakPolarHBondContact O-CB 3.45Å; D30-Y34 PolarHBondContact O-N 3.35Å
31	R	77.5	Confident	81.8	Confident	198 Å²	198	126.1 Å²	126.1	75%	0.747	57%	0.572	S	S	*	*	H	α-helix	trans	-60.9	-39.2	175.9	-101.7	-167.2	-167	-109.4	4.2	114.2	E27 I28 Y29 Y34 S35	E27-R31 PolarHBondContact O-N 3.43Å; I28-R31 PolarHBondContact O-N 2.9Å; Y29-R31 PolarHBondContact O-N 3.48Å; R31-Y34 PolarHBondContact O-N 3.39Å; R31-S35 PolarHBondContact O-N 3.49Å
32	R	75.7	Confident	80.7	Confident	194 Å²	194	130.9 Å²	130.9	73%	0.732	59%	0.586	S	S	*	*	H	α-helix	trans	-70.3	-41	-178.1	-87.3	-163.7	176.9	177	1.6	111.6	I28 Y29 D30 R36	I28-R32 PolarHBondContact O-N 2.98Å; Y29-R32 PolarHBondContact O-N 3.38Å; D30-R32 PolarHBondContact O-N 3.45Å; R32-R36 PolarHBondContact O-N 2.98Å
33	E	74.4	Confident	79.6	Confident	95 Å²	95	129.6 Å²	129.6	44%	0.444	59%	0.586	S	S	.	*	H	α-helix	trans	-66	-41.8	172.2	-91.4	-171.7	92.6	0	0	111.3	Y29 D30 S35 R36 F37	Y29-E33 WeakPolarHBondContact CD1-OE2 3.38Å; Y29-E33 WeakPolarHBondContact CE1-OE2 3.39Å; Y29-E33 PolarHBondContact O-N 3.38Å; D30-E33 PolarHBondContact O-N 2.9Å; E33-S35 VanDerWaalsContact C-N 3.34Å; E33-S35 PolarHBondContact O-N 3.45Å; E33-R36 PolarHBondContact O-N 2.98Å; E33-R36 VanDerWaalsContact O-N 3.11Å; E33-F37 PolarHBondContact O-N 3.48Å
34	Y	68.1	Low	78.5	Confident	149 Å²	149	126.6 Å²	126.6	58%	0.584	58%	0.583	S	S	*	*	H	α-helix	trans	-58	-44.8	179.1	-150.1	-89.5	0	0	0	112.4	D30 R31 R36 F37 E38	D30-Y34 VanDerWaalsContact O-CB 3.29Å; D30-Y34 WeakPolarHBondContact O-CB 3.45Å; D30-Y34 PolarHBondContact O-N 3.35Å; R31-Y34 PolarHBondContact O-N 3.39Å; Y34-R36 VanDerWaalsContact C-N 3.32Å; Y34-R36 PolarHBondContact O-N 2.95Å; Y34-F37 PolarHBondContact O-N 3.44Å; Y34-E38 HydrophobicContact CD1-CG 4.18Å; Y34-E38 HydrophobicContact CE1-CG 4.15Å; Y34-E38 PolarHBondContact O-N 3.39Å
35	S	74.4	Confident	77.2	Confident	56 Å²	56	127.1 Å²	127.1	39%	0.392	59%	0.586	S	S	.	*	H	α-helix	trans	-68.8	-28.8	179.4	-171.8	0	0	0	0	113.3	R31 E33 K39	R31-S35 PolarHBondContact O-N 3.49Å; E33-S35 VanDerWaalsContact C-N 3.34Å; E33-S35 PolarHBondContact O-N 3.45Å; S35-K39 VanDerWaalsContact O-CG 3.29Å; S35-K39 WeakPolarHBondContact O-CG 3.24Å; S35-K39 PolarHBondContact O-N 2.99Å
36	R	77.1	Confident	75.9	Confident	186 Å²	186	133.4 Å²	133.4	70%	0.702	60%	0.598	S	S	*	*	H	α-helix	trans	-71.3	-44.1	171	-86.9	-168	137.2	-134.4	-3.3	111.1	R32 E33 Y34 E38 K39 E40	R32-R36 PolarHBondContact O-N 2.98Å; E33-R36 PolarHBondContact O-N 2.98Å; E33-R36 VanDerWaalsContact O-N 3.11Å; Y34-R36 VanDerWaalsContact C-N 3.32Å; Y34-R36 PolarHBondContact O-N 2.95Å; R36-E38 PolarHBondContact O-N 2.96Å; R36-K39 PolarHBondContact O-N 3.27Å; R36-E40 WeakPolarHBondContact O-CG 3.29Å; R36-E40 PolarHBondContact O-N 3.06Å
37	F	75.8	Confident	74.5	Confident	124 Å²	124	137.5 Å²	137.5	54%	0.544	61%	0.61	S	S	.	*	H	α-helix	trans	-60.1	-43.4	178.1	-115.1	-83.1	0	0	0	112.6	E33 Y34 K39 E40 Q41	E33-F37 PolarHBondContact O-N 3.48Å; Y34-F37 PolarHBondContact O-N 3.44Å; F37-K39 PolarHBondContact O-N 3.36Å; F37-E40 PolarHBondContact O-N 3.04Å; F37-Q41 PolarHBondContact O-N 3.4Å
38	E	73.9	Confident	73.4	Confident	114 Å²	114	139.1 Å²	139.1	53%	0.533	62%	0.618	S	S	.	*	H	α-helix	trans	-62.3	-42.8	176	-79.9	-173	96	0	0	111.9	Y34 R36 E40 Q41 Q42	Y34-E38 HydrophobicContact CD1-CG 4.18Å; Y34-E38 HydrophobicContact CE1-CG 4.15Å; Y34-E38 PolarHBondContact O-N 3.39Å; R36-E38 PolarHBondContact O-N 2.96Å; E38-E40 VanDerWaalsContact C-N 3.32Å; E38-E40 PolarHBondContact O-N 2.97Å; E38-Q41 PolarHBondContact O-N 3.29Å; E38-Q42 WeakPolarHBondContact O-CB 3.4Å; E38-Q42 PolarHBondContact O-N 3.43Å
39	K	74.1	Confident	72.1	Confident	142 Å²	142	141.6 Å²	141.6	62%	0.617	63%	0.632	S	S	*	*	H	α-helix	trans	-63.3	-38.7	177.3	-74.4	176.8	-178.8	-176.1	0	112.1	S35 R36 F37 Q43	S35-K39 VanDerWaalsContact O-CG 3.29Å; S35-K39 WeakPolarHBondContact O-CG 3.24Å; S35-K39 PolarHBondContact O-N 2.99Å; R36-K39 PolarHBondContact O-N 3.27Å; F37-K39 PolarHBondContact O-N 3.36Å; K39-Q43 WeakPolarHBondContact O-CB 3.42Å; K39-Q43 PolarHBondContact O-N 3.34Å; K39-Q43 VanDerWaalsContact O-N 3.17Å
40	E	76.4	Confident	70.7	Confident	112 Å²	112	141.4 Å²	141.4	52%	0.523	65%	0.654	S	S	.	*	H	α-helix	trans	-68.2	-42.1	175.8	-70	-172.9	117.4	0	0	111.7	R36 F37 E38 Q43 L44	R36-E40 WeakPolarHBondContact O-CG 3.29Å; R36-E40 PolarHBondContact O-N 3.06Å; F37-E40 PolarHBondContact O-N 3.04Å; E38-E40 VanDerWaalsContact C-N 3.32Å; E38-E40 PolarHBondContact O-N 2.97Å; E40-Q43 PolarHBondContact O-N 3.47Å; E40-L44 VanDerWaalsContact O-CG 3.29Å; E40-L44 WeakPolarHBondContact O-CG 3.32Å; E40-L44 PolarHBondContact O-N 2.95Å
41	Q	75.5	Confident	70.2	Confident	135 Å²	135	143.1 Å²	143.1	63%	0.631	66%	0.658	S	S	*	*	H	α-helix	trans	-63.1	-42.3	174.1	-76.2	-152	49.4	0	0	113	F37 E38 Q43 L44 N45	F37-Q41 PolarHBondContact O-N 3.4Å; E38-Q41 PolarHBondContact O-N 3.29Å; Q41-Q43 VanDerWaalsContact C-N 3.3Å; Q41-Q43 PolarHBondContact O-N 3.33Å; Q41-L44 PolarHBondContact O-N 2.98Å; Q41-N45 WeakPolarHBondContact O-CB 3.33Å; Q41-N45 PolarHBondContact O-N 3.17Å
42	Q	72.6	Confident	69.8	Low	150 Å²	150	140.2 Å²	140.2	70%	0.701	65%	0.653	S	S	*	*	H	α-helix	trans	-63.7	-38.3	-180	-133.7	-179.9	-22.5	0	0	111.6	E38 W46	E38-Q42 WeakPolarHBondContact O-CB 3.4Å; E38-Q42 PolarHBondContact O-N 3.43Å; Q42-W46 PolarHBondContact O-N 2.92Å; Q42-W46 VanDerWaalsContact O-N 3.13Å
43	Q	73.1	Confident	69.5	Low	132 Å²	132	137.2 Å²	137.2	62%	0.617	65%	0.649	S	S	*	*	H	α-helix	trans	-72.2	-33.1	177.2	-161.4	-174	-97.4	0	0	112.6	K39 E40 Q41 K47	K39-Q43 WeakPolarHBondContact O-CB 3.42Å; K39-Q43 PolarHBondContact O-N 3.34Å; K39-Q43 VanDerWaalsContact O-N 3.17Å; E40-Q43 PolarHBondContact O-N 3.47Å; Q41-Q43 VanDerWaalsContact C-N 3.3Å; Q41-Q43 PolarHBondContact O-N 3.33Å; Q43-K47 PolarHBondContact O-N 2.93Å
44	L	69.9	Low	69.2	Low	120 Å²	120	139.6 Å²	139.6	63%	0.628	66%	0.661	S	S	*	*	H	α-helix	trans	-68.2	-42.5	173.1	-73.2	165.8	0	0	0	111.3	E40 Q41 W46 K47 Q48	E40-L44 VanDerWaalsContact O-CG 3.29Å; E40-L44 WeakPolarHBondContact O-CG 3.32Å; E40-L44 PolarHBondContact O-N 2.95Å; Q41-L44 PolarHBondContact O-N 2.98Å; L44-W46 VanDerWaalsContact C-N 3.35Å; L44-W46 PolarHBondContact O-N 3.31Å; L44-K47 PolarHBondContact O-N 3.34Å; L44-Q48 PolarHBondContact O-N 3.39Å
45	N	63.5	Low	69.3	Low	116 Å²	116	139.1 Å²	139.1	62%	0.62	67%	0.666	S	S	*	*	H	α-helix	trans	-64.2	-39.6	178.8	-153.7	10.4	0	0	0	111.7	Q41 K47 Q48 D49	Q41-N45 WeakPolarHBondContact O-CB 3.33Å; Q41-N45 PolarHBondContact O-N 3.17Å; N45-K47 VanDerWaalsContact C-N 3.27Å; N45-K47 PolarHBondContact O-N 3.49Å; N45-Q48 PolarHBondContact O-N 2.96Å; N45-D49 PolarHBondContact O-N 3.21Å
46	W	64.8	Low	68.9	Low	210 Å²	210	144.6 Å²	144.6	80%	0.795	68%	0.684	S	S	*	*	H	α-helix	trans	-61.3	-31.9	175.8	-174.9	-91.2	0	0	0	113.7	Q42 L44	Q42-W46 PolarHBondContact O-N 2.92Å; Q42-W46 VanDerWaalsContact O-N 3.13Å; L44-W46 VanDerWaalsContact C-N 3.35Å; L44-W46 PolarHBondContact O-N 3.31Å
47	K	62.7	Low	68.3	Low	152 Å²	152	141.6 Å²	141.6	66%	0.661	68%	0.683	S	S	*	*	H	α-helix	trans	-79.7	-19.2	178.8	-74.2	-170	176.5	-169.5	0	113.9	Q43 L44 N45	Q43-K47 PolarHBondContact O-N 2.93Å; L44-K47 PolarHBondContact O-N 3.34Å; N45-K47 VanDerWaalsContact C-N 3.27Å; N45-K47 PolarHBondContact O-N 3.49Å
48	Q	64.5	Low	67.8	Low	169 Å²	169	143 Å²	143	79%	0.79	69%	0.693	S	S	*	*	H	α-helix	trans	-93.4	-18.8	-177.3	-168.1	162.9	-54.5	0	0	112.7	L44 N45	L44-Q48 PolarHBondContact O-N 3.39Å; N45-Q48 PolarHBondContact O-N 2.96Å
49	D	58.9	Low	67.3	Low	153 Å²	153	145.4 Å²	145.4	82%	0.818	71%	0.707	S	S	*	*			trans	-90.9	-5	178.6	-161.7	-116.6	0	0	0	113.6	N45	N45-D49 PolarHBondContact O-N 3.21Å
50	S	51.3	Low	66.6	Low	154 Å²	154	145.7 Å²	145.7	100%	1.077	72%	0.715	S	S	*	*			trans	-108.4	0	176.3	-173.8	0	0	0	0	112.5

Retrieved 50 of 50 residues in 26.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).